HHsearch alignment for GI: 254780127 and conserved domain: PRK00448

>PRK00448 polC DNA polymerase III PolC; Validated.
Probab=98.68  E-value=6.4e-07  Score=63.97  Aligned_cols=57  Identities=21%  Similarity=0.171  Sum_probs=44.3

Q ss_pred             CCCEEEEEEHHHHHHHHHHH---CCCCCCCCCEEEHHHHHHHHCC---CCCHHHHHHHHCCCC
Q ss_conf             89819986307759999986---2998786504545889998588---999789999808898
Q gi|254780127|r   64 ETVMCVAHNSLFERILFKKT---LGIDIPSKRWICTSVLARTNGL---PSSLKNACLALNFSE  120 (675)
Q Consensus        64 ~~~~kv~HNa~FD~~vL~~~---lGi~i~~~~~~DTmi~A~~l~~---p~sL~~la~~lgl~~  120 (675)
T Consensus       497 ~d~vlVAHNa~FD~~Fi~~~~~~~~~~~~~~p~iDTl~lsr~l~p~~k~~~L~~l~k~~~v~~  559 (1436)
T PRK00448        497 GDSVLVAHNASFDVGFINTNYEKLGLEKIKNPVIDTLELSRFLYPEYKSHRLNTLAKKFGVEL  559 (1436)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCEECHHHHHHHHCCCCCCCCHHHHHHHHCCCC
T ss_conf             897799845865688999999980898667972302998987551011144788998848886