HHsearch alignment for GI: 254780127 and conserved domain: PRK05797

>PRK05797 consensus.
Probab=100.00  E-value=0  Score=843.25  Aligned_cols=517  Identities=19%  Similarity=0.226  Sum_probs=437.9

Q ss_pred             EEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCCEEEEEECCC---CCHHHHHHHHHHCCCCCEEEEEEHHHHHHH
Q ss_conf             89998040678870004600002688299999998382289997888---422179999986488981998630775999
Q gi|254780127|r    3 KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE---QSAMPSDLLQYLRDETVMCVAHNSLFERIL   79 (675)
Q Consensus         3 ~l~lD~ET~s~~dl~~~Gl~~y~~~~~I~~i~~a~~~~~~~~~d~~~---~~~~~~~l~~~L~~~~~~kv~HNa~FD~~v   79 (675)
T Consensus       321 ~~~~~~ett~~~~~----------~~~~vg~s~~~~~~~a~yip~~~~~~~~~~L~~Lk~lLed~~i~KIGhNlK~dl~v  390 (869)
T PRK05797        321 QVYINFTLEDENLY----------SKIEIKKIFINFGEKTYYIDFKELIDEEEFIEDLKEIFENEEIKKIGHDIKNFLTI  390 (869)
T ss_pred             CEEEEEECCCCCHH----------HHHHEEEEEEECCCEEEEEECHHHCCHHHHHHHHHHHHHCCCCCEEEECCHHHHHH
T ss_conf             87999973897612----------03041899996199799983145167789999999998489987898430699999


Q ss_pred             HHHHCCCCCCCCCEEEHHHHHHHHCC---CCCHHHHHHH-HCCCCCCHHHHHCHHHHHHHHHHHHHHCCCCCCCCCCHHH
Q ss_conf             99862998786504545889998588---9997899998-0889865276637657664100233201345311258768
Q gi|254780127|r   80 FKKTLGIDIPSKRWICTSVLARTNGL---PSSLKNACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQA  155 (675)
Q Consensus        80 L~~~lGi~i~~~~~~DTmi~A~~l~~---p~sL~~la~~-lgl~~~~~kd~~gk~li~~~~~~~~~~~~~~~~~~~~~~~  155 (675)
T Consensus       391 L~~~-GI~l~g-i~FDTMLAsYLLnP~~~~h~Ld~La~~yL~~~~~~~--------------------------------  436 (869)
T PRK05797        391 LKKL-GIEFKG-LAFDTAIAAYLIDPSKSEYDLSDLAKEYLSKDVNSE--------------------------------  436 (869)
T ss_pred             HHHC-CCCCCC-HHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCCCCH--------------------------------
T ss_conf             9975-985566-166899999972899888899999999808777514--------------------------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCC----------HHHHHHHHHHHHHHHHCCEECCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9998988775399999999872002----------143101789999875168430889999999999999999999998
Q gi|254780127|r  156 WQLFGEYCKRDVEATRELFKRLIPL----------SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIV  225 (675)
Q Consensus       156 ~~~~~~Ya~~Dv~~~~~L~~~L~~~----------~~~E~~l~~~~~~me~~Gi~vD~e~l~~~~~~~~~~~~~~~~~i~  225 (675)
T Consensus       437 ---e~~ya~~dA~~~~~L~~~L~~~L~~~~l~~L~~~IE~PLi~VLa~ME~~GI~VD~~~L~~l~~~l~~~l~~le~~I~  513 (869)
T PRK05797        437 ---EEEYKIKEVSVMKELYEKLKEKIEEMDMEKLLYEVELPLVEVLASMESEGFKVDKDILDELSKKFKEEIEKTQKEIY  513 (869)
T ss_pred             ---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             ---78999999999999999999999861289999999867899999998468099999999999999999999999999


Q ss_pred             HHCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCH---HHHHHHHHH-CCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHCC
Q ss_conf             630576688885688999999972899988896---588999974-4898548999999999754300035668873056
Q gi|254780127|r  226 KLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE---GTLKSILSH-SNITQLAKDLILNRLASSGSAILKLNTLSEAVSS  301 (675)
Q Consensus       226 ~~~g~~~~n~~S~~ql~~~L~~~~g~~~~~~~k---~~~~~~l~~-~~~~~~~~~ll~~r~~~~~~~~~~~~~l~~~~~~  301 (675)
T Consensus       514 ~~aG~eF-NinSPKQL~~iLFe~LgLp~~KKtKtG~STd~~vLe~L~~~hpi~~~iLeyR~l~KL~sT-Y~d~L~~~i~~  591 (869)
T PRK05797        514 ELAGEEF-NINSPKQLGKILFEKLDLPVIKKTKTGYSTNAEVLEKLRDKHPIIEKITEYRQLTKLYST-YVEGLKNVIDE  591 (869)
T ss_pred             HHCCCCC-CCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHH-HHHHHHHHCCC
T ss_conf             8628866-789989999998986499988878899878599999765548851999998799899988-98789974262


Q ss_pred             CCCCCCCEEECCCCCCHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHEEEECCCC-CEEEEEE
Q ss_conf             884522002113221001110688855477776652345654431024445544432210132121476998-7899973
Q gi|254780127|r  302 DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNG-KKLVVAD  380 (675)
Q Consensus       302 dGRih~~~~~~gAt~TGR~S~~~pNlQnlPr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iR~~f~a~~G-~~lv~aD  380 (675)
T Consensus       592 ~gRiHt~f~Q~~-t~TGRLSS~~PNLQNIP------------------------~r~e~G~~iR~aFi~~~~~~~l~saD  646 (869)
T PRK05797        592 DGRIHSNFNQTV-TTTGRLSSTEPNLQNIP------------------------IKYEMGREIRKVFIPNTEDSVILSAD  646 (869)
T ss_pred             CCCCCCHHHHHH-CCCCCCCCCCCCCCCCC------------------------CCCCCHHHHHHEEECCCCCCEEEECC
T ss_conf             465054266543-44021146898645687------------------------76520122553571477761588522


Q ss_pred             CCCCCEEEEEEECCCHHHHHHHHCCCCCCCCCHHHHHCCCCCCCCHHHHHCCCCCHHHHHHCCCHHHHHHHHHHCCCCCC
Q ss_conf             35485058866228767866540444100001577608751105702210064210013307887789887887088864
Q gi|254780127|r  381 LAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQ  460 (675)
Q Consensus       381 ySqiElRvlA~ls~d~~li~~f~~g~D~h~~tA~~~~~~~~~~v~~~~R~~aK~~~~gl~YG~G~~~l~~~~~~~G~~~~  460 (675)
T Consensus       647 YSQIELRilAh~s~d~~l~~af~~~~DiH~~tA~~vf~~~~~~v~~~~R~~AK~infGiiYG~~~~gLs~----------  716 (869)
T PRK05797        647 YSQIELRVLAHISGDENLIDAFNHHEDIHTKTASEVFKVPIEEVTPLMRSNAKAVNFGIVYGIGDFSLSQ----------  716 (869)
T ss_pred             HHHHHHHHHHHHHCCHHHHHHHHCCCCHHHHHHHHHHCCCHHHCCHHHHHHHHHHHHHHHHCCCHHHHHH----------
T ss_conf             7789999999984689999988559976899999995989111798899998898856655568677898----------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             03666665666765478899999999987511101031088978899999986730789999999999999633721420
Q gi|254780127|r  461 QFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA  540 (675)
Q Consensus       461 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ea~~~~~~~~~~~p~i~~~~~~~~~~~~~~~~~~~~~~~  540 (675)
T Consensus       717 ----------------------------------~l~i~~~eA~~~i~~yf~~yp~v~~~~~~~~~~a~~---~g-----  754 (869)
T PRK05797        717 ----------------------------------DLNISRKEAKEYIDNYFERYPNVKEYMEKIVEEAKE---KG-----  754 (869)
T ss_pred             ----------------------------------HCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHH---CC-----
T ss_conf             ----------------------------------529899999999999999680499999999999997---89-----


Q ss_pred             CCCCCCCCCCCCCCCCCCEEECCCCHHHCCCCCCHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             13222344321244564112246311310245201233203100123577653355777674798999999999999967
Q gi|254780127|r  541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN  620 (675)
Q Consensus       541 ~~~~~~~~~~~~~~~~~l~i~~psGR~l~~~~~~~~~~~~~~~~~~~~r~~~~g~k~~n~~iQgtAaDi~k~am~~l~~~  620 (675)
T Consensus       755 ------------------~v~Tl~gRrr~~p~i~s~n~~~r---~~~eR~------AiN~piQGtaADiiK~AMi~~~~~  807 (869)
T PRK05797        755 ------------------YVTTILNRRRYIPEIKSSNKIVR---AFGERL------AMNTPIQGSAADIIKLAMVNVYNK  807 (869)
T ss_pred             ------------------EEECCCCCEECCCCCCCCCHHHH---HHHHHH------HHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             ------------------07888887335887778898899---778887------827465567999999999999999


Q ss_pred             ------CCCEEEEECCEEEEECCCCHHHHHHH-HHHHHCCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             ------98189995358999678478999999-9998467630216984157303114631
Q gi|254780127|r  621 ------GYDIVLTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRYR  674 (675)
Q Consensus       621 ------g~~ivl~VHDElv~evp~~~~~~~~~-i~~~M~~~p~wa~~~pl~a~~~~~~~y~  674 (675)
T Consensus       808 l~~~~~~~~~~lqVHDElv~ev~~~~~~~~~~~v~~~Me~~~~--l~VPl~v~~~~g~nW~  866 (869)
T PRK05797        808 LKELNLKSKLILQVHDELILNVYKDELEEVKKIVKEEMENVIK--LKVPLDVDINVGNNWY  866 (869)
T ss_pred             HHHCCCCCEEEEEEEEEEEEEECHHHHHHHHHHHHHHHHCCCC--CCCCEEEECCCCCCHH
T ss_conf             9854998649999732668951688999999999999728425--7887473048278967