RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= 537021.9.peg.97_1 (55 letters) >3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation termination, ATP-binding, cytoplasm, hydrolase, membrane; 2.80A {Schizosaccharomyces pombe} Length = 508 Score = 24.7 bits (53), Expect = 4.8 Identities = 6/17 (35%), Positives = 14/17 (82%) Query: 34 FNILIDIWRFLNIGKNI 50 +N+L++++ L IG++I Sbjct: 345 YNVLVELYGLLTIGQSI 361 >2rjp_A Adamts-4; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: 886; 2.80A {Homo sapiens} PDB: 3b2z_A Length = 316 Score = 24.4 bits (52), Expect = 6.1 Identities = 2/41 (4%), Positives = 11/41 (26%) Query: 10 LAIICKKREMNDLKLDIKAVVSVFFNILIDIWRFLNIGKNI 50 ++ + +K + ++ +I + Sbjct: 10 TLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPV 50 >2v4b_A Adamts-1; zinc, zymogen, protease, hydrolase, metalloprotease, heparin-binding, metalloproteinase, metzincin, polymorphism, glycoprotein; 2.00A {Homo sapiens} PDB: 2jih_A Length = 300 Score = 24.5 bits (52), Expect = 6.6 Identities = 3/41 (7%), Positives = 16/41 (39%) Query: 10 LAIICKKREMNDLKLDIKAVVSVFFNILIDIWRFLNIGKNI 50 ++ + +K + F++ +++ +I ++ Sbjct: 10 TMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSV 50 >2rjq_A Adamts-5; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: NAG BAT; 2.60A {Homo sapiens} Length = 378 Score = 24.1 bits (51), Expect = 8.0 Identities = 4/42 (9%), Positives = 15/42 (35%) Query: 10 LAIICKKREMNDLKLDIKAVVSVFFNILIDIWRFLNIGKNIK 51 L ++ ++ + +I ++ +I +I+ Sbjct: 10 LLLVADASMARLYGRGLQHYLLTLASIANRLYSHASIENHIR 51 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.333 0.147 0.450 Gapped Lambda K H 0.267 0.0521 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 486,220 Number of extensions: 16083 Number of successful extensions: 39 Number of sequences better than 10.0: 1 Number of HSP's gapped: 39 Number of HSP's successfully gapped: 7 Length of query: 55 Length of database: 5,693,230 Length adjustment: 27 Effective length of query: 28 Effective length of database: 5,038,642 Effective search space: 141081976 Effective search space used: 141081976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 50 (23.5 bits)