>cd06135 Orn Oligoribonuclease (Orn) is a DEDDh-type DnaQ-like 3'-5' exoribonuclease that is responsible for degrading small oligoribonucleotides to mononucleotides. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. Orn is essential for E.coli survival. The human homolog, also called Sfn (small fragment nuclease), is able to hydrolyze short single-stranded RNA and DNA oligomers. It plays a role in cellular nucleotide recycling.

Probab=91.97 E-value=0.49 Score=25.04 Aligned_cols=49 Identities=12% Similarity=0.012 Sum_probs=25.7 Q ss_pred HCCCCCEEEEEEHHHHHHHHHHHCCCCCCCCCEEEHHHHHHHHCCCCCHHHHHHHHC Q ss_conf 648898199863077599999862998786504545889998588999789999808 Q gi|254780127|r 61 LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALN 117 (675) Q Consensus 61 L~~~~~~kv~HNa~FD~~vL~~~lGi~i~~~~~~DTmi~A~~l~~p~sL~~la~~lg 117 (675) T Consensus 90 ~~~~~~pLaGNSV~~Dr~FL~k~----mP-~-l~-~~l-hYR~iDVSsikel~~rw~ 138 (173) T cd06135 90 VPKGKSPLAGNSVHQDRRFLDKY----MP-E-LE-EYL-HYRILDVSSIKELARRWY 138 (173) T ss_pred CCCCCCCCCCCCHHHHHHHHHHH----CC-H-HH-HHC-CCEEEEHHHHHHHHHHHC T ss_conf 67998531576487709999985----80-6-79-759-870466777999999869

HHsearch alignment for GI: 254780127 and conserved domain: cd06135