BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780123|ref|YP_003064536.1| hypothetical protein CLIBASIA_00010 [Candidatus Liberibacter asiaticus str. psy62] (107 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780123|ref|YP_003064536.1| hypothetical protein CLIBASIA_00010 [Candidatus Liberibacter asiaticus str. psy62] Length = 107 Score = 215 bits (548), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 107/107 (100%), Positives = 107/107 (100%) Query: 1 MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYM 60 MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYM Sbjct: 1 MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYM 60 Query: 61 KRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA 107 KRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA Sbjct: 61 KRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA 107 >gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 22.3 bits (46), Expect = 2.4, Method: Compositional matrix adjust. Identities = 15/62 (24%), Positives = 27/62 (43%) Query: 41 VEAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAK 100 V V P + T+L I+ + D+G +++ K+F+ C+ F E + Sbjct: 39 VALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHR 98 Query: 101 LL 102 LL Sbjct: 99 LL 100 >gi|254780299|ref|YP_003064712.1| acyl-CoA dehydrogenase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 562 Score = 20.8 bits (42), Expect = 5.9, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 4/28 (14%) Query: 49 KKRVTVL--AISYMKRCGDKGKSQFLSE 74 KK +T+L +IS K DKG ++FL+E Sbjct: 481 KKVITILRDSISLCKE--DKGLARFLTE 506 >gi|254780837|ref|YP_003065250.1| putative restriction endonuclease S subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 426 Score = 20.4 bits (41), Expect = 9.4, Method: Composition-based stats. Identities = 8/27 (29%), Positives = 18/27 (66%) Query: 28 GLQEALITQDVKAVEAVDPDLKKRVTV 54 GL+++L +DVK + + P +K++ + Sbjct: 352 GLRQSLKFEDVKRLPVLVPPIKEQFDI 378 >gi|254780804|ref|YP_003065217.1| DNA polymerase III subunit delta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 20.4 bits (41), Expect = 9.4, Method: Composition-based stats. Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 75 ILVPALGTHKTFVDCTDE 92 IL+ L T K +DC +E Sbjct: 86 ILIENLSTEKKVLDCLEE 103 >gi|254780142|ref|YP_003064555.1| DNA-directed RNA polymerase subunit beta' [Candidatus Liberibacter asiaticus str. psy62] Length = 1398 Score = 20.0 bits (40), Expect = 9.9, Method: Composition-based stats. Identities = 6/29 (20%), Positives = 15/29 (51%) Query: 48 LKKRVTVLAISYMKRCGDKGKSQFLSEIL 76 +KK ++ + + + CG K F +++ Sbjct: 597 IKKNISAMVDTIYRHCGQKSTVAFCDDLM 625 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.135 0.368 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,330 Number of Sequences: 1233 Number of extensions: 1856 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 107 length of database: 328,796 effective HSP length: 62 effective length of query: 45 effective length of database: 252,350 effective search space: 11355750 effective search space used: 11355750 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 32 (16.9 bits)