RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780123|ref|YP_003064536.1| hypothetical protein CLIBASIA_00010 [Candidatus Liberibacter asiaticus str. psy62] (107 letters) >3jys_A SUSD superfamily protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 2.00A {Bacteroides vulgatus atcc 8482} (A:1-179,A:289-351,A:457-499) Length = 285 Score = 27.5 bits (60), Expect = 0.69 Identities = 8/77 (10%), Positives = 17/77 (22%), Gaps = 9/77 (11%) Query: 14 DIPQLLTFLSLITQGLQEALITQD-VKAV-EAVDPDLKKRVTVLAISYMKRCGDKGKSQF 71 P IT+ + + ++ +L + L G + S Sbjct: 139 LPP-------FITEKNYSIEPAPLSREDLFNWIEAELNEIKPNLPSPRQGWAGFRATSNL 191 Query: 72 LSEILVPALGTHKTFVD 88 + K Sbjct: 192 VHLFDFQNDEEPKASEI 208 >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} (A:1-90) Length = 90 Score = 25.6 bits (56), Expect = 2.7 Identities = 10/60 (16%), Positives = 18/60 (30%), Gaps = 4/60 (6%) Query: 42 EAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVD----CTDEDFRLV 97 + V KK++ V + + + E + + V C E LV Sbjct: 28 QGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLV 87 >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} (A:296-417) Length = 122 Score = 25.4 bits (55), Expect = 2.8 Identities = 10/60 (16%), Positives = 18/60 (30%), Gaps = 4/60 (6%) Query: 42 EAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVD----CTDEDFRLV 97 + V KK++ V + + + E + + V C E LV Sbjct: 59 QGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLV 118 >3cl6_A PUUE allantoinase; URIC acid, nitrogen fixation, hydrolase; 1.58A {Pseudomonas fluorescens} PDB: 3cl7_A 3cl8_A 1z7a_A (A:43-79) Length = 37 Score = 24.2 bits (53), Expect = 5.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Query: 64 GDKGKSQFLSEIL 76 GDK FLSE++ Sbjct: 4 GDKESEAFLSEMV 16 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.319 0.135 0.368 Gapped Lambda K H 0.267 0.0486 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 751,037 Number of extensions: 28318 Number of successful extensions: 45 Number of sequences better than 10.0: 1 Number of HSP's gapped: 45 Number of HSP's successfully gapped: 8 Length of query: 107 Length of database: 4,956,049 Length adjustment: 63 Effective length of query: 44 Effective length of database: 2,826,334 Effective search space: 124358696 Effective search space used: 124358696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.6 bits)