RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= 537021.9.peg.993_1
         (52 letters)



>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase B.  Serine/Threonine Kinases
           (STKs), Protein Kinase B (PKB) or Akt subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). There are
           three PKB isoforms from different genes, PKB-alpha (or
           Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. It is activated
           downstream of PI3K and plays important roles in diverse
           cellular functions including cell survival, growth,
           proliferation, angiogenesis, motility, and migration.
           PKB also has a central role in a variety of human
           cancers, having been implicated in tumor initiation,
           progression, and metastasis.
          Length = 323

 Score = 25.2 bits (55), Expect = 3.9
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 4   FFNQTKGKIIINDQLQLLMENIIKIRYVTQEARSLLGITLIK 45
           F+NQ   K+    +L +LME I   R ++ EA+SLL   L K
Sbjct: 195 FYNQDHEKLF---EL-ILMEEIRFPRTLSPEAKSLLAGLLKK 232


>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B gamma.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, gamma (or Akt3) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-gamma is
           predominantly expressed in neuronal tissues. Mice
           deficient in PKB-gamma show a reduction in brain weight
           due to the decreases in cell size and cell number.
           PKB-gamma has also been shown to be upregulated in
           estrogen-deficient breast cancer cells,
           androgen-independent prostate cancer cells, and primary
           ovarian tumors. It acts as a key mediator in the genesis
           of ovarian cancer.
          Length = 328

 Score = 25.0 bits (54), Expect = 4.0
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 4/42 (9%)

Query: 4   FFNQTKGKIIINDQLQLLMENIIKIRYVTQEARSLLGITLIK 45
           F+NQ   K+    +L +LME+I   R ++ +A+SLL   LIK
Sbjct: 195 FYNQDHEKLF---EL-ILMEDIKFPRTLSADAKSLLSGLLIK 232


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.329    0.143    0.375 

Gapped
Lambda     K      H
   0.267   0.0824    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 557,355
Number of extensions: 19523
Number of successful extensions: 56
Number of sequences better than 10.0: 1
Number of HSP's gapped: 56
Number of HSP's successfully gapped: 4
Length of query: 52
Length of database: 6,263,737
Length adjustment: 25
Effective length of query: 27
Effective length of database: 5,723,512
Effective search space: 154534824
Effective search space used: 154534824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (23.2 bits)