RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780124|ref|YP_003064537.1| hypothetical protein CLIBASIA_00015 [Candidatus Liberibacter asiaticus str. psy62] (388 letters) >gnl|CDD|107207 cd06446, Trp-synth_B, Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions. In the alpha reaction, indole 3-glycerol phosphate is cleaved reversibly to glyceraldehyde 3-phosphate and indole at the active site of the alpha subunit. In the beta reaction, indole undergoes a PLP-dependent reaction with L-serine to form L-tryptophan at the active site of the beta subunit. Members of this CD, Trp-synth_B, are found in all three major phylogenetic divisions.. Length = 365 Score = 33.7 bits (78), Expect = 0.080 Identities = 12/31 (38%), Positives = 20/31 (64%) Query: 333 KELEQLYKEQKVSDEFWEELQELITRGDGKP 363 +ELEQ + +++ +F EEL+EL G+P Sbjct: 4 EELEQEFSKERYDPDFPEELRELYKDYVGRP 34 >gnl|CDD|30482 COG0133, TrpB, Tryptophan synthase beta chain [Amino acid transport and metabolism]. Length = 396 Score = 32.5 bits (74), Expect = 0.21 Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 333 KELEQLYKEQKVSDEFWEELQELITRGDGKP 363 +ELE+ Y++ K EF EL L+ G+P Sbjct: 26 EELEKAYEKAKNDPEFQAELDYLLKDYAGRP 56 >gnl|CDD|39479 KOG4278, KOG4278, KOG4278, Protein tyrosine kinase [Signal transduction mechanisms]. Length = 1157 Score = 29.7 bits (66), Expect = 1.4 Identities = 11/57 (19%), Positives = 25/57 (43%) Query: 327 RILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSE 383 + + E ++ +SDE +EL + + P+ +P+ +T +S + E Sbjct: 512 SFAEIHQAFETMFSSSSISDEVQKELGKNNDKKSVVPLPRLPILPSKTRTLRSNVEE 568 >gnl|CDD|33956 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]. Length = 640 Score = 29.5 bits (66), Expect = 1.7 Identities = 14/77 (18%), Positives = 28/77 (36%), Gaps = 13/77 (16%) Query: 176 RVRTGSPINEWVISADDLLEKAKEFKE------RGTLALS--LKSKRAVSLEHYGVNDDS 227 V T P + V + +++A E + AL + + + Y V+++ Sbjct: 521 DVETVDPYD--VKELSEAIKEALEVPGPSVIIAKRECALEKRRRKRGGMKAPKYFVDEEK 578 Query: 228 C---RFCRAKVRCPALS 241 C C CP++ Sbjct: 579 CTGCGDCIVLSGCPSIE 595 >gnl|CDD|39109 KOG3906, KOG3906, KOG3906, Tryptophan 2,3-dioxygenase [Amino acid transport and metabolism]. Length = 399 Score = 29.2 bits (65), Expect = 1.8 Identities = 18/86 (20%), Positives = 36/86 (41%), Gaps = 1/86 (1%) Query: 300 RKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQKVSDEFWEELQELITRG 359 + + +KD+ +EL T + EE + LE+ + FW + ++ + R Sbjct: 169 KYNAQHYKDVFNDEELKTLNVSEEEKSLLELVESWLERTPGLESTGFNFWIKYEKSVNRY 228 Query: 360 DGKPVIAPRDIPTNKQTQKSQLSEFE 385 D P+N + + QL+E+ Sbjct: 229 LEDLAKQAAD-PSNTEEKAKQLAEYH 253 >gnl|CDD|36106 KOG0888, KOG0888, KOG0888, Nucleoside diphosphate kinase [Nucleotide transport and metabolism]. Length = 156 Score = 29.1 bits (65), Expect = 2.3 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Query: 324 AFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIA 366 A K + + + LE+ Y + K S F+ L E ++ G PV+A Sbjct: 38 ALKLVQLSKELLEEHYSDLK-SKPFFPGLVEYMSSG---PVVA 76 >gnl|CDD|37285 KOG2074, KOG2074, KOG2074, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB1 [Transcription, Replication, recombination and repair]. Length = 548 Score = 28.9 bits (64), Expect = 2.6 Identities = 19/81 (23%), Positives = 32/81 (39%), Gaps = 6/81 (7%) Query: 274 VKACEDEMFKRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPK 333 +K + F N D ++ V+ K + + + T+ E +L+ Sbjct: 69 LKQGDTHNFSFPNENDAVKERDAVKDTKALALQELLPNFESKATAKELELKQS-LLQENP 127 Query: 334 ELEQLYKEQKVS-----DEFW 349 L +LYKE VS +EFW Sbjct: 128 VLFKLYKELVVSKVLSPEEFW 148 >gnl|CDD|144066 pfam00334, NDK, Nucleoside diphosphate kinase. Length = 135 Score = 28.6 bits (65), Expect = 2.8 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Query: 324 AFKRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIA 366 A K + T ++ E+ Y E K F+ L E +T G PV+A Sbjct: 33 ALKMLQLTREQAEEHYAEHK-GKPFFPGLVEFMTSG---PVVA 71 >gnl|CDD|31531 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown]. Length = 294 Score = 28.3 bits (63), Expect = 3.7 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 8/101 (7%) Query: 274 VKACEDEMFKRLNA-GDEIQGY--QLVEGRKGNRSFKDINRAQELL-----TSVLGEEAF 325 +K DE+ +L E + + E G RS K + R E L TSVL E Sbjct: 74 LKEKRDEINAKLQELRKEYRELKEKRNEFNLGGRSIKSLEREIERLEKKQQTSVLTPEEE 133 Query: 326 KRILKTPKELEQLYKEQKVSDEFWEELQELITRGDGKPVIA 366 + +++ KEL + ++ K + E E+L+EL D A Sbjct: 134 RELVQKIKELRKELEDAKKALEENEKLKELKAEIDELKKKA 174 >gnl|CDD|39897 KOG4699, KOG4699, KOG4699, Preprotein translocase subunit Sec66 [Intracellular trafficking, secretion, and vesicular transport]. Length = 180 Score = 27.3 bits (60), Expect = 8.1 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Query: 321 GEEAFKRILKTPKELEQ---LYKEQKVSDEFWEELQEL 355 E +R++K K++E LY++ + +E WE E Sbjct: 73 AAEFKRRVMKLKKDMEVLNTLYEDGMIGEEHWERFNEE 110 >gnl|CDD|35097 COG5538, SEC66, Endoplasmic reticulum translocation complex, subunit SEC66 [Cell motility and secretion]. Length = 180 Score = 27.3 bits (60), Expect = 8.1 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Query: 321 GEEAFKRILKTPKELEQ---LYKEQKVSDEFWEELQEL 355 E +R++K K++E LY++ + +E WE E Sbjct: 73 AAEFKRRVMKLKKDMEVLNTLYEDGMIGEEHWERFNEE 110 >gnl|CDD|99899 cd05838, WHSC1_related, The PWWP domain was first identified in the WHSC1 (Wolf-Hirschhorn syndrome candidate 1) protein, a protein implicated in Wolf-Hirschhorn syndrome (WHS). When translocated, WHSC1 plays a role in lymphoid multiple myeloma (MM) disease, also known as plasmacytoma. WHCS1 proteins typically contain two copies of the PWWP domain. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.. Length = 95 Score = 27.3 bits (61), Expect = 8.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 364 VIAPRDIPTNKQTQKSQLSEFEV 386 + PR++P N Q + + EF V Sbjct: 21 ICDPREVPPNIQVLRHCIGEFCV 43 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0772 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,434,590 Number of extensions: 225142 Number of successful extensions: 621 Number of sequences better than 10.0: 1 Number of HSP's gapped: 620 Number of HSP's successfully gapped: 21 Length of query: 388 Length of database: 6,263,737 Length adjustment: 96 Effective length of query: 292 Effective length of database: 4,189,273 Effective search space: 1223267716 Effective search space used: 1223267716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 58 (26.0 bits)