BLASTP 2.2.5 [Nov-16-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|148264|gb|AAA24759.1| trp repressor binding protein (198 letters) Database: astral_seq95_1.71.fa 13,006 sequences; 2,264,470 total letters Searching...........................done Score E Sequences producing significant alignments: (bits) Value d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinoc... 84 6e-15 >d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans} Length = 201 Score = 84.0 bits (206), Expect = 6e-15 Identities = 62/173 (35%), Positives = 90/173 (52%), Gaps = 12/173 (6%) Query: 3 KVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGG------KTQ 56 K+ +++YS G M A A + GAEV + +V ET P + + + Sbjct: 4 KLAIVFYSSTGTGYAM-AQEAAEAGRAAGAEVRLLKVRETAPQDVIDGQDAWKANIEAMK 62 Query: 57 TAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGK-LASVFSSTG 115 P ATP +L +AI+F +PTRFG + QMR F+D GGLW+SG L K +++ S+ Sbjct: 63 DVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQN 122 Query: 116 TGGGQEQTITSTWTTLAHHGMVIVPIAYAAQELFDVSQVRGGTPYGATTIAGG 168 GGQE T+ + + T H G V+ P Y + +F GG PYGA+ A G Sbjct: 123 VNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIFK----SGGNPYGASVTANG 171 Database: astral_seq95_1.71.fa Posted date: Apr 2, 2007 3:57 PM Number of letters in database: 2,264,470 Number of sequences in database: 13,006 Lambda K H 0.315 0.132 0.379 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 952,560 Number of Sequences: 13006 Number of extensions: 40330 Number of successful extensions: 90 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 86 Number of HSP's gapped (non-prelim): 1 length of query: 198 length of database: 1,636,675,498 effective HSP length: 128 effective length of query: 70 effective length of database: 1,636,675,498 effective search space: 114567284860 effective search space used: 114567284860 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 75 (33.5 bits)