Query FBpp0084426 type=protein; loc=3R:complement(26626008..26626697); ID=FBpp0084426; name=TwdlO-PA; parent=FBgn0039438,FBtr0085054; dbxref=FlyBase:FBpp0084426,FlyBase_Annotation_IDs:CG6452-PA,GB_protein:AAF56604.1,REFSEQ:NP_651487,GB_protein:AAF56604,FlyMine:FBpp0084426,modMine:FBpp0084426; MD5=9535d7d9cde3bc16fd96c44d0179be27; length=229; release=r6.06; species=Dmel; Match_columns 229 No_of_seqs 137 out of 175 Neff 3.6 Searched_HMMs 16187 No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF03103 DUF243: Domain of unk 100.0 7E-43 4.3E-47 271.1 8.2 96 58-154 1-97 (97) 2 PF02513 Spin-Ssty: Spin/Ssty 68.0 1 6.2E-05 29.9 1.1 15 142-156 26-40 (50) 3 PF13893 RRM_5: RNA recognitio 65.9 4.1 0.00026 24.8 3.8 27 143-169 17-43 (56) 4 PF04202 Mfp-3: Foot protein 3 63.6 2.1 0.00013 30.3 2.2 20 4-23 11-32 (71) 5 PF00076 RRM_1: RNA recognitio 59.6 3.3 0.0002 25.6 2.4 26 144-169 36-61 (70) 6 PF14605 Nup35_RRM_2: Nup53/35 54.5 5.2 0.00032 25.6 2.8 20 144-163 33-52 (53) 7 PF06286 Coleoptericin: Coleop 40.4 4.5 0.00027 31.7 0.8 15 1-15 2-16 (143) 8 PF14259 RRM_6: RNA recognitio 36.6 12 0.00072 22.7 2.3 18 148-165 37-54 (66) 9 PF10035 DUF2179: Uncharacteri 36.0 10 0.00063 23.6 1.9 36 114-155 14-49 (55) 10 PF11608 Limkain-b1: Limkain b 35.3 47 0.0029 23.9 5.7 53 118-170 3-64 (88) 11 PF09848 DUF2075: Uncharacteri 34.9 23 0.0014 29.3 4.6 48 90-137 2-52 (363) 12 PF08942 DUF1919: Domain of un 34.2 7.5 0.00046 31.7 1.3 16 147-162 90-105 (196) 13 PF00638 Ran_BP1: RanBP1 domai 33.9 22 0.0013 25.0 3.7 27 143-169 92-118 (122) 14 PF07263 DMP1: Dentin matrix p 33.5 8.9 0.00055 35.6 1.8 22 1-22 1-25 (521) 15 PF03823 Neurokinin_B: Neuroki 31.6 8.7 0.00054 26.1 1.0 9 218-226 46-54 (58) 16 PF12566 DUF3748: Protein of u 29.0 17 0.001 27.9 2.4 40 83-128 7-46 (123) 17 PF01481 Arteri_nucleo: Arteri 28.3 21 0.0013 27.0 2.9 29 156-184 63-91 (116) 18 PF14657 Integrase_AP2: AP2-li 24.7 29 0.0018 21.0 2.6 20 154-173 24-43 (46) 19 PF05111 Amelin: Ameloblastin 20.5 25 0.0016 31.6 2.2 30 3-32 10-41 (417)No 1>PF03103 DUF243: Domain of unknown function (DUF243); InterPro: IPR004145 This domain is only found in fly proteins. It is found associated with YLP motifs (IPR004019 from INTERPRO) in some proteins. Probab=100.00 E-value=7e-43 Score=271.14 Aligned_cols=96 Identities=49% Similarity=0.765 Sum_probs=90.1 Q ss_pred ccceEEEEeCCCC-CCCChhhhhhhccCCCCCceEEEEeCCCCCChhHHHHHhhhcccccceeEEEecCCCChhHHHHHh Q FBpp0084426 58 LNKEYYTFEADES-QFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVLNKQTDIGDLAQKF 136 (229) Q Consensus 58 v~K~fY~h~APEe-~~~~~~~~~~l~~~~~K~yrVVFIKaPe~~~~~~Aa~~lA~q~~EeKT~IYVL~Kq~d~~dla~~l 136 (229) |+||||+|+|||| ++++++..+++++.++|||||||||||++++.+.++++++ +++||||+||||+||+|..||+.++ T Consensus 1 v~K~fY~h~APee~e~~~~~~~~~~~~~~kK~yrVVFIKaP~~~~~~~~~~~~~-~~~EeKT~IYVL~Kk~d~~~l~~~~ 79 (97) T PF03103_consen 1 VTKHFYVHSAPEEEEFEEPRAIVQLAGPPKKNYRVVFIKAPENPGPEAAALPLA-QQNEEKTAIYVLVKKPDEADLAIQL 79 (97) T ss_pred CcceEEEEcCCCCcccccchhhhhcccccCCceEEEEEECCCCCchhhhccccc-cccccceEEEEEecCCCcchhhHhh Confidence 6899999999999 4556677788899999999999999999999998888888 8899999999999999999999999 Q ss_pred hhhccCCCCCCeEEEEEe Q FBpp0084426 137 NAARQNSNQRPEVHFVKY 154 (229) Q Consensus 137 ~~~~~~~~~KPEV~FIKY 154 (229) +++++++++||||||||| T Consensus 80 ~~~~~~~~~KPEV~FIKY 97 (97) T PF03103_consen 80 PTPAPTQPSKPEVHFIKY 97 (97) T ss_pred cccCCCCCCCCeEEeeCC Confidence 999999999999999999No 2>PF02513 Spin-Ssty: Spin/Ssty Family; InterPro: IPR003671 Spindlin (Spin) and Ssty were first identified for their involvement in gametogenesis. Spindlin was identified as a maternal transcript present in the unfertilised egg and early embryo, and was subsequently shown to interact with the spindle apparatus during oogenesis, and may therefore be important for mitosis []. In addition, spindlin appears to be a target for cell cycle-dependent phosphorylation, and as such may play a role in cell cycle regulation during the transition from gamete to embryo []. Ssty is a multi-copy, Y-linked spermatogenesis-specific transcript that appears to be required for normal spermatogenesis []. Ssty may play an analogous role to spindlin in sperm cells, namely during the transition from sperm cells to early embryo, and in mitosis.; GO: 0007276 gamete generation; PDB: 4MZG_D 4MZF_B 2NS2_A 4H75_A 4MZH_A 4UY4_A. Probab=68.02 E-value=1 Score=29.93 Aligned_cols=15 Identities=27% Similarity=0.549 Sum_probs=12.6 Q ss_pred CCCCCCeEEEEEeCC Q FBpp0084426 142 NSNQRPEVHFVKYRT 156 (229) Q Consensus 142 ~~~~KPEV~FIKYrT 156 (229) +.+-+|.+|||||.. T Consensus 26 Qvp~~ps~y~Ikydg 40 (50) T PF02513_consen 26 QVPVNPSLYFIKYDG 40 (50) T ss_dssp EETTSTTEEEEEETT T ss_pred EeeccccEEEEEEcC Confidence 467799999999974No 3>PF13893 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain); PDB: 2D9O_A 1A9N_D 2DIT_A 2YTC_A 1SJQ_A 2AD9_A 1X4D_A 2ADC_A 2EVZ_A 1QM9_A .... Probab=65.87 E-value=4.1 Score=24.80 Aligned_cols=27 Identities=22% Similarity=0.417 Sum_probs=22.8 Q ss_pred CCCCCeEEEEEeCCHHHHHHHHHHHHH Q FBpp0084426 143 SNQRPEVHFVKYRTPEDAANAQRAIQS 169 (229) Q Consensus 143 ~~~KPEV~FIKYrT~eeAa~AQ~~IQ~ 169 (229) ...+...-||+|.+.++|..|.+.+.. T Consensus 17 ~~~~~~~a~V~f~~~~~A~~A~~~l~~ 43 (56) T PF13893_consen 17 MDKKKGFAFVEFSDEEAAEKAIQALNG 43 (56) T ss_dssp ECTTTTEEEEEESSHHHHHHHHHHHTT T ss_pred ecCCCcEEEEEECCHHHHHHHHHHcCC Confidence 345677899999999999999998854No 4>PF04202 Mfp-3: Foot protein 3; InterPro: IPR007328 Mytilus foot protein-3 (Mfp-3) is a highly polymorphic protein family located in the byssal adhesive plaques of blue mussels. Probab=63.62 E-value=2.1 Score=30.35 Aligned_cols=20 Identities=10% Similarity=0.285 Sum_probs=13.8 Q ss_pred hHHHH-HHHHhhc-cccCCCCC Q FBpp0084426 4 LIAFC-LIGAACA-QYNYGAGF 23 (229) Q Consensus 4 ~i~lc-l~a~a~a-gYnY~p~~ 23 (229) +|||| |+||.++ |+.|.|+- T Consensus 11 ALVLiG~faVqsdA~~~Y~p~y 32 (71) T PF04202_consen 11 ALVLIGSFAVQSDAGAYYDPGY 32 (71) T ss_pred HHHHHHHHHHhhcCCCCcCCCC Confidence 45555 7777766 88888773No 5>PF00076 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain); InterPro: IPR000504 Many eukaryotic proteins containing one or more copies of a putative RNA-binding domain of about 90 amino acids are known to bind single-stranded RNAs [, , ]. The largest group of single strand RNA-binding proteins is the eukaryotic RNA recognition motif (RRM) family that contains an eight amino acid RNP-1 consensus sequence [, ]. RRM proteins have a variety of RNA binding preferences and functions, and include heterogeneous nuclear ribonucleoproteins (hnRNPs), proteins implicated in regulation of alternative splicing (SR, U2AF, Sxl), protein components of small nuclear ribonucleoproteins (U1 and U2 snRNPs), and proteins that regulate RNA stability and translation (PABP, La, Hu) [, , ]. The RRM in heterodimeric splicing factor U2 snRNP auxiliary factor (U2AF) appears to have two RRM-like domains with specialised features for protein recognition []. The motif also appears in a few single stranded DNA binding proteins. The typical RRM consists of four anti-parallel beta-strands and two alpha-helices arranged in a beta-alpha-beta-beta-alpha-beta fold with side chains that stack with RNA bases. Specificity of RNA binding is determined by multiple contacts with surrounding amino acids. A third helix is present during RNA binding in some cases []. The RRM is reviewed in a number of publications [, , ].; GO: 0003676 nucleic acid binding; PDB: 1YTY_B 2VOO_B 2VOP_A 2VON_B 2VOD_A 1ZH5_B 1S79_A 4CH1_A 1P1T_A 2KRR_A .... Probab=59.58 E-value=3.3 Score=25.61 Aligned_cols=26 Identities=27% Similarity=0.440 Sum_probs=21.0 Q ss_pred CCCCeEEEEEeCCHHHHHHHHHHHHH Q FBpp0084426 144 NQRPEVHFVKYRTPEDAANAQRAIQS 169 (229) Q Consensus 144 ~~KPEV~FIKYrT~eeAa~AQ~~IQ~ 169 (229) ....-.-||.|.+.++|..|.+.+.. T Consensus 36 ~~~~~~~~V~f~~~~~a~~ai~~l~~ 61 (70) T PF00076_consen 36 GQSRGFAFVEFESKEDAQKAIEKLNG 61 (70) T ss_dssp SSEEEEEEEEESSHHHHHHHHHHHTT T ss_pred ccccccceEEEcCHHHHHHHHHHhCC Confidence 34445679999999999999988765No 6>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Probab=54.45 E-value=5.2 Score=25.60 Aligned_cols=20 Identities=25% Similarity=0.468 Sum_probs=17.2 Q ss_pred CCCCeEEEEEeCCHHHHHHH Q FBpp0084426 144 NQRPEVHFVKYRTPEDAANA 163 (229) Q Consensus 144 ~~KPEV~FIKYrT~eeAa~A 163 (229) +.++-..||||+|..+|+.| T Consensus 33 ~~~~~~~~l~y~~~~~ae~A 52 (53) T PF14605_consen 33 PDSSNSMYLKYKTRQAAEKA 52 (53) T ss_pred CCCCcEEEEEECCHHHHHhh Confidence 35677899999999999987No 7>PF06286 Coleoptericin: Coleoptericin; InterPro: IPR009382 This family consists of several insect coleoptericin, acaloleptin, holotricin and rhinocerosin proteins which are all known to be antibacterial proteins []. These all appear to be short, glycine-rich molecules, inducible by infection.; GO: 0042742 defense response to bacterium, 0005576 extracellular region Probab=40.42 E-value=4.5 Score=31.70 Aligned_cols=15 Identities=40% Similarity=0.634 Sum_probs=13.0 Q ss_pred CchhHHHHHHHHhhc Q FBpp0084426 1 MRFLIAFCLIGAACA 15 (229) Q Consensus 1 Mr~~i~lcl~a~a~a 15 (229) |...|+|||+|++.| T Consensus 2 mkl~i~~~lia~saa 16 (143) T PF06286_consen 2 MKLYIIFGLIALSAA 16 (143) T ss_pred ceEeeehhHHHHHHh Confidence 788999999999765No 8>PF14259 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or RNP domain); PDB: 2LXI_A 2KG1_A 2HGN_A 3VAH_B 3VAG_A 3VAK_B 3VAL_I 3VAJ_B 4TU7_A 4TU9_A .... Probab=36.64 E-value=12 Score=22.66 Aligned_cols=18 Identities=39% Similarity=0.732 Sum_probs=14.5 Q ss_pred eEEEEEeCCHHHHHHHHH Q FBpp0084426 148 EVHFVKYRTPEDAANAQR 165 (229) Q Consensus 148 EV~FIKYrT~eeAa~AQ~ 165 (229) -.-||.|++.++|.+|.+ T Consensus 37 ~~a~V~f~~~~~a~~a~~ 54 (66) T PF14259_consen 37 GFAFVEFESPEDAQKALK 54 (66) T ss_dssp CEEEEEESSHHHHHHHHT T ss_pred ceEEEEeCCHHHHHHHHH Confidence 347999999999988644No 9>PF10035 DUF2179: Uncharacterized protein conserved in bacteria (DUF2179); InterPro: IPR019264 This entry, found mostly in hypothetical bacterial proteins, has no known function. ; PDB: 3HLU_B. Probab=36.04 E-value=10 Score=23.64 Aligned_cols=36 Identities=11% Similarity=0.256 Sum_probs=23.0 Q ss_pred cccceeEEEecCCCChhHHHHHhhhhccCCCCCCeEEEEEeC Q FBpp0084426 114 AEQRTAIYVLNKQTDIGDLAQKFNAARQNSNQRPEVHFVKYR 155 (229) Q Consensus 114 ~EeKT~IYVL~Kq~d~~dla~~l~~~~~~~~~KPEV~FIKYr 155 (229) .++|++||+..++-|..+|-..+..+ .|..|++=+. T Consensus 14 ~~~~~il~~v~~~~e~~~l~~~I~~i------Dp~AFi~v~~ 49 (55) T PF10035_consen 14 GEEKTILMTVVSRRELPKLKKIIKEI------DPNAFITVSD 49 (55) T ss_dssp SS--EEEEEEEECCHHHHHHHHHHCC-------TT-EEEE-- T ss_pred CCCeEEEEEEEEhhhHHHHHHHHHHh------CCCEEEEEEc Confidence 47899999999999988888766544 4555555443No 10>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes. Limkain b1 may be a relatively common target of human autoantibodies reactive to cytoplasmic vesicle-like structures [].; PDB: 2DIU_A. Probab=35.32 E-value=47 Score=23.89 Aligned_cols=53 Identities=17% Similarity=0.338 Sum_probs=36.0 Q ss_pred eeEEEec--CCCC--hhHHHHHhhhhccCCCCC-----CeEEEEEeCCHHHHHHHHHHHHHH Q FBpp0084426 118 TAIYVLN--KQTD--IGDLAQKFNAARQNSNQR-----PEVHFVKYRTPEDAANAQRAIQSQ 170 (229) Q Consensus 118 T~IYVL~--Kq~d--~~dla~~l~~~~~~~~~K-----PEV~FIKYrT~eeAa~AQ~~IQ~q 170 (229) |.+||.+ .--| ...|-..|....-+-..| +-.-+|+|.+++.|.+|+..|+.+ T Consensus 3 ~ll~V~NLP~~~d~~~~~Ik~RL~qLs~NcGGkV~~I~~~~A~irF~s~~~A~RA~kRm~gE 64 (88) T PF11608_consen 3 TLLLVSNLPTNKDKPPKKIKNRLKQLSDNCGGKVLSISGGTAIIRFPSQEAARRAQKRMEGE 64 (88) T ss_dssp EEEEEES--TTS---HHHHHHHHHHHHHTTT--EEE--TT-EEEEESSHHHHHHHHHHHTT- T ss_pred eEEEEEcCCCCccccHHHHHHHHHHhhhCCCCeEEEEeCCEEEEEeCCHHHHHHHHHhhcCC Confidence 7788877 3445 556666776665443322 355689999999999999999987No 11>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function. It is found in some proteins described as Schlafen family members, which may have a role in hematopoeitic cell differentiation []. Probab=34.93 E-value=23 Score=29.33 Aligned_cols=48 Identities=27% Similarity=0.383 Sum_probs=39.3 Q ss_pred eEEEEeCCCCCChhHHHHHhhhcc---cccceeEEEecCCCChhHHHHHhh Q FBpp0084426 90 RVVFIKGPENRGLENAALALAKQA---AEQRTAIYVLNKQTDIGDLAQKFN 137 (229) Q Consensus 90 rVVFIKaPe~~~~~~Aa~~lA~q~---~EeKT~IYVL~Kq~d~~dla~~l~ 137 (229) +||||++.-.+|-+--++.++..- .+.++.+|++...+....|-..+. T Consensus 2 ~viiI~G~pGTGKTvla~~l~~~l~~~~~~~~~~~l~~n~~l~~~l~~~l~ 52 (363) T PF09848_consen 2 KVIIIQGGPGTGKTVLALDLAKELAKISEGKKVIYLCGNGPLRNVLRKALK 52 (363) T ss_pred EEEEEEECCCCCHHHHHHHHHHHhhhhhcCCeeEEEEechHHHHHHHHHHH Confidence 699999999999888788888864 688999999998887666655544No 12>PF08942 DUF1919: Domain of unknown function (DUF1919); InterPro: IPR015037 This protein has no known function. It is found in various hypothetical and putative bacterial proteins. ; PDB: 2G6T_B. Probab=34.25 E-value=7.5 Score=31.71 Aligned_cols=16 Identities=38% Similarity=0.764 Sum_probs=13.5 Q ss_pred CeEEEEEeCCHHHHHH Q FBpp0084426 147 PEVHFVKYRTPEDAAN 162 (229) Q Consensus 147 PEV~FIKYrT~eeAa~ 162 (229) =|+||+-|++.|||.. T Consensus 90 I~IhF~HY~s~eEA~~ 105 (196) T PF08942_consen 90 IEIHFMHYKSFEEAKE 105 (196) T ss_dssp EEEEESS-SSHHHHHH T ss_pred EEEEEEecCCHHHHHH Confidence 5899999999999965No 13>PF00638 Ran_BP1: RanBP1 domain; InterPro: IPR000156 Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran Binding Protein 1 (RanBP1) has guanine nucleotide dissociation inhibitory activity, specific for the GTP form of Ran and also functions to stimulate Ran GTPase activating protein(GAP)-mediated GTP hydrolysis by Ran. RanBP1 contributes to maintaining the gradient of RanGTP across the nuclear envelope high (GDI activity) or the cytoplasmic levels of RanGTP low (GAP cofactor) []. All RanBP1 proteins contain an approx 150 amino acid residue Ran binding domain. Ran BP1 binds directly to RanGTP with high affinity. There are four sites of contact between Ran and the Ran binding domain. One of these involves binding of the C-terminal segment of Ran to a groove on the Ran binding domain that is analogous to the surface utilised in the EVH1-peptide interaction []. Nup358 contains four Ran binding domains. The structure of the first of these is known [].; GO: 0046907 intracellular transport; PDB: 4L6E_A 2Y8F_A 2Y8G_B 2CRF_A 1XKE_A 1RRP_D 4HAT_B 4HAV_B 4HAX_B 4HB3_B .... Probab=33.88 E-value=22 Score=24.96 Aligned_cols=27 Identities=22% Similarity=0.602 Sum_probs=23.4 Q ss_pred CCCCCeEEEEEeCCHHHHHHHHHHHHH Q FBpp0084426 143 SNQRPEVHFVKYRTPEDAANAQRAIQS 169 (229) Q Consensus 143 ~~~KPEV~FIKYrT~eeAa~AQ~~IQ~ 169 (229) ...||+.|.||+++.++|..-...|+. T Consensus 92 ~~~~~~~~~irf~~~~~a~~f~~~i~e 118 (122) T PF00638_consen 92 EEGKPETYLIRFKSAEEADEFKKAIEE 118 (122) T ss_dssp SSSEEEEEEEEESSHHHHHHHHHHHHH T ss_pred CCCceEEEEEEECCHHHHHHHHHHHHH Confidence 456899999999999999998888764No 14>PF07263 DMP1: Dentin matrix protein 1 (DMP1); InterPro: IPR009889 This family consists of several mammalian dentin matrix protein 1 (DMP1) sequences. The dentin matrix acidic phosphoprotein 1 (DMP1) gene has been mapped to human chromosome 4q21 []. DMP1 is a bone and teeth specific protein initially identified from mineralised dentin. DMP1 is primarily localised in the nuclear compartment of undifferentiated osteoblasts. In the nucleus, DMP1 acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the early phase of osteoblast maturation, Ca2+ surges into the nucleus from the cytoplasm, triggering the phosphorylation of DMP1 by a nuclear isoform of casein kinase II. This phosphorylated DMP1 is then exported out into the extracellular matrix, where it regulates nucleation of hydroxyapatite. DMP1 is a unique molecule that initiates osteoblast differentiation by transcription in the nucleus and orchestrates mineralised matrix formation extracellularly, at later stages of osteoblast maturation []. The DMP1 gene has been found to be ectopically expressed in lung cancer although the reason for this is unknown [].; GO: 0001503 ossification, 0030198 extracellular matrix organization Probab=33.49 E-value=8.9 Score=35.55 Aligned_cols=22 Identities=27% Similarity=0.507 Sum_probs=16.4 Q ss_pred Cc-hhHHHHHHHHhhc--cccCCCC Q FBpp0084426 1 MR-FLIAFCLIGAACA--QYNYGAG 22 (229) Q Consensus 1 Mr-~~i~lcl~a~a~a--gYnY~p~ 22 (229) |+ .||+||||++.|| =-.||-. T Consensus 1 MKt~iLLi~lW~LscAlPvary~nt 25 (521) T PF07263_consen 1 MKTSILLIFLWGLSCALPVARYQNT 25 (521) T ss_pred CccchHHHHHHHHhccccccccCCc Confidence 77 6777889999999 4555544No 15>PF03823 Neurokinin_B: Neurokinin B; InterPro: IPR003635 Tachykinins [, , ] are a group of biologically active peptides which excite neurons, evoke behavioral responses, are potent vasodilatators and contract (directly or indirectly) many smooth muscles. This family includes neurokinin B (also known as Tachykinin-3), as well as many other peptides. Like other tachykinins, neurokinins are synthesized as larger protein precursors that are enzymatically converted to their mature forms. Neurokinin B is a critical central regulator of human gonadal function []. In humans, defect in Neurokinin B causes hypogonadotropic hypogonadism 10 with or without anosmia (HH10), which is a disorder characterised by absent or incomplete sexual maturation by the age of 18 years, in conjunction with low levels of circulating gonadotropins and testosterone and no other abnormalities of the hypothalamic-pituitary axis [].; GO: 0007217 tachykinin receptor signaling pathway Probab=31.57 E-value=8.7 Score=26.10 Aligned_cols=9 Identities=67% Similarity=1.220 Sum_probs=7.2 Q ss_pred CchHHHhhh Q FBpp0084426 218 LPANILRRL 226 (229) Q Consensus 218 lp~~~~rr~ 226 (229) ||+++|||| T Consensus 46 LPpSLLRRL 54 (58) T PF03823_consen 46 LPPSLLRRL 54 (58) T ss_pred CCHHHHHHH Confidence 788888886No 16>PF12566 DUF3748: Protein of unknown function (DUF3748); InterPro: IPR022223 This domain family is found in bacteria and eukaryotes, and is approximately 120 amino acids in length. Probab=28.97 E-value=17 Score=27.89 Aligned_cols=40 Identities=28% Similarity=0.294 Sum_probs=24.7 Q ss_pred cCCCCCceEEEEeCCCCCChhHHHHHhhhcccccceeEEEecCCCC Q FBpp0084426 83 GSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVLNKQTD 128 (229) Q Consensus 83 ~~~~K~yrVVFIKaPe~~~~~~Aa~~lA~q~~EeKT~IYVL~Kq~d 128 (229) -+|...-|+|||-+||++..+- .- .--.++-+.|-..+++ T Consensus 7 ~sP~~p~~~vFIHGpe~pd~~w---~Y---dfhhRrGviv~~~~~~ 46 (123) T PF12566_consen 7 VSPVEPNRYVFIHGPENPDEQW---QY---DFHHRRGVIVDEDEPG 46 (123) T ss_pred eCCCcCceEEEEeCCCCCCccc---cc---ccccceEEEEecCCCC Confidence 3455667999999999986321 00 1125677777665544No 17>PF01481 Arteri_nucleo: Arterivirus nucleocapsid protein; InterPro: IPR002484 Arterivirus are ssRNA positive-strand viruses with no DNA stage in their replication cycle. This family contains the viral nucleocapsid protein, which encapsidates the viral ssRNA. Porcine reproductive and respiratory syndrome virus (PRRSV) is the causative agent of both severe and persistent respiratory disease and reproductive failure in pigs worldwide. The PRRSV virion contains a core made of the 123 amino acid nucleocapsid (N or VP1) protein, a product of the ORF7 gene. The crystal structure of the capsid-forming domain of the nucleocapsid protein has been determined to 2.6 A resolution. The protein exists as a tight dimer forming a four-stranded beta sheet floor superposed by two long alpha helices and flanked by two N- and two C-terminal alpha helices. The structure represents a new class of viral capsid-forming domains, distinctly different from those of other known enveloped viruses, but reminiscent of the coat protein of bacteriophage MS2 [].; GO: 0019013 viral nucleocapsid; PDB: 1P65_A 2I9F_C. Probab=28.35 E-value=21 Score=27.03 Aligned_cols=29 Identities=28% Similarity=0.502 Sum_probs=23.6 Q ss_pred CHHHHHHHHHHHHHHhhhcCCcccccCCc Q FBpp0084426 156 TPEDAANAQRAIQSQYDNLGGSSQSINGG 184 (229) Q Consensus 156 T~eeAa~AQ~~IQ~qYD~LGGsS~~~~~g 184 (229) |+.|++.-.+.||.-||+=||+-...+.| T Consensus 63 ~p~e~~~~r~~i~~~FnqGgG~lsl~~sG 91 (116) T PF01481_consen 63 TPQERALCRQLIQRAFNQGGGTLSLSDSG 91 (116) T ss_dssp -HHHHHHHHHHHHHHHHCT-SEEEEETTS T ss_pred CHHHHHHHHHHHHHHHHcCCcceeecCCC Confidence 78999999999999999999998845444No 18>PF14657 Integrase_AP2: AP2-like DNA-binding integrase domain; InterPro: IPR028259 This entry represents the AP2-like domains found N-terminal in a variety of phage integrase proteins, including the ICEBs1 integrase from Bacillus subtilis []. Presumably these domains are DNA-binding. Probab=24.74 E-value=29 Score=21.01 Aligned_cols=20 Identities=30% Similarity=0.647 Sum_probs=17.8 Q ss_pred eCCHHHHHHHHHHHHHHhhh Q FBpp0084426 154 YRTPEDAANAQRAIQSQYDN 173 (229) Q Consensus 154 YrT~eeAa~AQ~~IQ~qYD~ 173 (229) |+|..||..+.+.|..+.++ T Consensus 24 F~TkkeA~~~~~~~~~~~~~ 43 (46) T PF14657_consen 24 FKTKKEAQKAEREIENKINN 43 (46) T ss_pred cCcHHHHHHHHHHHHHHHHc Confidence 89999999999999988753No 19>PF05111 Amelin: Ameloblastin precursor (Amelin); InterPro: IPR007798 This family consists of mammalian Ameloblastin precursor (Amelin) proteins. Matrix proteins of tooth enamel consist mainly of amelogenin but also of non-amelogenin proteins, which, although their volumetric percentage is low, have an important role in enamel mineralization. One of the non-amelogenin proteins is ameloblastin, also known as amelin and sheathlin. Ameloblastin (AMBN) is one of the enamel sheath proteins which is thought to have a role in determining the prismatic structure of growing enamel crystals [].; GO: 0030345 structural constituent of tooth enamel, 0042475 odontogenesis of dentin-containing tooth Probab=20.55 E-value=25 Score=31.56 Aligned_cols=30 Identities=27% Similarity=0.567 Sum_probs=23.4 Q ss_pred hhHHHHHHHHhhc--cccCCCCCCCCCCCCcC Q FBpp0084426 3 FLIAFCLIGAACA--QYNYGAGFTGAASDNVP 32 (229) Q Consensus 3 ~~i~lcl~a~a~a--gYnY~p~~~~~~~~s~~ 32 (229) .+++|||+.++.| =|--+++..|-+++|.. T Consensus 10 l~L~lcll~~s~avP~fpq~pg~~gmaSlSLE 41 (417) T PF05111_consen 10 LILILCLLGTSFAVPMFPQQPGTPGMASLSLE 41 (417) T ss_pred HHHHHHHHhhhhccccccCCCCCCccccccHH Confidence 7899999999998 66667777666666653