HHsearch alignment for GI: 254780127 and conserved domain: cd05785

>cd05785 DNA_polB_like2_exo A subfamily of the 3'-5' exonuclease domain of family-B DNA polymerases. This subfamily is composed of uncharacterized bacterial family-B DNA polymerases. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are involved in metal binding and catalysis. The exonuclease domain of family-B DNA polymerases has a fundamental role in proofreading activity. It contains a beta hairpin structure that plays an important role in active site switching in the event of a nucleotide misincorporation. Family-B DNA polymerases are predominantly involved in DNA replication and DNA repair.
Probab=98.94  E-value=7.1e-08  Score=70.25  Aligned_cols=154  Identities=18%  Similarity=0.180  Sum_probs=89.2

Q ss_pred             CCEEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCCEEEEEECC--CCCHHHHHHHHHHC--CCCCEEEEEEH-HH
Q ss_conf             978999804067887000460000268829999999838228999788--84221799999864--88981998630-77
Q gi|254780127|r    1 MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRT--EQSAMPSDLLQYLR--DETVMCVAHNS-LF   75 (675)
Q Consensus         1 mk~l~lD~ET~s~~dl~~~Gl~~y~~~~~I~~i~~a~~~~~~~~~d~~--~~~~~~~~l~~~L~--~~~~~kv~HNa-~F   75 (675)
T Consensus         9 lr~lsfDIE~~~~~g~~~p~--p~~~~d~Ii~I~~~~~~~~~~v~~~~~~~E~~lL~~F~~~i~~~dPDII-tGyNi~~F   85 (207)
T cd05785           9 LRRLQLDIETYSLPGFFFSN--PDRGDDRIIIVALRDNRGWEEVLHAEDAAEKELLEELVAIIRERDPDVI-EGHNIFRF   85 (207)
T ss_pred             EEEEEEEEEECCCCCCCCCC--CCCCCCCEEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCEE-EECCCCCC
T ss_conf             05999999747889977999--8889997899998858997798762699999999999999987399999-86798775


Q ss_pred             HHHHHHH---HCCCCCC------------------------------CCCEEEHHHHHHHH-----C-CCCCHHHHHHHH
Q ss_conf             5999998---6299878------------------------------65045458899985-----8-899978999980
Q gi|254780127|r   76 ERILFKK---TLGIDIP------------------------------SKRWICTSVLARTN-----G-LPSSLKNACLAL  116 (675)
Q Consensus        76 D~~vL~~---~lGi~i~------------------------------~~~~~DTmi~A~~l-----~-~p~sL~~la~~l  116 (675)
T Consensus        86 D~pYL~~Ra~~~~i~~~lgR~~~~~~~~~~~~~~~~~~~~~~~~~i~Gr~~lD~~~~~k~~~~~~~~L~SY~L~~Va~~~  165 (207)
T cd05785          86 DLPYLRRRCRRHGVPLAIGRDGSIPRQRPSRFRFAERLIDYPRYDIPGRHVIDTYFLVQLFDVSSRDLPSYGLKAVAKHF  165 (207)
T ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCEEECCEEEECCCCCCEEEEEECCEEEEEHHHHHHHHCCCCCCCCCCCHHHHHHHH
T ss_conf             88999999999599722257898744640302122355530499873648865499998642111467765289999987


Q ss_pred             CCCCCCHHHHHCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8898652766376576641002332013453112587689998988775399999999
Q gi|254780127|r  117 NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF  174 (675)
Q Consensus       117 gl~~~~~kd~~gk~li~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ya~~Dv~~~~~L~  174 (675)
T Consensus       166 ~l~~~~k~~~~~~~i~~~--------------~---~~d~~~l~~Yni~Dv~~t~~La  206 (207)
T cd05785         166 GLASPDRTYIDGRQIAEV--------------W---RSDPARLLAYALDDVRETEGLA  206 (207)
T ss_pred             HHCCCCCCCCCHHHHHHH--------------H---HCCHHHHHHHHHHHHHHHHHHC
T ss_conf             313666563889999999--------------9---5298999998299999999860