RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780123|ref|YP_003064536.1| hypothetical protein CLIBASIA_00010 [Candidatus Liberibacter asiaticus str. psy62] (107 letters) >d1us7b_ a.205.1.1 (B:) Hsp90 co-chaperone CDC37 {Human (Homo sapiens) [TaxId: 9606]} Length = 201 Score = 28.6 bits (64), Expect = 0.14 Identities = 10/41 (24%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Query: 27 QGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKG 67 + LQ+ +DV+ ++ + A +M+RC D G Sbjct: 156 EELQKCFDVKDVQMLQDAISKMDPTD---AKYHMQRCIDSG 193 >d1iqqa_ d.124.1.1 (A:) S3-RNase {Japanese pear (Pyrus pyrifolia) [TaxId: 3767]} Length = 200 Score = 24.7 bits (53), Expect = 2.4 Identities = 14/69 (20%), Positives = 30/69 (43%), Gaps = 4/69 (5%) Query: 25 ITQGLQEALITQDVKA--VEAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGT 82 +++ L +A I D K + ++ ++ +C KG + L EI + + + Sbjct: 117 VSRILSKAKIEPDGKKRALLDIENAIRNGADNKKPKL--KCQKKGTTTELVEITLCSDKS 174 Query: 83 HKTFVDCTD 91 + F+DC Sbjct: 175 GEHFIDCPH 183 >d2hrca1 c.92.1.1 (A:65-423) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]} Length = 359 Score = 24.0 bits (51), Expect = 3.4 Identities = 8/99 (8%), Positives = 29/99 (29%), Gaps = 13/99 (13%) Query: 4 HFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRC 63 +++ ++ + + G L Q ++++ + +K + ++ I++ Sbjct: 218 ATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDH 277 Query: 64 -------GDKGKSQFLSEI------LVPALGTHKTFVDC 89 + E +L + F Sbjct: 278 IETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKA 316 >d1n93x_ a.206.1.1 (X:) P40 nucleoprotein {Borna disease virus [TaxId: 12455]} Length = 343 Score = 22.7 bits (48), Expect = 9.3 Identities = 8/20 (40%), Positives = 10/20 (50%) Query: 19 LTFLSLITQGLQEALITQDV 38 L FL L+ GL A + V Sbjct: 49 LVFLCLLIPGLHAAFVHGGV 68 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.319 0.135 0.368 Gapped Lambda K H 0.267 0.0476 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 372,786 Number of extensions: 15014 Number of successful extensions: 35 Number of sequences better than 10.0: 1 Number of HSP's gapped: 34 Number of HSP's successfully gapped: 6 Length of query: 107 Length of database: 2,407,596 Length adjustment: 67 Effective length of query: 40 Effective length of database: 1,487,686 Effective search space: 59507440 Effective search space used: 59507440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.5 bits)