RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780123|ref|YP_003064536.1| hypothetical protein CLIBASIA_00010 [Candidatus Liberibacter asiaticus str. psy62] (107 letters) >gnl|CDD|163455 TIGR03743, SXT_TraD, conjugative coupling factor TraD, SXT/TOL subfamily. Members of this protein family are the putative conjugative coupling factor, TraD (or TraG), rather distantly related to the well-characterized TraD of the F plasmid. Members are associated with conjugative-transposon-like mobile genetic elements of the class that includes SXT, an antibiotic resistance transfer element in some Vibrio cholerae strains. Length = 634 Score = 32.2 bits (74), Expect = 0.027 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 13/52 (25%) Query: 29 LQEALITQDVKAVEAV-------DPDLKKRVTVLAISYMKRCGDKGKSQFLS 73 L E LITQD++ + V D DLK+R+ A KR G +F Sbjct: 192 LAELLITQDIRRGDVVIVIDPKGDADLKRRMRAEA----KRAGR--PDRFYY 237 >gnl|CDD|163466 TIGR03754, conj_TOL_TraD, conjugative coupling factor TraD, TOL family. Members of this protein are assigned by homology to the TraD family of conjugative coupling factor. This particular clade serves as a marker for an extended gene region that occurs occasionally on plasmids, including the toluene catabolism TOL plasmid. More commonly, the gene region is chromosomal, flanked by various markers of conjugative transfer and insertion. Length = 643 Score = 29.3 bits (66), Expect = 0.22 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 11/43 (25%) Query: 29 LQEALITQDVKAVEAV-------DPDLKKRVTVLAISYMKRCG 64 L E LITQD++ + V D DL KR+ A KR G Sbjct: 196 LAELLITQDIRRGDVVIVFDPKGDADLLKRMYAEA----KRAG 234 >gnl|CDD|177413 PHA02584, 34, long tail fiber, proximal subunit; Provisional. Length = 1229 Score = 28.2 bits (63), Expect = 0.56 Identities = 11/40 (27%), Positives = 24/40 (60%) Query: 19 LTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAIS 58 L+++ + G + ++ Q+V VE VD + R+ V+A++ Sbjct: 412 LSYIEDDSTGRKYWVVAQNVPIVERVDSTDRARLGVIALA 451 >gnl|CDD|180755 PRK06926, PRK06926, flagellar motor protein MotP; Reviewed. Length = 271 Score = 26.6 bits (59), Expect = 1.4 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Query: 11 KAKDIPQLL-TFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAI 57 + D+ +L+ TF+SL + +E L++ + + E DP +KK + +LAI Sbjct: 75 QEDDVEELVQTFVSLSEKARREGLLSLEAELEEVKDPFIKKGL-LLAI 121 >gnl|CDD|115779 pfam07148, MalM, Maltose operon periplasmic protein precursor (MalM). This family consists of several maltose operon periplasmic protein precursor (MalM) sequences. The function of this family is unknown. Length = 279 Score = 26.4 bits (58), Expect = 2.0 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 8/42 (19%) Query: 6 IEEAVKAKDIPQLLTFL----SLITQGLQEALITQDVKAVEA 43 IE+AV DIP+ L+ L +L +G QE VKAV + Sbjct: 240 IEQAVAKGDIPKALSLLDEAKALGIEGAQEVF----VKAVNS 277 >gnl|CDD|181963 PRK09573, PRK09573, (S)-2,3-di-O-geranylgeranylglyceryl phosphate synthase; Reviewed. Length = 279 Score = 25.3 bits (56), Expect = 3.8 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 13/63 (20%) Query: 15 IPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSE 74 I L F S + VK +E ++ DLK+ V L I + G K KS ++++ Sbjct: 158 ILFLCAFFST--------WSREIVKDIEDIEGDLKENVITLPI----KYGIK-KSWYIAK 204 Query: 75 ILV 77 IL+ Sbjct: 205 ILL 207 >gnl|CDD|178811 PRK00035, hemH, ferrochelatase; Reviewed. Length = 333 Score = 25.1 bits (56), Expect = 4.4 Identities = 7/35 (20%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Query: 55 LAISYMKRCGDKGKSQFLSEILVPALGTHKTFVDC 89 + I Y + + G +F +P L F++ Sbjct: 283 IDIEYREIAEEAGGEEF---RRIPCLNDSPEFIEA 314 >gnl|CDD|117139 pfam08564, CDC37_C, Cdc37 C terminal domain. Cdc37 is a protein required for the activity of numerous eukaryotic protein kinases. This domains corresponds to the C terminal domain whose function is unclear. It is found C terminal to the Hsp90 chaperone (Heat shocked protein 90) binding domain pfam08565 and the N terminal kinase binding domain of Cdc37 pfam03234. Length = 87 Score = 24.6 bits (54), Expect = 5.4 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Query: 27 QGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKG 67 LQ+A T+D+ V V + V A +M+R D G Sbjct: 16 PELQKAFETKDLDEVNKVLAKMP--VEE-AEYHMERLIDSG 53 >gnl|CDD|185554 PTZ00323, PTZ00323, NAD+ synthase; Provisional. Length = 294 Score = 24.7 bits (54), Expect = 5.5 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 5/43 (11%) Query: 27 QGLQEALITQDVKAVEAVDPD--LKKRVTVLAISYMKRCGDKG 67 LQ L ++V+ A +P ++K+ L YM+RCG KG Sbjct: 9 PELQRVL--KEVRRKRAFNPAAWIEKKCAKLN-EYMRRCGLKG 48 >gnl|CDD|163185 TIGR03212, uraD_N-term-dom, putative urate catabolism protein. This model represents a protein that is predominantly found just upstream of the UraD protein (OHCU decarboxylase) and in a number of instances as a N-terminal fusion with it. UraD itself catalyzes the last step in the catabolism of urate to allantoate. The function of this protein is presently unknown. It shows homology with the pfam01522 polysaccharide deacetylase domain family. Length = 297 Score = 24.7 bits (54), Expect = 6.4 Identities = 7/13 (53%), Positives = 8/13 (61%) Query: 64 GDKGKSQFLSEIL 76 GD FLSEI+ Sbjct: 42 GDAASEAFLSEIV 54 >gnl|CDD|185239 PRK15339, PRK15339, type III secretion system outer membrane pore InvG; Provisional. Length = 559 Score = 24.3 bits (53), Expect = 7.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Query: 3 VHFIEEAVKAKDIPQLLTFLSL 24 VHFIE VKA D+ + LSL Sbjct: 286 VHFIEMLVKALDVAKRHVELSL 307 >gnl|CDD|185540 PTZ00288, PTZ00288, glucokinase 1; Provisional. Length = 405 Score = 24.1 bits (52), Expect = 9.3 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 10 VKAKDIPQLLTFLSLITQGLQEAL-ITQDVKA 40 V DI +LL F + Q L++ L Q V A Sbjct: 62 VTKTDIRELLEFFDEVLQKLKKNLSFIQRVAA 93 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.135 0.368 Gapped Lambda K H 0.267 0.0702 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,663,047 Number of extensions: 91945 Number of successful extensions: 194 Number of sequences better than 10.0: 1 Number of HSP's gapped: 194 Number of HSP's successfully gapped: 23 Length of query: 107 Length of database: 5,994,473 Length adjustment: 73 Effective length of query: 34 Effective length of database: 4,417,089 Effective search space: 150181026 Effective search space used: 150181026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.1 bits)