RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780122|ref|YP_003064535.1| hypothetical protein CLIBASIA_00005 [Candidatus Liberibacter asiaticus str. psy62] (123 letters) >d1x38a1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 388 Score = 25.4 bits (54), Expect = 1.4 Identities = 13/92 (14%), Positives = 34/92 (36%), Gaps = 2/92 (2%) Query: 25 DPDISIEMQISE--NQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQAT 82 D +E ++++ + L E+I Q + + D + + ++ + AT Sbjct: 7 DATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGAT 66 Query: 83 AKNLKSLLKEYWEESLDGEDDEEIYEHPDQEH 114 AK + ++ + + + + D H Sbjct: 67 AKEWQDMVDGFQKACMSTRLGIPMIYGIDAVH 98 >d1o70a2 b.118.1.1 (A:468-624) Fasciclin I {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 157 Score = 24.8 bits (53), Expect = 2.1 Identities = 4/23 (17%), Positives = 12/23 (52%) Query: 60 STILDKLDAMDDLKTYISLLQAT 82 +T+L KL++ + + + + Sbjct: 1 TTVLGKLESDPMMSDTYKMGKFS 23 >d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Length = 323 Score = 24.9 bits (54), Expect = 2.3 Identities = 8/48 (16%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Query: 59 DSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEI 106 +L+ A D++ + T+K L ++ +E + + +E+ Sbjct: 269 PEHLLNPRKAWKDVRQF----NETSKELVAMFQESFSARFAAKASQEM 312 >d2p5zx1 b.40.8.1 (X:378-468) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]} Length = 91 Score = 24.7 bits (54), Expect = 2.3 Identities = 5/16 (31%), Positives = 8/16 (50%) Query: 100 GEDDEEIYEHPDQEHR 115 +IY H D++ R Sbjct: 14 STVKNDIYAHIDKDGR 29 >d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 428 Score = 23.1 bits (48), Expect = 6.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 21 HPNADPDISIEMQISENQRYLDE 43 HP +P+ I+M ++ENQ LD Sbjct: 30 HPLKNPNGVIQMGLAENQLCLDL 52 >d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]} Length = 169 Score = 23.4 bits (50), Expect = 6.9 Identities = 17/71 (23%), Positives = 29/71 (40%), Gaps = 5/71 (7%) Query: 42 DEEISQCNAVVDVFKRSDSTILDK----LDAMDDLKTYISLLQATAKNLKSLLKEYWEES 97 D E+ + + + + I+D LD L I+ ++ LK LK + +E Sbjct: 36 DAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSLMDIIND-HSSVDRLKQTLKRHIQEM 94 Query: 98 LDGEDDEEIYE 108 G D+E E Sbjct: 95 FAGVIDDEFIE 105 >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 86 Score = 22.8 bits (48), Expect = 9.3 Identities = 11/30 (36%), Positives = 15/30 (50%) Query: 43 EEISQCNAVVDVFKRSDSTILDKLDAMDDL 72 EE +C + D+F R+ I D MD L Sbjct: 11 EEKDECMKIFDIFDRNAENIAPVSDTMDML 40 >d1v9ma_ f.40.1.1 (A:) V-type ATP synthase subunit C {Thermus thermophilus [TaxId: 274]} Length = 319 Score = 22.6 bits (48), Expect = 9.8 Identities = 6/46 (13%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Query: 75 YISLLQATAKNLKSLLKEY-WEESLDGEDDEEIYEHPDQEHREDYY 119 + L + + LL E + L G+ ++ + + Sbjct: 21 FQEALDLSFADFLRLLSETVYGGELAGQGLPDVDRAVLRTQAKLVG 66 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.313 0.132 0.377 Gapped Lambda K H 0.267 0.0602 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 498,772 Number of extensions: 20710 Number of successful extensions: 51 Number of sequences better than 10.0: 1 Number of HSP's gapped: 51 Number of HSP's successfully gapped: 23 Length of query: 123 Length of database: 2,407,596 Length adjustment: 75 Effective length of query: 48 Effective length of database: 1,377,846 Effective search space: 66136608 Effective search space used: 66136608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.2 bits)