BLAST/PSIBLAST alignment of GI: 254780127 and GI: 212712317 at iteration 1
>gi|212712317|ref|ZP_03320445.1| hypothetical protein PROVALCAL_03405 [Providencia alcalifaciens DSM 30120] Length = 685
>gi|212685063|gb|EEB44591.1| hypothetical protein PROVALCAL_03405 [Providencia alcalifaciens DSM 30120] Length = 685
 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 273/688 (39%), Positives = 380/688 (55%), Gaps = 24/688 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L++D+ET S +P+ K G  +YAE   I L A+A ++  V++WD T++S +P++L Q L D
Sbjct: 5   LWLDLETFSEKPI-KYGTHSYAETVEIMLFAWALNNNLVQVWDVTDKSPIPTELKQALSD 63

Query: 64  ETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLT 123
              +  AHNS F+R +   + GI I   RW  T V A  +GLP +L   C  L       
Sbjct: 64  PNTIIYAHNSHFDRTMLNHS-GIKIDVSRWRDTMVQALAHGLPGALGALCEVLGVPLDKA 122

Query: 124 KMEEGKALIARFCKG-SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPLS- 181
           K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE+ KRL   + 
Sbjct: 123 KDKEGKALIQLFCKPRPKNSALRRATSKTHPEEWKRFVAYAGLDIEAMREVHKRLPSWNY 182

Query: 182 -DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
            D E + W  DQ INDRG  +D+ L     E +  E+K+L +    LTD  ++++ Q  A
Sbjct: 183 CDNELEHWHRDQRINDRGVYMDIQLATAAIEAVEIEQKRLAKLTQDLTDNEVQAATQRDA 242

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           L  ++    G+DL DM + TL+  ++  +I    ++L+  RL SS ++  K   L   VS
Sbjct: 243 LLQHISAAFGVDLPDMQKSTLERRINDPDIPLPLRELLAIRLQSSTTSTSKYKALMNGVS 302

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG--ETIADP-L 357
           SDGRLRGTLQF GASRTGRW+G +FQPQNLPR    +  + + I+AL  G  + I D  +
Sbjct: 303 SDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPTLDQNTIDKGIEALKAGCADLIYDDIM 362

Query: 358 GLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN-----GEDIYVTT 412
            L S  +R CI+A  GKKLVV+DL+ IE R+LAW+AGE WKI AF+      G D+Y   
Sbjct: 363 QLTSSTLRGCIMAPEGKKLVVSDLSNIEGRMLAWLAGEAWKITAFSEFDKGIGADLYKLA 422

Query: 413 YAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTF 472
           YA+AFN   + V K  R IGKVMEL LGY GG   F T A    LDL + ++        
Sbjct: 423 YARAFNISPEDVDKHMRQIGKVMELGLGYGGGVAAFLTFALTYSLDLDELAEAALPNIPP 482

Query: 473 EDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVV 532
           +    A S +    +    + + + +  T C+ +K+ WR  H   +  W +L +     +
Sbjct: 483 KVKHDALSWYQKSVETKKTYGLSETVFIT-CDSLKRMWRNAHPETVSFWYELEDTVRHAI 541

Query: 533 QEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD---CSYL--NTATSQL 587
              G     R     +L +RR K  + IVLPS R + Y   + D    SY+  N  + + 
Sbjct: 542 SSPGITFPCR-----KLKVRRDKAWLRIVLPSGRAVCYPSPRNDNGQISYMGVNPYSRKW 596

Query: 588 MRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTL 647
            R +TYGGKL EN+ QA +RD+L   M     +GYDIVLTVHDE+++E PD P F+   L
Sbjct: 597 QRLKTYGGKLVENVTQAAARDVLAGNMPTIEDHGYDIVLTVHDEVLTEAPDNPAFNHEHL 656

Query: 648 CSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L+  NP WA  LPL A G+EA  YRK
Sbjct: 657 SELLATNPEWALDLPLSAGGFEAYHYRK 684