HHsearch alignment for GI: 254780127 and conserved domain: PRK07883

>PRK07883 hypothetical protein; Validated.
Probab=99.00  E-value=2.8e-08  Score=72.99  Aligned_cols=63  Identities=22%  Similarity=0.295  Sum_probs=48.5

Q ss_pred             HHHHHCCCCCEEEEEEHHHHHHHHHHH---CCCCCCCCCEEEHHHHHHHHCC-----CCCHHHHHHHHCCCCC
Q ss_conf             999864889819986307759999986---2998786504545889998588-----9997899998088986
Q gi|254780127|r   57 LLQYLRDETVMCVAHNSLFERILFKKT---LGIDIPSKRWICTSVLARTNGL-----PSSLKNACLALNFSEH  121 (675)
Q Consensus        57 l~~~L~~~~~~kv~HNa~FD~~vL~~~---lGi~i~~~~~~DTmi~A~~l~~-----p~sL~~la~~lgl~~~  121 (675)
T Consensus        98 f~~F~--~~~vlVAHNa~FD~~FL~~~~~r~g~~~~~~~~ldTl~LARrl~p~~e~~~~kL~tLa~~~g~~~~  168 (575)
T PRK07883         98 FLEFA--RGSVLVAHNAPFDIGFLRAAAERCGYPWPQPEVLCTVRLARRVLSRDEAPNVRLSALARLFGAATT  168 (575)
T ss_pred             HHHHH--CCCEEEEECCHHHHHHHHHHHHHCCCCCCCCCEEEHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCC
T ss_conf             99996--899899908345299999999975999878978648999998669211468998999997599999