Query FBpp0290332 type=protein; loc=3L:join(7019749..7019898,7050565..7050695,7051242..7051421,7051486..7051722,7051977..7052052); ID=FBpp0290332; name=Mp-PI; parent=FBgn0260660,FBtr0301110; dbxref=REFSEQ:NP_001163360,GB_protein:ACZ94631,FlyBase:FBpp0290332,FlyBase_Annotation_IDs:CG42543-PI,FlyMine:FBpp0290332,modMine:FBpp0290332; MD5=cbe8be0b8c7853022eef14251deda915; length=257; release=r6.06; species=Dmel; Match_columns 257 No_of_seqs 92 out of 102 Neff 4.0 Searched_HMMs 16187 No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF06482 Endostatin: Collagena 100.0 9.2E-67 5.7E-71 476.2 8.8 173 47-219 113-286 (286) 2 PF07588 DUF1554: Protein of u 99.8 4.1E-20 2.5E-24 151.8 8.3 123 58-191 2-131 (135) 3 PF11267 DUF3067: Domain of un 56.4 2.6 0.00016 31.7 1.8 15 242-256 41-55 (98) 4 PF05624 LSR: Lipolysis stimul 36.3 10 0.00065 25.0 2.0 14 11-24 8-21 (48) 5 PF13134 DUF3948: Protein of u 33.6 15 0.00092 22.8 2.3 19 3-21 14-32 (35) 6 PF10686 DUF2493: Protein of u 28.7 16 0.00096 24.5 2.0 21 65-85 37-57 (67) 7 PF03032 FSAP_sig_propep: Frog 28.1 12 0.00072 24.3 1.1 13 16-28 7-19 (46) 8 PF12273 RCR: Chitin synthesis 24.8 19 0.0012 26.5 2.1 10 13-22 9-18 (119) 9 PF11297 DUF3098: Protein of u 21.3 22 0.0013 24.8 1.6 38 14-51 11-51 (67) 10 PF12874 zf-met: Zinc-finger o 19.7 26 0.0016 18.3 1.4 15 240-254 8-22 (25)No 1>PF06482 Endostatin: Collagenase NC10 and Endostatin; InterPro: IPR010515 NC10 stands for Non-helical region 10 and is taken from P39059 from SWISSPROT. A mutation in this region in P39060 from SWISSPROT is associated with an increased risk of prostrate cancer. This domain is cleaved from the precursor and forms endostatin. Endostatin is a key tumour suppressor and has been used highly successfully to treat cancer. It is a potent angiogenesis inhibitor []. Endostatin also binds a zinc ion near the N terminus; this is likely to be of structural rather than functional importance according to [].; GO: 0005198 structural molecule activity, 0007155 cell adhesion, 0031012 extracellular matrix; PDB: 1DY2_A 1DY1_A 1DY0_A 1KOE_A 3N3F_B 1BNL_D 3HSH_E 3HON_A. Probab=100.00 E-value=9.2e-67 Score=476.21 Aligned_cols=173 Identities=54% Similarity=0.997 Sum_probs=133.5 Q ss_pred hhhcccEEEccCCCCCCCCCcchhhHHHHHHhhhcCCCCceEEEEeccccCccccccCCCC-CCceeccCCcEEecCccc Q FBpp0290332 47 ARIQLRVAALNEPSTGDLQGIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPADR-DLPVVNTRGDVLFNSWKG 125 (257) Q Consensus 47 ~~~~Lhl~Aln~p~~GdLgGI~GADa~C~~qAraaGl~GTfRAfLSs~~q~l~~iV~~~DR-~gP~vN~kG~VLf~nw~~ 125 (257) ....|||||||+|++|||+||+|||++||+|||++|+.||||||||+++||+++||++.|| ++||||+||||||+||++ T Consensus 113 ~~~~l~liAlN~P~~G~m~Gi~gAD~~C~~qAr~~gl~gtfRAfLSs~~qdL~~iV~~~dr~~~PivNlkgevLf~sw~~ 192 (286) T PF06482_consen 113 DDGPLHLIALNEPLSGNMRGIRGADFQCFRQARAAGLTGTFRAFLSSRLQDLYSIVRRADRDNVPIVNLKGEVLFNSWES 192 (286) T ss_dssp TTS-EEEEE-SS-B-SBSSHHHHHHHHHHHHHHHTT--S-EEESS-BTTB-GGGGS-GGGTSS--EE-TTS-EEES-HHH T ss_pred CCCceEEEEcCCCCCCCccccccccHHHHHHHHHcCCCCceEEeeecccccHhhhccHhhCCCCCeEeCcCCEeecCHHH Confidence 3444999999999999999999999999999999999999999999999999999999999 799999999999999999 Q ss_pred cccCCCCCccCCCceeccCCCcccCCCCCCcceEeeeCCCCcccccCCcCCcCcCCCCCccccccCCCcccccccccccc Q FBpp0290332 126 IFNGQGGFFSQAPRIYSFSGKNVMTDSTWPMKMVWHGSLPNGERSMDTYCDAWHSGDHLKGSFASNLDGHKLLEQKRQSC 205 (257) Q Consensus 126 Lf~~~g~~~~~~~~I~sFng~dvl~Dp~wp~k~vWTGS~~dG~~~~d~tC~~WtSs~~~~~G~As~l~s~~ll~q~~~sC 205 (257) ||+++++.+.++.+||||||+|||+||.||+|.|||||+++|++..++||++|+|++.+++|+||+|++++||+|++.|| T Consensus 193 lf~g~~~~~~~~~~iySFdGr~v~~d~~wP~K~vWhGs~~~G~r~~~~~C~~Wrs~~~~~~G~As~l~~g~ll~q~~~sC 272 (286) T PF06482_consen 193 LFSGSGGPFNPNAPIYSFDGRDVLTDPAWPQKMVWHGSDPRGRRLTDSYCEAWRSSDPAVTGQASSLQSGKLLDQQPYSC 272 (286) T ss_dssp HTSSS-SB--TTS--BBTTS-BTTTSTTSSS-EEE--B-TTS-B-TTSBHHHHB---TTSEEEEEEGGGTBSS--EEEET T ss_pred HhCCCCCCCCCCCcEEeECCccccCCCCcceEEEEeCCCCCCccCCcCcccccccCCCCceEeeeecCCCCcccCCcccC Confidence 99999888888999999999999999999999999999999999999999999999999999999999999999999999 Q ss_pred cCceeEEEeecCch Q FBpp0290332 206 DSKLIILCVEALSQ 219 (257) Q Consensus 206 s~~~ivLCVE~~~~ 219 (257) +++||||||||+.+ T Consensus 273 ~~~~ivLCiE~~~~ 286 (286) T PF06482_consen 273 SNSFIVLCIENSFM 286 (286) T ss_dssp TS-BB-EEEESS-- T ss_pred CCceEEEEEecccC Confidence 99999999999864No 2>PF07588 DUF1554: Protein of unknown function (DUF1554); InterPro: IPR011448 This is a domain that occurs in 1-2 copies in a family of proteins identified in Leptospira interrogans and other bacteria. The function of the proteins is not known. Probab=99.80 E-value=4.1e-20 Score=151.76 Aligned_cols=123 Identities=22% Similarity=0.340 Sum_probs=92.5 Q ss_pred CCCCCCCCCcchhhHHHHHHhhhc--CCCCceEEEEecccc--CccccccCCCCCCceeccCCcEEecCccccccCCCCC Q FBpp0290332 58 EPSTGDLQGIRGADFACYRQGRRA--GLLGTFKAFLSSRVQ--NLDTIVRPADRDLPVVNTRGDVLFNSWKGIFNGQGGF 133 (257) Q Consensus 58 ~p~~GdLgGI~GADa~C~~qAraa--Gl~GTfRAfLSs~~q--~l~~iV~~~DR~gP~vN~kG~VLf~nw~~Lf~~~g~~ 133 (257) ..|+|+||||.|||++|+..+.+. +.+++|||||++..+ +... +.++-.. ...+|||.++.+|.+. +|.+ T Consensus 2 ~~~~GnlGGi~GADa~C~~d~~~p~~~~~~~yKAml~~~~~~~R~a~-~t~n~~~----g~~DWVl~pnt~Y~r~-dgt~ 75 (135) T PF07588_consen 2 NTYNGNLGGISGADAKCNADANKPSPGGGGTYKAMLVDGSNSTRRAC-VTANCGD----GQIDWVLKPNTTYYRS-DGTT 75 (135) T ss_pred ccccCcccchhhHhHHHHcCCCCCCCCCCcCeEEEEEcCccccceee-cCCCCCC----CcccceecCCceEEec-CCCE Confidence 468999999999999999988854 357899999999775 3222 2222211 2789999999999976 6653 Q ss_pred -ccCC-CceeccCCCcccCCCCC-CcceEeeeCCCCcccccCCcCCcCcCCCCCccccccC Q FBpp0290332 134 -FSQA-PRIYSFSGKNVMTDSTW-PMKMVWHGSLPNGERSMDTYCDAWHSGDHLKGSFASN 191 (257) Q Consensus 134 -~~~~-~~I~sFng~dvl~Dp~w-p~k~vWTGS~~dG~~~~d~tC~~WtSs~~~~~G~As~ 191 (257) +.++ ..||+|+ |+.++. ..+.+|||++.+|+... .+|.+|++.....+|..+. T Consensus 76 i~tTn~~glf~f~----l~~~i~~~~~~~WTGl~~~Wt~~~-~~C~~Wt~~s~~~~G~~G~ 131 (135) T PF07588_consen 76 IFTTNSNGLFDFP----LSNPISGTSGTIWTGLNSDWTTAT-NNCNNWTSGSSGVTGAYGS 131 (135) T ss_pred EEecCCCceEccc----ccceecCCCccEEEeECCCCeeCC-CcccCCcCCCCcccccccc Confidence 4444 5699998 544443 37999999999987764 8999999988666665544No 3>PF11267 DUF3067: Domain of unknown function (DUF3067); InterPro: IPR021420 This family of proteins has no known function. ; PDB: 2LJW_A. Probab=56.36 E-value=2.6 Score=31.72 Aligned_cols=15 Identities=33% Similarity=0.523 Sum_probs=11.9 Q ss_pred ccCHHHHHHHHHhhh Q FBpp0290332 242 FKTADEYAAHLENLL 256 (257) Q Consensus 242 ~~~~~~y~~~l~~~~ 256 (257) -+||.||.+||+.+. T Consensus 41 PltE~eY~~hL~~ia 55 (98) T PF11267_consen 41 PLTEEEYLEHLDAIA 55 (98) T ss_dssp SS-HHHHHHHHHHHH T ss_pred CCCHHHHHHHHHHHH Confidence 479999999999763No 4>PF05624 LSR: Lipolysis stimulated receptor (LSR); InterPro: IPR008664 This domain consists of mammalian LISCH7 protein homologues. LISCH7 is a liver-specific BHLH-ZIP transcription factor. Probab=36.30 E-value=10 Score=24.97 Aligned_cols=14 Identities=43% Similarity=0.980 Sum_probs=10.8 Q ss_pred HHHHHHHHHHHHhh Q FBpp0290332 11 LVITALILFFLLGI 24 (257) Q Consensus 11 ~~~~~~~~~~~~~~ 24 (257) .++++|++|.|+|| T Consensus 8 vilg~~l~~lL~gi 21 (48) T PF05624_consen 8 VILGALLLLLLIGI 21 (48) T ss_pred HHHHHHHHHHHHHH Confidence 56778888888887No 5>PF13134 DUF3948: Protein of unknown function (DUF3948); InterPro: IPR025034 This family of proteins has not yet been functionally characterised. Probab=33.60 E-value=15 Score=22.75 Aligned_cols=19 Identities=32% Similarity=0.460 Sum_probs=14.2 Q ss_pred eeeechhhHHHHHHHHHHH Q FBpp0290332 3 MVISTRAKLVITALILFFL 21 (257) Q Consensus 3 ~~~~~~~~~~~~~~~~~~~ 21 (257) .+.|.-..+|.+|||+|+- T Consensus 14 ~lgsAsGa~vLTa~I~fl~ 32 (35) T PF13134_consen 14 FLGSASGAAVLTAFIVFLS 32 (35) T ss_pred eeeeccchHHHHHHHHHHH Confidence 4455666789999999863No 6>PF10686 DUF2493: Protein of unknown function (DUF2493); InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. Members of this family are mainly Proteobacteria. The function is not known. Probab=28.65 E-value=16 Score=24.53 Aligned_cols=21 Identities=33% Similarity=0.384 Sum_probs=17.4 Q ss_pred CCcchhhHHHHHHhhhcCCCC Q FBpp0290332 65 QGIRGADFACYRQGRRAGLLG 85 (257) Q Consensus 65 gGI~GADa~C~~qAraaGl~G 85 (257) ||-+|||....+-|++.|+.- T Consensus 37 Gga~GaD~lA~~wA~~~gv~~ 57 (67) T PF10686_consen 37 GGARGADALAEQWARERGVPV 57 (67) T ss_pred CCCCchHHHHHHHHHHcCCce Confidence 455799999999999888753No 7>PF03032 FSAP_sig_propep: Frog skin active peptide family signal and propeptide; InterPro: IPR004275 In addition to the highly specific cell-mediated immune system, vertebrates possess an efficient host-defence mechanism against invading microorganisms which involves the synthesis of highly potent antimicrobial peptides with a large spectrum of activity. This entry represents a number of these defence peptides secreted from the skin of amphibians, including the opiate-like dermorphins and deltorphins, and the antimicrobial dermoseptins and temporins.; GO: 0006952 defense response, 0042742 defense response to bacterium, 0005576 extracellular region Probab=28.09 E-value=12 Score=24.31 Aligned_cols=13 Identities=38% Similarity=0.925 Sum_probs=9.9 Q ss_pred HHHHHHHhheeee Q FBpp0290332 16 LILFFLLGIVLVT 28 (257) Q Consensus 16 ~~~~~~~~~~~~~ 28 (257) +.++|+||+|+.+ T Consensus 7 llllfflG~ISlS 19 (46) T PF03032_consen 7 LLLLFFLGTISLS 19 (46) T ss_pred HHHHHHHHHhhcc Confidence 5677778999875No 8>PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. Probab=24.84 E-value=19 Score=26.49 Aligned_cols=10 Identities=50% Similarity=0.803 Sum_probs=3.9 Q ss_pred HHHHHHHHHH Q FBpp0290332 13 ITALILFFLL 22 (257) Q Consensus 13 ~~~~~~~~~~ 22 (257) |.+||+|||+ T Consensus 9 i~~~~l~~~~ 18 (119) T PF12273_consen 9 IVFFLLFFLG 18 (119) T ss_pred HHHHHHHHHH Confidence 3333334433No 9>PF11297 DUF3098: Protein of unknown function (DUF3098); InterPro: IPR021448 This bacterial family of proteins has no known function. Probab=21.30 E-value=22 Score=24.79 Aligned_cols=38 Identities=26% Similarity=0.458 Sum_probs=25.7 Q ss_pred HHHHHHHHHhheeeecC--C-CcccCCccCchhhhhhhhcc Q FBpp0290332 14 TALILFFLLGIVLVTGS--T-KGWFNPNRYNGERVAARIQL 51 (257) Q Consensus 14 ~~~~~~~~~~~~~~~~~--~-~~~~~p~~y~~~rva~~~~L 51 (257) .+-+...++|.++.+|+ + ..-|||.-|.--|+--.|-+ T Consensus 11 ~ig~~viilGfiLMsG~gs~d~~~Fn~~iFs~rrI~lAPiv 51 (67) T PF11297_consen 11 LIGIAVIILGFILMSGGGSTDPAVFNPDIFSFRRITLAPIV 51 (67) T ss_pred HHHHHHHHHHHHHhcCCCCCCCCccCcccccccceehhhHH Confidence 33445567888888875 3 34488888888776655544No 10>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 2MKN_A 2MKD_A 2LCE_A 1FU9_A 1JN7_A 2KVG_A 1ZU1_A 2EOS_A. Probab=19.65 E-value=26 Score=18.26 Aligned_cols=15 Identities=20% Similarity=0.538 Sum_probs=12.6 Q ss_pred hhccCHHHHHHHHHh Q FBpp0290332 240 REFKTADEYAAHLEN 254 (257) Q Consensus 240 ~~~~~~~~y~~~l~~ 254 (257) ..|.++..|.+|++. T Consensus 8 ~~f~~~~~~~~H~~s 22 (25) T PF12874_consen 8 KSFTSESQLRQHLRS 22 (25) T ss_dssp EEESSHHHHHHHHTT T ss_pred CCCCCHHHHHHHhCc Confidence 358899999999975