HHsearch alignment for GI: 254780127 and conserved domain: PRK07300

>PRK07300 consensus.
Probab=100.00  E-value=0  Score=818.76  Aligned_cols=527  Identities=18%  Similarity=0.188  Sum_probs=422.7

Q ss_pred             EEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCCEEEEEECCCCCHHHHHHHHHHCCCCCEEEEEEHHHHHHHHHHHC
Q ss_conf             99804067887000460000268829999999838228999788842217999998648898199863077599999862
Q gi|254780127|r    5 FIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRDETVMCVAHNSLFERILFKKTL   84 (675)
Q Consensus         5 ~lD~ET~s~~dl~~~Gl~~y~~~~~I~~i~~a~~~~~~~~~d~~~~~~~~~~l~~~L~~~~~~kv~HNa~FD~~vL~~~l   84 (675)
T Consensus       323 ~~~~et~~~--------~~~--~a~lvG~s~--~~~~~~y~~~~~~~l~~~~~~~~~~~---~i~~~nlK~~~~vL~~~-  386 (880)
T PRK07300        323 FFYFETLGD--------NYH--REAIIGFAW--GNGEQIYASTDLSLLATDSFKQVLQK---PIATYDFKRSKVLLSHL-  386 (880)
T ss_pred             EEEEEECCC--------CCC--CCCEEEEEE--ECCCEEEECCCHHHHHCHHHHHHHHH---HHHHHHHHHHHHHHHHC-
T ss_conf             257653379--------813--077799998--55975895581332117688887653---56550378689999977-


Q ss_pred             CCCCCCCCEEEHHHHHHHHCC--CCCHHHHHHH-HCCCCCCHHHHHCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             998786504545889998588--9997899998-0889865276637657664100233201345311258768999898
Q gi|254780127|r   85 GIDIPSKRWICTSVLARTNGL--PSSLKNACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGE  161 (675)
Q Consensus        85 Gi~i~~~~~~DTmi~A~~l~~--p~sL~~la~~-lgl~~~~~kd~~gk~li~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (675)
T Consensus       387 GI~l~~-~~fDTmLAsYLL~p~~~~~Ld~La~~yl~~~~~~~e~l~Gkg~k-----------------~~~~~-~~~~~~  447 (880)
T PRK07300        387 GIELPA-PSFDARLAKYLLSTVEDNELSTIARLYTDISLETDDTVYGKGAK-----------------RAIPE-KEVLLE  447 (880)
T ss_pred             CCCCCC-CHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCCHHHHCCCCCC-----------------CCCCC-HHHHHH
T ss_conf             986677-40348999853687655877899999468888733766366521-----------------03662-779999


Q ss_pred             HHHHHHHHHHHHHHHHCCC----------HHHHHHHHHHHHHHHHCCEECCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             8775399999999872002----------143101789999875168430889999999999999999999998630576
Q gi|254780127|r  162 YCKRDVEATRELFKRLIPL----------SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGI  231 (675)
Q Consensus       162 Ya~~Dv~~~~~L~~~L~~~----------~~~E~~l~~~~~~me~~Gi~vD~e~l~~~~~~~~~~~~~~~~~i~~~~g~~  231 (675)
T Consensus       448 yaa~da~~~~~L~~~L~~~L~~~~l~~L~~~IE~PLi~VLa~ME~~GI~VD~~~L~~ls~el~~~l~~Le~~Iy~lAG~e  527 (880)
T PRK07300        448 HLARKVKVLLDSKEQMLDKLTAHEQLDLLFDMELPLANVLAKMEIAGIKVNRETLQEMAAENEVVIEALTQEIYDLAGQE  527 (880)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999999989998761699999999868999999999658088899999999999999999999999865876


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCC--C---CCHHHHHHHHHH-CCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCC
Q ss_conf             68888568899999997289998--8---896588999974-48985489999999997543000356688730568845
Q gi|254780127|r  232 IRSSRQTYALRMYLFLITGIDLV--D---MSEGTLKSILSH-SNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRL  305 (675)
Q Consensus       232 ~~n~~S~~ql~~~L~~~~g~~~~--~---~~k~~~~~~l~~-~~~~~~~~~ll~~r~~~~~~~~~~~~~l~~~~~~dGRi  305 (675)
T Consensus       528 F-NInSPKQLgeILFekLgLP~~~~KKTKTGySTd~evLe~L~~~hpi~~~ILeyR~l~KLkST-Y~d~L~~~i~~~gRI  605 (880)
T PRK07300        528 F-NINSPKQLGVILFEKMGLPLEMTKKTKTGYSTAVDVLERLAPIAPIVAKILEYRQITKLQST-YVIGLQDYILADGKI  605 (880)
T ss_pred             C-CCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH-HHHHHHHHCCCCCCC
T ss_conf             5-77999999999998449987677778888785799999976618748999998489999999-899899854754612


Q ss_pred             CCCEEECCCCCCHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHEEEECC-CCCEEEEEECCCC
Q ss_conf             220021132210011106888554777766523456544310244455444322101321214769-9878999733548
Q gi|254780127|r  306 RGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIAS-NGKKLVVADLAGI  384 (675)
Q Consensus       306 h~~~~~~gAt~TGR~S~~~pNlQnlPr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iR~~f~a~-~G~~lv~aDySqi  384 (675)
T Consensus       606 HTsf~Qt~-TaTGRLSS~~PNLQNIP------------------------iRte~Gr~IR~aFi~~~~~~~llsaDYSQI  660 (880)
T PRK07300        606 HTRYVQDL-TQTGRLSSVDPNLQNIP------------------------VRLEQGRLIRKAFVPSHEDAVLLSSDYSQI  660 (880)
T ss_pred             CCHHHHHH-CCCCEECCCCCCCCCCC------------------------CCCCCCHHHHHEEECCCCCEEEEEECHHHH
T ss_conf             21356423-13342114787634688------------------------777435204412732788559998232268


Q ss_pred             CEEEEEEECCCHHHHHHHHCCCCCCCCCHHHHHCCC-CCCCCHHHHHCCCCCHHHHHHCCCHHHHHHHHHHCCCCCCHHH
Q ss_conf             505886622876786654044410000157760875-1105702210064210013307887789887887088864036
Q gi|254780127|r  385 EARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP-IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS  463 (675)
Q Consensus       385 ElRvlA~ls~d~~li~~f~~g~D~h~~tA~~~~~~~-~~~v~~~~R~~aK~~~~gl~YG~G~~~l~~~~~~~G~~~~~~~  463 (675)
T Consensus       661 ELRilAhlS~D~~Li~AF~~~~DIH~~TA~~if~v~~~~~Vt~~~Rr~AK~iNFGiiYG~s~fgLs~-------------  727 (880)
T PRK07300        661 ELRVLAHISGDEHLIAAFKEGADIHTSTAMRVFGIEKAEDVTANDRRNAKAVNFGIVYGISDFGLSN-------------  727 (880)
T ss_pred             HHHHHHHHHCCHHHHHHHHCCCCHHHHHHHHHHCCCCHHHCCHHHHHHHHHHHHHHHHCCCHHHHHH-------------
T ss_conf             9999999818888999871588778999999949973200899999998631211112788677888-------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEECCC
Q ss_conf             66665666765478899999999987511101031088978899999986730789999999999999633721420132
Q gi|254780127|r  464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRV  543 (675)
Q Consensus       464 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ea~~~~~~~~~~~p~i~~~~~~~~~~~~~~~~~~~~~~~~~~  543 (675)
T Consensus       728 -------------------------------~l~i~~~eA~~~I~~Yf~~yp~v~~~~~~~~~~a~~---~G--------  765 (880)
T PRK07300        728 -------------------------------NLGITRKQAKSYIDTYFERYPGIKNYMENVVREAKD---KG--------  765 (880)
T ss_pred             -------------------------------HCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH---CC--------
T ss_conf             -------------------------------649999999999999999691099999999999997---68--------


Q ss_pred             CCCCCCCCCCCCCCCEEECCCCHHHCCCCCCHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----
Q ss_conf             2234432124456411224631131024520123320310012357765335577767479899999999999996----
Q gi|254780127|r  544 ANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK----  619 (675)
Q Consensus       544 ~~~~~~~~~~~~~~l~i~~psGR~l~~~~~~~~~~~~~~~~~~~~r~~~~g~k~~n~~iQgtAaDi~k~am~~l~~----  619 (675)
T Consensus       766 ---------------yv~Tl~gRrr~ip~i~s~n~~~r---~~~eR~------AiN~piQGtAADiiK~AMi~~~~~l~~  821 (880)
T PRK07300        766 ---------------YVETLFKRRRELPDINSRNFNVR---SFAERT------AINSPIQGSAADILKIAMINLDKALQA  821 (880)
T ss_pred             ---------------CEECCCCCEECCCCCCCCCHHHH---HHHHHH------HHCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             ---------------87777788135898678887788---799898------816024178999999999999999984


Q ss_pred             C--CCCEEEEECCEEEEECCCCHHHHHHH-HHHHHCCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             7--98189995358999678478999999-9998467630216984157303114631
Q gi|254780127|r  620 N--GYDIVLTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRYR  674 (675)
Q Consensus       620 ~--g~~ivl~VHDElv~evp~~~~~~~~~-i~~~M~~~p~wa~~~pl~a~~~~~~~y~  674 (675)
T Consensus       822 ~~~~~~mlLQVHDELvfEv~~~~~~~~~~~v~~~Me~~~~--l~VPL~v~~~~G~nW~  877 (880)
T PRK07300        822 GGFKSKMLLQVHDEIVLEVPNDELTAIKKLVKETMEAAIE--LAVPLIADENTGQTWY  877 (880)
T ss_pred             CCCCCEEEEEECEEEEEEECHHHHHHHHHHHHHHHHCCCC--CCCCEEEECCCCCCHH
T ss_conf             5988518999740458851788999999999999837524--7888373018488967