Query gi|254780126|ref|YP_003064539.1| hypothetical protein CLIBASIA_00025 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 216 No_of_seqs 117 out of 177 Neff 5.9 Searched_HMMs 39220 Date Sun May 22 13:16:44 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780126.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam10991 DUF2815 Protein of u 100.0 0 0 353.8 17.7 178 3-197 3-181 (181) 2 PHA00458 single-stranded DNA-b 100.0 1.2E-31 3.1E-36 214.7 14.4 162 4-178 7-184 (230) 3 TIGR01060 eno phosphopyruvate 54.2 7.3 0.00019 18.9 1.6 16 99-114 247-262 (430) 4 smart00425 TBOX Domain first f 36.0 24 0.00062 15.6 1.9 37 4-44 23-59 (190) 5 pfam10927 DUF2738 Protein of u 33.4 34 0.00088 14.7 8.8 57 119-181 153-210 (246) 6 TIGR02309 HpaB-1 4-hydroxyphen 30.7 38 0.00097 14.4 3.4 25 30-55 64-88 (487) 7 pfam00907 T-box T-box. The T-b 29.6 36 0.00093 14.6 2.0 36 4-44 22-58 (183) 8 cd00182 TBOX T-box DNA binding 29.6 36 0.00091 14.6 1.9 37 4-44 24-60 (188) 9 TIGR02720 pyruv_oxi_spxB pyruv 27.9 39 0.00098 14.4 1.8 98 3-111 153-254 (577) 10 TIGR02347 chap_CCT_zeta T-comp 26.3 46 0.0012 14.0 2.9 24 32-55 380-403 (548) 11 pfam03952 Enolase_N Enolase, N 26.0 38 0.00098 14.4 1.5 52 119-181 9-62 (132) 12 KOG3585 consensus 25.6 47 0.0012 13.9 2.6 37 3-44 46-83 (328) 13 TIGR01485 SPP_plant-cyano sucr 25.0 48 0.0012 13.8 2.4 35 8-48 105-139 (257) 14 TIGR01984 UbiH 2-polyprenyl-6- 24.4 49 0.0013 13.7 3.7 63 3-65 219-291 (425) 15 pfam12208 DUF3601 Domain of un 23.1 52 0.0013 13.6 2.6 17 134-150 4-20 (79) 16 PRK10797 glutamate and asparta 22.9 53 0.0014 13.6 3.8 20 3-26 41-60 (302) 17 cd03313 enolase Enolase: Enola 20.5 59 0.0015 13.3 2.1 10 32-41 157-166 (408) No 1 >pfam10991 DUF2815 Protein of unknown function (DUF2815). This is a phage related family of proteins with unknown function. Probab=100.00 E-value=0 Score=353.77 Aligned_cols=178 Identities=30% Similarity=0.516 Sum_probs=151.8 Q ss_pred EEEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC Q ss_conf 36776899833127864112367886624799999637878999999999999987542000221001344443446652 Q gi|254780126|r 3 KLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGV 82 (216) Q Consensus 3 kvt~kgr~sYp~L~~P~~~~~~~g~~~~kYs~~llipK~d~~~~~~i~~AI~~a~~~~~~~k~~~~~~~~~k~~~~~k~p 82 (216) -+|.++||||||||+|.... +|+++|||||+|||||+|++++++|++||++|++++|+.+... .+.++.+|+| T Consensus 3 v~t~~VRlSy~~l~ep~~~~--~~~ge~KYs~t~lipK~d~~ti~~I~~AI~~a~~~~~~~k~~g-----~~~~~~~k~p 75 (181) T pfam10991 3 VKTGNVRLSYANLFEPKSIE--NGQGEPKYSASFIIPKSDTETIKAIKAAIKAAAEEGWGKKADG-----KKIPATLKTP 75 (181) T ss_pred EEECCEEEECCCCCCCCCCC--CCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCC-----CCCCCCCCCC T ss_conf 58674889843104664344--6898623689999857988999999999999998754100357-----7257656563 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCEEECCCCCCC-CCCCCCCCCCCEEEEEEEEEEEECCCCCCEEEE Q ss_conf 1017545555545445654227738993037777883685787473-476774015407999999998640788531169 Q gi|254780126|r 83 LRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPV-SDPREVFYPGCWVIAKLNIGAYELDPYKTKGFS 161 (216) Q Consensus 83 lrDGD~~~~~~~~~~~~~e~~~g~~~i~a~~k~~kP~ivD~~~~~i-~d~~~~iySGs~~kv~~~~~pY~~~~~~gkGVs 161 (216) |||||.+++.++ ++|+|+|||||+|+ +||.|||++++|| +++++ ||||||+||+++||+|+.++| |||+ T Consensus 76 lrDGD~~~~~d~------~~y~g~~~inA~sk-~~P~vvD~~~~pi~~~~~e-vYSGcy~rasi~~~ayn~~gn--KGI~ 145 (181) T pfam10991 76 LRDGDLERPFDD------EAYAGHYFINASSK-TRPLIVDRNVRPLALDEGE-VYSGCYANASINFYAYNNNGN--KGIA 145 (181) T ss_pred CCCCCCCCCCCC------CCCCCCEEEECCCC-CCCCEECCCCCCCCCCCCC-EECCEEEEEEEEEEEEECCCC--CEEE T ss_conf 115874665657------55487589965788-7991663876524467785-764528999998988826899--2488 Q ss_pred EEECEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC Q ss_conf 997407997248755566665534334443333334 Q gi|254780126|r 162 CTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSD 197 (216) Q Consensus 162 ~~L~~VQ~i~dgE~~GG~~~~~~~~f~~~~~e~~~d 197 (216) |+|+|||+++|||||||++.+++++|++++++++.+ T Consensus 146 ~gL~~VQk~~DGE~lGgg~~sae~dF~~~~~~~~~~ 181 (181) T pfam10991 146 AGLNNVQFVRDGEPLGGGRVAAEDDFDALADEDEDD 181 (181) T ss_pred EEECCEEEECCCCCCCCCCCCHHHHHCCCCCCCCCC T ss_conf 850206970168714678767256504544233579 No 2 >PHA00458 single-stranded DNA-binding protein Probab=99.98 E-value=1.2e-31 Score=214.73 Aligned_cols=162 Identities=17% Similarity=0.213 Sum_probs=112.0 Q ss_pred EEEEEEEE-CCCCCCCC----CCCCCCCCCCCEEEEEEEECCCCHHH---HHHHHHHHHHHHHH---HHHHCCCCCCCCC Q ss_conf 67768998-33127864----11236788662479999963787899---99999999999875---4200022100134 Q gi|254780126|r 4 LTVKGRLS-YPALDTKV----RMKLPDGSSVEHYGCDIVFPKADTKQ---INAVEACLKTAVTE---IFPNVSPDAFLSA 72 (216) Q Consensus 4 vt~kgr~s-Yp~L~~P~----~~~~~~g~~~~kYs~~llipK~d~~~---~~~i~~AI~~a~~~---~~~~k~~~~~~~~ 72 (216) +|+.|.+. ||||++|| ++|++.|+ |||+|+||++|+++ +.+|+++++++++. ++.++.++. T Consensus 7 tTP~G~a~~Yp~LtkPD~g~~t~fne~G~----YKv~L~v~~ddp~aq~li~~ie~~~e~a~a~a~e~~~~n~~k~---- 78 (230) T PHA00458 7 TTPVGTAEPYAYIAKPDFGNEGFGNPRGV----YKVDLTVSNDDPRCQKMIDEIVKAHEEAYAAAVEEYEANPPKV---- 78 (230) T ss_pred ECCCCCCCCCCCCCCCCCCCCCCCCCCCC----EEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHH---- T ss_conf 46874301352235887575554488971----6899983575377899999999999999999998865243111---- Q ss_pred CCCCCCCCCCC--CCCCCCCCCC--CCCCCCCCCCC-CEEEEEECCCCCCCEEECCCCCCCCCCCCCCCCCCEEEEEEEE Q ss_conf 44434466521--0175455555--45445654227-7389930377778836857874734767740154079999999 Q gi|254780126|r 73 VRSKSESRGVL--RDGDAKIASS--HKPENYTQTYT-DSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNI 147 (216) Q Consensus 73 ~k~~~~~k~pl--rDGD~~~~~~--~~~~~~~e~~~-g~~~i~a~~k~~kP~ivD~~~~~i~d~~~~iySGs~~kv~~~~ 147 (216) .+.+.|+ +.||..+.+. |...+.+.+|+ +....+.+++.++|.|||++++||.+ .+.||+||.+||++.+ T Consensus 79 ----~~gKkp~~pye~d~p~~d~e~G~~~FkfK~kas~~~kKtge~~~~~~~l~Dskgkpi~~-~p~I~gGS~lKV~~~l 153 (230) T PHA00458 79 ----QRGKKPLKPYEGDMPFFDNGDGTVTFKFKCYASYQDKKTGENKPIVLRVVDSKGKRIED-VPIIGGGSKLKVKFSL 153 (230) T ss_pred ----HCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCC-CCCCCCCCEEEEEEEE T ss_conf ----02566787533568753378872899999630246433586242451688688988888-8755688678998998 Q ss_pred EEEECCCCCCEEEEEEECEEEEEECCCCCCC Q ss_conf 9864078853116999740799724875556 Q gi|254780126|r 148 GAYELDPYKTKGFSCTLTGVQFFKHDERWGA 178 (216) Q Consensus 148 ~pY~~~~~~gkGVs~~L~~VQ~i~dgE~~GG 178 (216) +||.++++.|.||+|||.+||+|+++|.-|| T Consensus 154 ~PY~~~~~~GagvslrL~avQvieLve~~g~ 184 (230) T PHA00458 154 FPYKWNAAVGASVKLQLESVMLVELAEFGGG 184 (230) T ss_pred ECCCCCCCCCEEEEEEEEEEEEEEEEECCCC T ss_conf 4133257664247988622279985320677 No 3 >TIGR01060 eno phosphopyruvate hydratase; InterPro: IPR000941 Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate , . In vertebrates, there are 3 different, tissue-specific isoenzymes, designated alpha, beta and gamma. Alpha is present in most tissues, beta is localised in muscle tissue, and gamma is found only in nervous tissue. The functional enzyme exists as a dimer of any 2 isoforms. In immature organs and in adult liver, it is usually an alpha homodimer, in adult skeletal muscle, a beta homodimer, and in adult neurons, a gamma homodimer. In developing muscle, it is usually an alpha/beta heterodimer, and in the developing nervous system, an alpha/gamma heterodimer . The tissue specific forms display minor kinetic differences. Tau-crystallin, one of the major lens proteins in some fish, reptiles and birds, has been shown to be evolutionary related to enolase. Neuron-specific enolase is released in a variety of neurological diseases, such as multiple sclerosis and after seizures or acute stroke. Several tumour cells have also been found positive for neuron-specific enolase. Beta-enolase deficiency is associated with glycogenosis type XIII defect.; GO: 0004634 phosphopyruvate hydratase activity, 0006096 glycolysis, 0000015 phosphopyruvate hydratase complex. Probab=54.23 E-value=7.3 Score=18.88 Aligned_cols=16 Identities=19% Similarity=0.281 Sum_probs=9.4 Q ss_pred CCCCCCCEEEEEECCC Q ss_conf 6542277389930377 Q gi|254780126|r 99 YTQTYTDSVYISAKNK 114 (216) Q Consensus 99 ~~e~~~g~~~i~a~~k 114 (216) +|+...+.|++..+++ T Consensus 247 FY~~~~~~Y~~~g~~~ 262 (430) T TIGR01060 247 FYDEETGKYVLKGENK 262 (430) T ss_pred HEECCCCEEEEEECCC T ss_conf 0406861588740304 No 4 >smart00425 TBOX Domain first found in the mice T locus (Brachyury) protein. Probab=35.99 E-value=24 Score=15.64 Aligned_cols=37 Identities=24% Similarity=0.319 Sum_probs=25.3 Q ss_pred EEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEECCCCHH Q ss_conf 67768998331278641123678866247999996378789 Q gi|254780126|r 4 LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTK 44 (216) Q Consensus 4 vt~kgr~sYp~L~~P~~~~~~~g~~~~kYs~~llipK~d~~ 44 (216) ||-.||-.||.|. ++..+-+. ..+|.+.|-|..-|.. T Consensus 23 vTk~GRrmFP~l~--~~vsGLdp--~~~Y~v~l~~~~~D~~ 59 (190) T smart00425 23 VTKSGRRMFPTLK--YKVSGLDP--NALYSVLMDLVPVDDK 59 (190) T ss_pred EECCCCCCCCCEE--EEEECCCC--CCCEEEEEEEEECCCC T ss_conf 9338834587359--99978895--7326999999987588 No 5 >pfam10927 DUF2738 Protein of unknown function (DUF2738). This is a viral family of proteins with unknown function. Probab=33.35 E-value=34 Score=14.71 Aligned_cols=57 Identities=26% Similarity=0.268 Sum_probs=38.6 Q ss_pred EEE-CCCCCCCCCCCCCCCCCCEEEEEEEEEEEECCCCCCEEEEEEECEEEEEECCCCCCCCCC Q ss_conf 368-578747347677401540799999999864078853116999740799724875556666 Q gi|254780126|r 119 LLV-DRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPK 181 (216) Q Consensus 119 ~iv-D~~~~~i~d~~~~iySGs~~kv~~~~~pY~~~~~~gkGVs~~L~~VQ~i~dgE~~GG~~~ 181 (216) .++ |..|+++.-++ .|++=|++.+.+-+---..++ -||++|+.+-++ .+|++|-+.. T Consensus 153 ~F~k~~~g~~~~i~D-~i~~~C~v~a~l~iESIfiG~----K~SiQlKi~~vl-ivE~l~~~r~ 210 (246) T pfam10927 153 GFFKDVEGQEVKIPD-IIKGRCRVIADLRVESIFIGA----KPSIQLKIVDVL-IVEPLGERRK 210 (246) T ss_pred EEEECCCCCCCCHHH-HHHCCEEEEEEEEEEEEEECC----CEEEEEEEEEEE-EECCCHHHHC T ss_conf 987315798556434-442505786766787788647----036899988888-8423213331 No 6 >TIGR02309 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component; InterPro: IPR012687 This entry represents the monooxygenase found within apparent operons for the degradation of 4-hydroxyphenylacetic acid in Deinococcus, Thermus and Oceanobacillus. Phylogenetic trees support inclusion of the Bacillus halodurans sequence although the complete 4-hydroxyphenylacetic acid degradation pathway may not exist in that organism. Generally, this enzyme acts with the assistance of a small flavin reductase domain protein, HpaC. This family of sequences is a member of a larger subfamily of monooxygenases HpaB.. Probab=30.72 E-value=38 Score=14.44 Aligned_cols=25 Identities=16% Similarity=0.375 Sum_probs=20.4 Q ss_pred CEEEEEEEECCCCHHHHHHHHHHHHH Q ss_conf 24799999637878999999999999 Q gi|254780126|r 30 EHYGCDIVFPKADTKQINAVEACLKT 55 (216) Q Consensus 30 ~kYs~~llipK~d~~~~~~i~~AI~~ 55 (216) .||+-+|+||++ .++++.+.+||+. T Consensus 64 kr~~~sFm~P~T-kedL~~r~ea~~~ 88 (487) T TIGR02309 64 KRYSKSFMVPKT-KEDLKERAEAYKL 88 (487) T ss_pred CCEEEEECCCCC-HHHHHHHHHHHHH T ss_conf 610012147567-6899999999999 No 7 >pfam00907 T-box T-box. The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box proteins are found in a wide range of animals, but not in other kingdoms such as plants. Family members are all thought to bind to the DNA consensus sequence TCACACCT. they are found exclusively in the nucleus, and perform DNA-binding and transcriptional activation/repression roles. They are generally required for development of the specific tissues they are expressed in, and mutations in T-box genes are implicated in human conditions such as DiGeorge syndrome and X-linked cleft palate, which feature malformations. Probab=29.62 E-value=36 Score=14.56 Aligned_cols=36 Identities=25% Similarity=0.386 Sum_probs=24.6 Q ss_pred EEEEEEEECCCCCCCCCCCCCCC-CCCCEEEEEEEECCCCHH Q ss_conf 67768998331278641123678-866247999996378789 Q gi|254780126|r 4 LTVKGRLSYPALDTKVRMKLPDG-SSVEHYGCDIVFPKADTK 44 (216) Q Consensus 4 vt~kgr~sYp~L~~P~~~~~~~g-~~~~kYs~~llipK~d~~ 44 (216) ||..||-.||.|. +...| +-..+|++.+-|..-|.. T Consensus 22 ITk~GRrMFP~l~-----~~vsGLdp~~~Y~v~ld~~~~D~~ 58 (183) T pfam00907 22 ITKSGRRMFPTLK-----VSVSGLDPNALYSVLLDFVPVDDH 58 (183) T ss_pred EECCCCCCCCCEE-----EEEECCCCCCCEEEEEEEEECCCC T ss_conf 9338834587449-----999799947317999999987688 No 8 >cd00182 TBOX T-box DNA binding domain of the T-box family of transcriptional regulators. The T-box family is an ancient group that appears to play a critical role in development in all animal species. These genes were uncovered on the basis of similarity to the DNA binding domain of murine Brachyury (T) gene product, the defining feature of the family. Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development and conserved expression patterns, most of the known genes in all species being expressed in mesoderm or mesoderm precursors. Probab=29.57 E-value=36 Score=14.62 Aligned_cols=37 Identities=24% Similarity=0.363 Sum_probs=24.9 Q ss_pred EEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEECCCCHH Q ss_conf 67768998331278641123678866247999996378789 Q gi|254780126|r 4 LTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTK 44 (216) Q Consensus 4 vt~kgr~sYp~L~~P~~~~~~~g~~~~kYs~~llipK~d~~ 44 (216) ||-.||-.||.|. ++..+-+ -..+|++.+-|..-|.. T Consensus 24 ITk~GRrMFP~l~--~~vsGLd--p~~~Y~v~ld~~~~D~~ 60 (188) T cd00182 24 ITKSGRRMFPTLK--VKVSGLD--PNALYSVLMDLVPVDDH 60 (188) T ss_pred EECCCCCCCCCEE--EEEECCC--CCCCEEEEEEEEECCCC T ss_conf 9038745687359--9996899--57417999999987677 No 9 >TIGR02720 pyruv_oxi_spxB pyruvate oxidase; InterPro: IPR014092 Members of this family are examples of pyruvate oxidase (1.2.3.3 from EC), an enzyme with FAD and TPP as cofactors that catalyses the reaction pyruvate + phosphate + O2 + H2O = acetyl phosphate + CO2 + H2O2. It should not be confused with pyruvate dehydrogenase (1.2.2.2 from EC) as in Escherichia coli PoxB, although the E. coli enzyme is closely homologous and has pyruvate oxidase as an alternate name.. Probab=27.93 E-value=39 Score=14.40 Aligned_cols=98 Identities=14% Similarity=0.073 Sum_probs=62.7 Q ss_pred EEEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHH----HHHHCCCCCCCCCCCCCCC Q ss_conf 367768998331278641123678866247999996378789999999999999875----4200022100134444344 Q gi|254780126|r 3 KLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTE----IFPNVSPDAFLSAVRSKSE 78 (216) Q Consensus 3 kvt~kgr~sYp~L~~P~~~~~~~g~~~~kYs~~llipK~d~~~~~~i~~AI~~a~~~----~~~~k~~~~~~~~~k~~~~ 78 (216) .||+..-|-|..+ |+..+...+. |.-++++|.-|.+++..+-+.|++|... +.|+++...-++. ...+ T Consensus 153 Vv~IP~dfG~~eI--~~~~y~~as~----~~~~~~~P~~~~~~v~~~~~~l~aA~~P~iY~G~Ga~~A~e~l~~--lS~~ 224 (577) T TIGR02720 153 VVTIPVDFGWQEI--PDNDYYAASV----SEKLVLLPAPDEEEVKKAVKLLKAAKRPVIYVGVGARKAGEELKA--LSEK 224 (577) T ss_pred EEECCCCCCCCCC--CCCCCCCCCC----CCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHH--HHHH T ss_conf 9985787784315--5434433445----411145888788899999999984189769983075247899999--9986 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEE Q ss_conf 665210175455555454456542277389930 Q gi|254780126|r 79 SRGVLRDGDAKIASSHKPENYTQTYTDSVYISA 111 (216) Q Consensus 79 ~k~plrDGD~~~~~~~~~~~~~e~~~g~~~i~a 111 (216) +|.||= .-....|-.+..|+.|.|+-+--| T Consensus 225 lk~Pli---~t~~akgi~~D~Y~a~lGSA~RvA 254 (577) T TIGR02720 225 LKVPLI---STGLAKGIIEDDYPAYLGSAYRVA 254 (577) T ss_pred CCCCEE---EECCCCCCCCCCCCCCCCCCHHHH T ss_conf 398848---613653011256874446512222 No 10 >TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit; InterPro: IPR012722 Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT zeta chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding. Probab=26.33 E-value=46 Score=13.96 Aligned_cols=24 Identities=13% Similarity=0.440 Sum_probs=19.8 Q ss_pred EEEEEEECCCCHHHHHHHHHHHHH Q ss_conf 799999637878999999999999 Q gi|254780126|r 32 YGCDIVFPKADTKQINAVEACLKT 55 (216) Q Consensus 32 Ys~~llipK~d~~~~~~i~~AI~~ 55 (216) =||||||-=++.-|+..|+.||.. T Consensus 380 kScTiLIkGpn~~ti~QiKDAvRD 403 (548) T TIGR02347 380 KSCTILIKGPNDHTIKQIKDAVRD 403 (548) T ss_pred CEEEEEEECCCHHHHHHHHHHHHH T ss_conf 616887328864467764676652 No 11 >pfam03952 Enolase_N Enolase, N-terminal domain. Probab=25.97 E-value=38 Score=14.43 Aligned_cols=52 Identities=17% Similarity=0.297 Sum_probs=33.4 Q ss_pred EEECCCCCCCCCCCCCCCCCCEEEEEEEEEEEECCCCCCEEEEEEECEEEEEECCC--CCCCCCC Q ss_conf 36857874734767740154079999999986407885311699974079972487--5556666 Q gi|254780126|r 119 LLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDE--RWGASPK 181 (216) Q Consensus 119 ~ivD~~~~~i~d~~~~iySGs~~kv~~~~~pY~~~~~~gkGVs~~L~~VQ~i~dgE--~~GG~~~ 181 (216) +|+|+.|+|..+.+-..-+|+.+++++ + -|-|.+-.-.+-++|++ +++|.+. T Consensus 9 ~IlDSRG~PTvev~v~~~~g~~g~a~~--------P---SGAStG~~EA~elrD~~~~~y~GkgV 62 (132) T pfam03952 9 EILDSRGNPTVEVEVTLEDGTFGRAAV--------P---SGASTGSHEAVELRDGDKSRYGGKGV 62 (132) T ss_pred EEECCCCCEEEEEEEEECCCCEEEEEC--------C---CCCCCCCCEEEEECCCCCCCCCCCCH T ss_conf 998799984799999989998899967--------7---77788871446771699641477458 No 12 >KOG3585 consensus Probab=25.60 E-value=47 Score=13.88 Aligned_cols=37 Identities=27% Similarity=0.345 Sum_probs=25.9 Q ss_pred EEEEEEEEECCCCCCCCCCCCCCC-CCCCEEEEEEEECCCCHH Q ss_conf 367768998331278641123678-866247999996378789 Q gi|254780126|r 3 KLTVKGRLSYPALDTKVRMKLPDG-SSVEHYGCDIVFPKADTK 44 (216) Q Consensus 3 kvt~kgr~sYp~L~~P~~~~~~~g-~~~~kYs~~llipK~d~~ 44 (216) -||-.||-.||.|. |...| +-..+|++.|-|..-|.. T Consensus 46 iitK~GRrmFP~l~-----~~VsGLdp~s~Y~i~l~~~~~D~~ 83 (328) T KOG3585 46 IVTKRGRRMFPALK-----FKVSGLDPNSLYSILLELVPIDDK 83 (328) T ss_pred EEECCCCEECCCCC-----CEECCCCCCCCEEEEEEEEECCCC T ss_conf 78528925246652-----043168866546899998975675 No 13 >TIGR01485 SPP_plant-cyano sucrose phosphatase; InterPro: IPR012847 This entry describes the sucrose phosphate phosphohydrolase from plants and cyanobacteria (SPP). However, a closely related group of sequences from bacteria and archaea may prove to catalyze the same reaction. SPP is a member of the Class IIB subfamily of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. SPP catalyzes the final step in the biosynthesis of sucrose, a critically important molecule for plants. Sucrose phosphate synthase (SPS), the prior step in the biosynthesis of sucrose contains a domain, which exhibits considerable similarity to SPP albeit without conservation of the catalytic residues. The catalytic machinery of the synthase resides in another domain. It seems likely that the phosphatase-like domain is involved in substrate binding, possibly binding both substrates in a "product-like" orientation prior to ligation by the synthase catalytic domain.. Probab=25.04 E-value=48 Score=13.81 Aligned_cols=35 Identities=11% Similarity=0.145 Sum_probs=25.6 Q ss_pred EEEECCCCCCCCCCCCCCCCCCCEEEEEEEECCCCHHHHHH Q ss_conf 89983312786411236788662479999963787899999 Q gi|254780126|r 8 GRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINA 48 (216) Q Consensus 8 gr~sYp~L~~P~~~~~~~g~~~~kYs~~llipK~d~~~~~~ 48 (216) -..+|+.|- -.++-+|.| ++|++.|.++++.++.+ T Consensus 105 ~t~~F~~L~-----~Qp~~eQ~~-~KvSFFl~~~~~~~V~~ 139 (257) T TIGR01485 105 ITRKFEELK-----PQPDSEQRP-HKVSFFLDKEAAAEVIK 139 (257) T ss_pred HHCCHHHHC-----CCCCCCCCC-CCEEEECCHHHHHHHHH T ss_conf 223502305-----797210477-00135407565468999 No 14 >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterPro: IPR011295 This entry represents the FAD-dependent monooxygenase responsible for the second hydroxylation step in the aerobic ubiquinone biosynthetic pathway . The sequences in this entry are restricted to the proteobacteria. This family is closely related to the UbiF hydroxylase which catalyses the final hydroxylation step. The enzyme has also been named VisB due to a mutant visible light sensitive phenotype.. Probab=24.40 E-value=49 Score=13.74 Aligned_cols=63 Identities=14% Similarity=0.178 Sum_probs=48.7 Q ss_pred EEEEEEEEECCCCCCCCCCCCCCC-------CCC-CEEEEEEEECCCCHHHHHHH-HHHHHHHHHHH-HHHCC Q ss_conf 367768998331278641123678-------866-24799999637878999999-99999998754-20002 Q gi|254780126|r 3 KLTVKGRLSYPALDTKVRMKLPDG-------SSV-EHYGCDIVFPKADTKQINAV-EACLKTAVTEI-FPNVS 65 (216) Q Consensus 3 kvt~kgr~sYp~L~~P~~~~~~~g-------~~~-~kYs~~llipK~d~~~~~~i-~~AI~~a~~~~-~~~k~ 65 (216) -++-.++.+.||-+.-++.|.+.| .+. +.||+-=-+|+++++++..+ +++.-...... ||.-. T Consensus 219 Alian~~~~~pH~~~A~ERFt~~GPlALLP~~d~q~~~slvWc~~~~~a~~~~~L~~~eFl~~Lq~~nFG~rl 291 (425) T TIGR01984 219 ALIANVRVEQPHQGCAFERFTPHGPLALLPLKDNQYRLSLVWCLPKEQAERLANLSDAEFLAELQQANFGWRL 291 (425) T ss_pred EEEEECCCCCCCCCCEEEEECCCCCEEECCCCCCCCCEEEEECCCHHHHHHHHCCCHHHHHHHHHHHHHHHHH T ss_conf 3012310035757606844477778023467899972388971897899998668988999998651222542 No 15 >pfam12208 DUF3601 Domain of unknown function (DUF3601). This domain family is found in bacteria, and is approximately 80 amino acids in length. Probab=23.08 E-value=52 Score=13.58 Aligned_cols=17 Identities=24% Similarity=0.411 Sum_probs=10.7 Q ss_pred CCCCCCEEEEEEEEEEE Q ss_conf 40154079999999986 Q gi|254780126|r 134 VFYPGCWVIAKLNIGAY 150 (216) Q Consensus 134 ~iySGs~~kv~~~~~pY 150 (216) .+||||++||.=.|.-| T Consensus 4 ~l~~G~~vkVik~F~Dy 20 (79) T pfam12208 4 YLYSGDYVKVIKAFKDY 20 (79) T ss_pred EEECCCEEEEEEEEECC T ss_conf 23058589983210246 No 16 >PRK10797 glutamate and aspartate transporter subunit; Provisional Probab=22.85 E-value=53 Score=13.55 Aligned_cols=20 Identities=15% Similarity=-0.091 Sum_probs=11.1 Q ss_pred EEEEEEEEECCCCCCCCCCCCCCC Q ss_conf 367768998331278641123678 Q gi|254780126|r 3 KLTVKGRLSYPALDTKVRMKLPDG 26 (216) Q Consensus 3 kvt~kgr~sYp~L~~P~~~~~~~g 26 (216) +|++-.+..|| |+.....+| T Consensus 41 ~l~vG~~~~~p----Pf~~~d~~g 60 (302) T PRK10797 41 VIVVGHRESSV----PFSYYDNQQ 60 (302) T ss_pred EEEEEECCCCC----CCEEECCCC T ss_conf 89999899989----971689999 No 17 >cd03313 enolase Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways. The reaction is facilitated by the presence of metal ions. Probab=20.46 E-value=59 Score=13.25 Aligned_cols=10 Identities=10% Similarity=0.291 Sum_probs=4.6 Q ss_pred EEEEEEECCC Q ss_conf 7999996378 Q gi|254780126|r 32 YGCDIVFPKA 41 (216) Q Consensus 32 Ys~~llipK~ 41 (216) +.=-+|+|.. T Consensus 157 iQEfmI~P~g 166 (408) T cd03313 157 FQEFMIVPVG 166 (408) T ss_pred CEEEEEECCC T ss_conf 3279985799 Done!