HHsearch alignment for GI: 254780127 and conserved domain: pfam01612

>pfam01612 3_5_exonuc 3'-5' exonuclease. This domain is responsible for the 3'-5' exonuclease proofreading activity of E. coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides. This domain consists of the amino-terminal half of the Klenow fragment in E. coli polI it is also found in the Werner syndrome helicase (WRN), focus forming activity 1 protein (FFA-1) and ribonuclease D (RNase D). Werner syndrome is a human genetic disorder causing premature aging; the WRN protein has helicase activity in the 3'-5' direction. The FFA-1 protein is required for formation of a replication foci and also has helicase activity; it is a homologue of the WRN protein. RNase D is a 3'-5' exonuclease involved in tRNA processing. Also found in this family is the autoantigen PM/Scl thought to be involved in polymyositis-scleroderma overlap syndrome.
Probab=99.75  E-value=7.9e-17  Score=129.50  Aligned_cols=148  Identities=19%  Similarity=0.151  Sum_probs=104.0

Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCCEEEEEECCCCCHHHHHHHHHHCCCCCEEEEEEHHHHHHHHH
Q ss_conf             78999804067887000460000268829999999838228999788842217999998648898199863077599999
Q gi|254780127|r    2 SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRDETVMCVAHNSLFERILFK   81 (675)
Q Consensus         2 k~l~lD~ET~s~~dl~~~Gl~~y~~~~~I~~i~~a~~~~~~~~~d~~~~~~~~~~l~~~L~~~~~~kv~HNa~FD~~vL~   81 (675)
T Consensus        21 ~~ia~DtEt~~~--------~~~~~~~~~~llq~~~~-~~~yli~~~~~~~~~~~L~~ll~~~~i~Kvghn~k~D~~~L~   91 (172)
T pfam01612        21 KVVAVDTETTSL--------DTYSYTLVGCLIQISTG-EGAYIIDPLALGDDLEGLKRLLEDPNITKVGHNAKFDLEVLA   91 (172)
T ss_pred             CCEEEEEECCCC--------CCCCCCCCEEEEEEECC-CCCEEEECCCCHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHH
T ss_conf             908998062898--------86761343369999679-860776434756679999999759998799975899999998


Q ss_pred             HHCCCCCCCCCEEEHHHHHHHHCC--CCCHHHHHHH-HCCCCCCHHHHHCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             862998786504545889998588--9997899998-0889865276637657664100233201345311258768999
Q gi|254780127|r   82 KTLGIDIPSKRWICTSVLARTNGL--PSSLKNACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQL  158 (675)
Q Consensus        82 ~~lGi~i~~~~~~DTmi~A~~l~~--p~sL~~la~~-lgl~~~~~kd~~gk~li~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (675)
T Consensus        92 ~~~~~~~~--~~~Dt~~a~~~l~~~~~~gL~~L~~~~lg~~~~K~~---------------~~-----s~w~~rp-L~~~  148 (172)
T pfam01612        92 RDFGIKLE--NLFDTMLAAYLLGYPRSHSLDDLAEKYLGVELDKSE---------------QC-----ADWRARP-LSEE  148 (172)
T ss_pred             HHCCCCCC--CCHHHHHHHHHCCCCCCCCHHHHHHHHCCCCCCHHH---------------EE-----CCCCCCC-CCHH
T ss_conf             85476668--732789999881996435699999998098787441---------------56-----6788789-8299


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             89887753999999998720021
Q gi|254780127|r  159 FGEYCKRDVEATRELFKRLIPLS  181 (675)
Q Consensus       159 ~~~Ya~~Dv~~~~~L~~~L~~~~  181 (675)
T Consensus       149 qi~YAa~Da~~~~~l~~~l~~~l  171 (172)
T pfam01612       149 QLRYAAEDADYLLRLYDKLRKEL  171 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999974