BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780127|ref|YP_003064540.1| putative DNA polymerase from
bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62]
         (675 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780127|ref|YP_003064540.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039804|gb|ACT56600.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|317120698|gb|ADV02521.1| DNA polymerase A [Liberibacter phage SC1]
 gi|317120741|gb|ADV02563.1| DNA polymerase A [Liberibacter phage SC2]
 gi|317120802|gb|ADV02623.1| DNA polymerase A [Liberibacter phage SC2]
 gi|317120842|gb|ADV02663.1| DNA polymerase A [Liberibacter phage SC1]
          Length = 675

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 675/675 (100%), Positives = 675/675 (100%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEAKRYRK
Sbjct: 661 LPLKAEGYEAKRYRK 675


>gi|255957611|dbj|BAH96662.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957616|dbj|BAH96666.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957626|dbj|BAH96674.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957641|dbj|BAH96686.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957661|dbj|BAH96702.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957666|dbj|BAH96706.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957671|dbj|BAH96710.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957676|dbj|BAH96714.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957686|dbj|BAH96722.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  548 bits (1412), Expect = e-153,   Method: Composition-based stats.
 Identities = 674/675 (99%), Positives = 674/675 (99%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEAKRYRK
Sbjct: 661 LPLKAEGYEAKRYRK 675


>gi|255957621|dbj|BAH96670.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 673/675 (99%), Positives = 673/675 (99%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE VS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSETVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEAKRYRK
Sbjct: 661 LPLKAEGYEAKRYRK 675


>gi|255957561|dbj|BAH96622.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957566|dbj|BAH96626.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957571|dbj|BAH96630.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957576|dbj|BAH96634.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957581|dbj|BAH96638.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957586|dbj|BAH96642.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957591|dbj|BAH96646.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957601|dbj|BAH96654.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957631|dbj|BAH96678.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957636|dbj|BAH96682.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957646|dbj|BAH96690.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957651|dbj|BAH96694.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957656|dbj|BAH96698.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957681|dbj|BAH96718.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 673/675 (99%), Positives = 673/675 (99%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFC GSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEAKRYRK
Sbjct: 661 LPLKAEGYEAKRYRK 675


>gi|255957556|dbj|BAH96618.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 672/675 (99%), Positives = 672/675 (99%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFC GSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
            PLKAEGYEAKRYRK
Sbjct: 661 FPLKAEGYEAKRYRK 675


>gi|255957596|dbj|BAH96650.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957606|dbj|BAH96658.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  545 bits (1403), Expect = e-152,   Method: Composition-based stats.
 Identities = 672/675 (99%), Positives = 672/675 (99%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
           HLTKMEEGKALIARFC GSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA
Sbjct: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP
Sbjct: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES
Sbjct: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
           HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA
Sbjct: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN
Sbjct: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD PYFSVGTLCSLMTKNPSWAKG
Sbjct: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDIPYFSVGTLCSLMTKNPSWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEAKRYRK
Sbjct: 661 LPLKAEGYEAKRYRK 675


>gi|313895585|ref|ZP_07829141.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975711|gb|EFR41170.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 645

 Score =  540 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 208/698 (29%), Positives = 309/698 (44%), Gaps = 77/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + ID+ET S  PL K GV+ YAE     I L  Y+ D   V++ D      +P ++L
Sbjct: 1   MKSISIDVETFSSVPLAKAGVYKYAESEDFEILLFGYSVDGGEVQVVDLANGEEIPKEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L DETV   A N++FER+   + LGI +    W C+ + A T GLP SLK+    L  
Sbjct: 61  AALTDETVTKWAFNAMFERVCLSRHLGIHLKPNAWRCSMIWAATLGLPLSLKDVGAVLWL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDS----PPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
                K+EEGK LI  FC     +           A+  + W+LF EY KRDVE    + 
Sbjct: 121 DRQ--KLEEGKDLIRYFCVPCKATRSNGGRTRNLPADAPEKWKLFTEYNKRDVETEMAIQ 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            RL   P+ + E + +++DQ INDRG  +D   V +      + +    E         +
Sbjct: 179 ARLKKFPVPESEWENYVIDQEINDRGILVDTTFVTQAICCDERSKAVCLERAQN--LTDL 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+ +  +++  +  +L  +      ++++  R   S +++ K 
Sbjct: 237 ENPNSPLQLMDWLHGK-GLSVESLAKSEVTKMLKTATGD--VREVLELRQQLSKTSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE- 351
             +     +D R RG  QFYGA+RTGR++G + Q QNLP+   ++    +T+      E 
Sbjct: 294 MAMEAVTGADHRARGLFQFYGANRTGRFAGRLIQLQNLPQNHLAQLKEVRTLVKDGDFEL 353

Query: 352 ---TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  +     + VVAD A IEARVLAW+AGE W +  F    DI
Sbjct: 354 LDMLYDSTSDVLSQLIRTSFVPHPACRFVVADYAAIEARVLAWLAGEQWVLDVFREHGDI 413

Query: 409 YVTTYAKAFN--TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  T ++ F+        + + R  GK   L+ GY G       M               
Sbjct: 414 YCETASRMFHCKVEKHGENADLRQKGKQAVLSCGYGGSVGALVAMG-------------- 459

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     AV+  +     + +   WRA +  ++Q W D+  
Sbjct: 460 --------------------------AVESGMKEEELQPLVDLWRASNPHIVQFWWDVDR 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN----- 581
                V+    +    +  V           + I LPS R L Y+  +   +        
Sbjct: 494 AVKTCVKRRVEVETHGIRCV------YKSGVLFIRLPSGRELAYAKPRIGENRFGGESVT 547

Query: 582 ----TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                 T +  R  T+GGKL ENI Q  +RD+L   MK     G+DIV+ VHDEIV E P
Sbjct: 548 YEGLGMTKKWERIETFGGKLVENITQGTARDLLVFAMKQLRNRGFDIVMHVHDEIVLEVP 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                SV  +CS+M +NP WAKGLPLKA+GYE + YRK
Sbjct: 608 YG-VSSVEEICSIMAENPPWAKGLPLKADGYECEFYRK 644


>gi|153938384|ref|YP_001391676.1| DNA-directed DNA polymerase I [Clostridium botulinum F str.
           Langeland]
 gi|152934280|gb|ABS39778.1| DNA-directed DNA polymerase I [Clostridium botulinum F str.
           Langeland]
          Length = 658

 Score =  539 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 214/702 (30%), Positives = 319/702 (45%), Gaps = 76/702 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           +  L ID+ET S   +   G + Y E     I L AYA++DEPV++ D      +PS++ 
Sbjct: 5   IDTLSIDVETYSSMDIKTSGAYKYCESPDFEILLFAYAFNDEPVQIVDLANGEKLPSNVF 64

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  ++  A N+ FER   K       P ++W CT V A T GLPSSL     AL F
Sbjct: 65  YALTDPNIIKTAFNANFERNSIKNQYPALCPPEQWECTMVKALTLGLPSSLDMVGKALKF 124

Query: 119 SEHLTKMEEGKALIARFCKGSI----DSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
            E   KM+EGKALI  FCK       +         + ++ W+ F EYCKRDVE  RE+ 
Sbjct: 125 EEDKQKMKEGKALIQYFCKPCKPTKTNGKRTRNLPEHDMEKWETFKEYCKRDVEVEREIR 184

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
             L        E+ LW LDQ INDRG   DL L+ +  E      ++L +  ++LT    
Sbjct: 185 NLLNRYETKVEEQKLWQLDQHINDRGIGTDLILIKQAIECDTNYTERLTKAAIELTGLE- 243

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSN--ITQLAKDLILNRLASSGSAIL 290
            +      ++ ++    G ++  +++ ++  ++  +          ++  R   + ++I 
Sbjct: 244 -NPNSPTQIKKWIGERLGREVKSLTKTSIPGLIEEATSLNKSEVIKMLELRQLMAKTSIK 302

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K +T+  A   DGR+RG LQFYGA+RTGRW+G + Q QNLP+    +    +      + 
Sbjct: 303 KYDTMQNARCKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLDNARNFVREGKF 362

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +             S  +R+  I   G + +V+D + IEARV+AW AGE W++  F+   
Sbjct: 363 QEVEFLFDSVPDTLSQLIRTAFIPREGNRFIVSDFSAIEARVIAWFAGEQWRLDVFSTHG 422

Query: 407 DIYVTTYAKAFNTPID--KVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
            IY  + ++ F   I+  K   E R  GK+ ELALGY G      +M             
Sbjct: 423 KIYEASASQMFKVAIESIKKGSELRQKGKIAELALGYGGSVGALSSMDRKKS-------- 474

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                                            +       + K+WR  +  + + W D+
Sbjct: 475 ---------------------------------IPEEELPGLVKSWRNANPNITKFWWDV 501

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS------ 578
            +    V++E  +++ +       L        + I LPS R+L Y   K +        
Sbjct: 502 DKAAKKVIRERTTVNLQYG-----LKFIYDPGVLFIQLPSGRKLSYIRPKIEPHETFSGD 556

Query: 579 -----YLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                 +   + Q  R  TYG KL ENIVQA SRD L E M    K GYDIV+ VHDE+V
Sbjct: 557 KITYEGMEQTSKQWKRIDTYGPKLVENIVQATSRDCLREAMFRVDKAGYDIVMHVHDEVV 616

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            + P     +V  +  LM +   WA GLPLKA+GYE   Y+K
Sbjct: 617 LDIPKDRA-TVKEINELMGQPIEWAPGLPLKADGYECNYYQK 657


>gi|167039879|ref|YP_001662864.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X514]
 gi|300915307|ref|ZP_07132621.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X561]
 gi|307724797|ref|YP_003904548.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X513]
 gi|166854119|gb|ABY92528.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X514]
 gi|300888583|gb|EFK83731.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X561]
 gi|307581858|gb|ADN55257.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X513]
          Length = 644

 Score =  538 bits (1386), Expect = e-150,   Method: Composition-based stats.
 Identities = 212/698 (30%), Positives = 327/698 (46%), Gaps = 78/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YAE     I L  Y+ D  PV++ D      +P ++ 
Sbjct: 1   MRTLSIDIETFSSVDLAKSGVYRYAEAPDFEILLFGYSVDAGPVQVVDFACGEKIPKEIQ 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           Q + D  V   A N+ FERI   K  GI +    W CT V +   GLP SL+ A +    
Sbjct: 61  QAILDNNVTKWAFNAQFERICLSKYFGIHLAPDSWRCTMVWSAYLGLPLSLEGAAIVTG- 119

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
                K+ +GK LI  F   CK ++ +         H  + W  F  Y  RDVE    + 
Sbjct: 120 -ADKKKLTKGKELIRYFSVPCKPTVTNGGRTRNLPEHAPEKWNSFKAYNLRDVEVELSIQ 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           ++L   P+ + E + ++LDQ INDRG ++DL+LV K  +   + R++L   + +     +
Sbjct: 179 EKLQKFPMPEEEWNNYILDQQINDRGIQLDLELVKKAIQCDEKVREELTSRLKE--LTDL 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      ++ +L    G++   + + ++K++L  +       +++  R   + S++ K 
Sbjct: 237 DNPNSVVQMKSWLSEK-GLETDSLDKASVKALLKEAPEH--LSEVLELRQLLAKSSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  AV +DGR RG LQFYGA+RTGR++G + Q QNLP+   S+    + +      + 
Sbjct: 294 TAMENAVCTDGRARGLLQFYGANRTGRFAGRLIQVQNLPQNHLSDLEQARRLVRGGHFDA 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                    G+ S+ +R+  +   G K +VAD + IEARV+AW+AGE W+ + FA    I
Sbjct: 354 LEILYDSIPGVLSELIRTAFVPKKGYKFIVADFSAIEARVIAWLAGETWRNEVFATHGKI 413

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F  P+++V+K    R  GK+ ELALGY G     K M               
Sbjct: 414 YEASASQMFKVPLEEVTKGSPLRQKGKIAELALGYGGSVGALKAMG-------------- 459

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   L     + +  AWR  +  +++LW D+  
Sbjct: 460 --------------------------ALDMGLTEEELKPLVYAWRNANPNIVRLWWDVDR 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT---- 582
                V E       R+              + I LPS R+L Y   +   +   +    
Sbjct: 494 AVKEAVTERCRTETHRIR------FEYRSGMLLIWLPSGRQLTYVKPRMGINSFGSEAVT 547

Query: 583 -----ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                AT +  R  +YG K  ENIVQAISRD+LC  M+N  ++G +IV+ VHDE+V E P
Sbjct: 548 YEGVGATKKWERIESYGPKFVENIVQAISRDLLCHSMRNLDESGLNIVMHVHDEVVLEVP 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                 V  +C LM + P WA GL L+A+G+E   Y+K
Sbjct: 608 LE--ICVQDVCVLMGQVPPWAHGLLLRADGFECDFYKK 643


>gi|226949733|ref|YP_002804824.1| DNA polymerase [Clostridium botulinum A2 str. Kyoto]
 gi|226841086|gb|ACO83752.1| DNA polymerase [Clostridium botulinum A2 str. Kyoto]
          Length = 655

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 219/705 (31%), Positives = 322/705 (45%), Gaps = 81/705 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ L ID+ET S   +   G + Y E     I L AYA++DEPV++ D T+  A+P  ++
Sbjct: 1   MTTLAIDVETYSSIDIKTSGAYKYCEAPDFEILLFAYAFNDEPVQIVDFTQHEALPQRVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGI---DIPSKRWICTSVLARTNGLPSSLKNACLA 115
             L D  V+  A N+ FER   K   G+     P  +W CT + A T GLPSSL     A
Sbjct: 61  DALYDPDVIKTAFNANFERSAIK--FGVSSLPCPPGQWECTMIKALTLGLPSSLDMVGKA 118

Query: 116 LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCT----RANHVQAWQLFGEYCKRDVEATR 171
           L   E   KM+EGKALI  FCK    +   D        + ++ W+ F EYCKRDVE  R
Sbjct: 119 LKLEEDKQKMKEGKALIQYFCKPCKPTKTNDKRTRNLPKHDMEKWETFKEYCKRDVEVER 178

Query: 172 ELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           E+   L        E+ LW LDQ INDRG   DL L+ +  E      ++L +  +KLT 
Sbjct: 179 EIRNLLNRYETKAEEQKLWQLDQHINDRGIDTDLILIKQAIECDTNYTERLTKAAIKLTG 238

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNI--TQLAKDLILNRLASSGS 287
               +      ++ ++    G ++  +++ ++  ++  +          ++  R   + +
Sbjct: 239 LE--NPNSPTQIKKWIGERLGREVKSLTKTSIPGLIEEAKDLNKSEVIKMLELRQLMAKT 296

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           +I K +T+  A   DGR+RG LQFYGA+RTGRW+G + Q QNLP+    +    +     
Sbjct: 297 SIKKYDTMQNARCKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLDNARNFVRE 356

Query: 348 NRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA 403
            + E             S  +R+  I   G + +V+D + IEARV+AW AGE W++  F+
Sbjct: 357 GKFEEVEFLFDSVPDTLSQLIRTAFIPREGNRFIVSDFSAIEARVIAWFAGEQWRLDVFS 416

Query: 404 NGEDIYVTTYAKAFNTPID--KVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQ 461
               IY  + ++ F  PI+  K   E R  GK+ ELALGY G      +M          
Sbjct: 417 THGKIYEASASQMFKVPIESIKKGSELRQKGKIAELALGYGGSVGALSSMDRKKS----- 471

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
                                               +       + K+WR  +  + + W
Sbjct: 472 ------------------------------------IPEEELPGLVKSWRNANPNITKFW 495

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS--- 578
            D+ +     ++E  +++ +       L        + I LPS R+L Y   K +     
Sbjct: 496 WDVDKAAKKAIRERTTVNLQYG-----LKFIYDPGVLFIQLPSGRKLSYIRPKIEPHETF 550

Query: 579 --------YLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHD 630
                    +   + Q  R  TYG KL ENIVQA SRD L E M    K GYDIV+ VHD
Sbjct: 551 SGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATSRDCLREAMFRVNKEGYDIVMHVHD 610

Query: 631 EIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E+V + P     +V  +  LM +   WA GLPLKA+GYE   Y K
Sbjct: 611 EVVLDIPKDRA-TVKEINELMGQPIKWAPGLPLKADGYECNYYMK 654


>gi|255092532|ref|ZP_05322010.1| DNA polymerase [Clostridium difficile CIP 107932]
 gi|260683192|ref|YP_003214477.1| dna-directed dna polymerase i [Clostridium difficile CD196]
 gi|260209355|emb|CBA62784.1| dna-directed dna polymerase i [Clostridium difficile CD196]
          Length = 652

 Score =  536 bits (1381), Expect = e-150,   Method: Composition-based stats.
 Identities = 220/700 (31%), Positives = 334/700 (47%), Gaps = 74/700 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + KVGV+ Y +     I L AYA+D+E VK+ D      +P +++
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D  V+  A N+ FER    K L I++    W CT + A T GLP SL +   AL F
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----HVQAWQLFGEYCKRDVEATRELF 174
           +E   KM+EGKALI  FCK    +        N     ++ W  F EYCK+DV   RE+ 
Sbjct: 121 NEDKQKMKEGKALIQYFCKPCKATKVNKGRTRNLPIHDMEKWNKFKEYCKQDVVVEREIR 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            +L     ++ E  LW LDQ IND G ++D +L+    E   +  +KL ++ +K+T   +
Sbjct: 181 NKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIKITG--L 238

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G ++  +++ ++  IL   +   + + ++  R   S ++I K 
Sbjct: 239 NNPNSPAQLKKWLSDKVGFEITSLTKESIPEILKQVDDENVVR-ILELRKLMSKTSIKKY 297

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE- 351
             +  A  +D R+RG LQFYGA+RTGRW+G + Q QNLP+    +  L + +      + 
Sbjct: 298 EAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHIEDLDLARNLLKEGDFDL 357

Query: 352 ---TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  I S G + +V+D + IEARV+AW+AGE W++  F +   I
Sbjct: 358 IELLYDSVPDVLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWLAGEKWRLDVFNSHGKI 417

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F  PI+ + K  E R  GK+ EL+ GY G      +M +             
Sbjct: 418 YEASASQMFKIPIENIKKGSELRQKGKLAELSNGYGGSVGALISMGAIK----------- 466

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                          L     + +  AWR  +  + + W D+ +
Sbjct: 467 -----------------------------MGLKEEELQPIVTAWRNANPNITKFWWDVDK 497

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS-------- 578
                +++   +  +       +    +   + I LPSSRRL Y   K +          
Sbjct: 498 AAKKAIKDRTIVEIQ-----HGIKFIYNPGVLFIELPSSRRLSYLRPKIEPHTTFSGDKI 552

Query: 579 ---YLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
               +   + Q  R  TYG KL ENIVQA +RD L E M N T  GY IV+ VHDE+V +
Sbjct: 553 TYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTDAGYSIVMHVHDELVID 612

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                  S+  + S+M K  SWAKGLPLKA+GYE   Y+K
Sbjct: 613 VDK-KGGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|300856814|ref|YP_003781798.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
 gi|300436929|gb|ADK16696.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
          Length = 650

 Score =  536 bits (1381), Expect = e-150,   Method: Composition-based stats.
 Identities = 206/699 (29%), Positives = 317/699 (45%), Gaps = 74/699 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L ID+ET     + KVG + Y E     I L AYA++DEPV++ D  +   +P  + 
Sbjct: 1   MDTLAIDVETYCELDIKKVGAYKYCEHPSFQILLFAYAFNDEPVEVIDFAQGEELPQKVK 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L +  ++  A N+ FE    KK L   I ++ W CT V +   GLP SL      L F
Sbjct: 61  TALLNPGILKTAFNANFEINALKKYLINGIDAEDWQCTMVQSLILGLPGSLDMVGKVLRF 120

Query: 119 SEHLTKMEEGKALIARFCKGSI----DSPPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
            E   KM+EGKALI  FCK       +         +  + W++F +Y K+DVE  R + 
Sbjct: 121 EEDKQKMKEGKALIQYFCKPCKPTKSNGGRTRNLPEHAPEKWEIFKKYNKQDVEVERAIR 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            +L   P ++ E+ LW LDQ INDRG   D++L+ K  E      K+L ++  +LT   +
Sbjct: 181 NKLNRYPTTENEQRLWELDQCINDRGVGADIELIEKAIECNNSYNKRLTKEATELTG--L 238

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ ++    G ++  +++ ++ +++  S   +  K ++  R   + ++I K 
Sbjct: 239 SNPNSPTQLKRWIGERVGHEVKSLTKDSIPTLIKESKDEK-VKKILELRQLMAKTSIKKY 297

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
            T+  A   DGR+RG LQFYGA+RTGRW+G + Q QNLP+    +    +      + + 
Sbjct: 298 ETMQRARCEDGRMRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLDDARNFIRTGQFDK 357

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                       S  +R+  I   G + +VAD + IEARV+AW AGE W++  F N  DI
Sbjct: 358 VEFLYDSIPDTLSQLIRTAFIPKEGNRFIVADFSAIEARVIAWYAGEQWRLDVFNNNGDI 417

Query: 409 YVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + +K F  P++K   +   R  GK+ ELALGY G      +M               
Sbjct: 418 YCASASKMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALMSMDKKK----------- 466

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                          +       + K WR     + + W D+ +
Sbjct: 467 ------------------------------NIPEDELPGLVKDWRDASPHITKFWWDVDK 496

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD--------CS 578
                ++E  ++          L        + I LPS R+L Y   K +         +
Sbjct: 497 AAKKAIRERTTV-----VLQFGLKFIYDPGVLFIQLPSGRKLAYIRPKIEPGPYDKPIIT 551

Query: 579 YLN--TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
           Y      + Q     TYG K+ ENIVQA +RD L   M+     G+ IV+ VHDE++ + 
Sbjct: 552 YEGLQQTSKQWTTLETYGPKIVENIVQATARDCLGITMQRVEDKGFHIVMHVHDELICDV 611

Query: 637 PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           P     +V  +C +  +   WA GLPLKA+GYE   Y K
Sbjct: 612 PKGK-GTVEEICDIFGEPIEWAPGLPLKADGYECNYYMK 649


>gi|293401134|ref|ZP_06645278.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305260|gb|EFE46505.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 646

 Score =  536 bits (1380), Expect = e-150,   Method: Composition-based stats.
 Identities = 205/702 (29%), Positives = 307/702 (43%), Gaps = 84/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   LPK GV+ Y E     I L AY+ D +PV++ D      +P +++
Sbjct: 1   MKTLSIDIETYSDVQLPKTGVYRYCESDNFEILLFAYSIDSQPVQVVDLACGETIPEEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D+TV+  A N+ FERI   + LG      +  + W C+ + A T GLP SL+    
Sbjct: 61  AALEDDTVIKWAFNAAFERICLSRFLGYPTGTYLSPESWRCSMIWAATMGLPLSLEGVGA 120

Query: 115 ALNFSEHLTKMEEGKALIARFCKG---SIDSPPYDCTRANH-VQAWQLFGEYCKRDVEAT 170
            L       K+ EGK LI  FC+    +  +      R  H    W+ F  Y  RDVE  
Sbjct: 121 VLGLE--KQKLTEGKDLIKYFCQPCAATKANGGRTRNRPFHAPDKWEAFKRYNIRDVETE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
             +  +L   P+ +   + + +DQ INDRG R+D++LV +   +  + R++L   I    
Sbjct: 179 MGIQHKLRKFPVPNEVWEEYHIDQEINDRGVRLDMELVSQAIAMDTRSREELTAAIKD-- 236

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
              + +      ++ +L    GI+   + +  +  +L  +       D++  R   + S+
Sbjct: 237 MTELENPNSVQQMKQWLSD-NGIETDSLDKKAVAELLKDAPDN--LADVLTLRQQLAKSS 293

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   + + V SDGR RG  QFYGA+RTGR+SG   Q QNLP+    +    +++    
Sbjct: 294 VRKYQAMEKTVCSDGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLPDLSEARSLVRSG 353

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             +       D     S  +R+  I        VAD + IEARV+AW AGE W+ + F  
Sbjct: 354 DFDGVELLYEDVPDTLSQLIRTAFIPRENALFYVADFSAIEARVIAWFAGESWRQQVFEK 413

Query: 405 GEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G DIY  + ++ F  P++K   +   R  GK+ ELALGY G     K M           
Sbjct: 414 GGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMG---------- 463

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A+   L       +  AWR  +  +++ W 
Sbjct: 464 ------------------------------ALDMGLNEEELPALVDAWRQANPRIVEFWW 493

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN- 581
            +       V+   + +         L        + I LPS R+L Y   K   +    
Sbjct: 494 AVDRAVMEAVKYKHTTTDYG------LTFSCKSGMLFITLPSGRKLAYVKPKIGTNKFGG 547

Query: 582 --------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                     T +  R  +YG K  ENIVQA +RDILC  MK        IV+ +HDE+V
Sbjct: 548 SCITYEGVGGTKKWERLDSYGPKFVENIVQATARDILCYAMKTL--RCCSIVMHIHDELV 605

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E    P  S+  +C  M + P WAKGL L+A+GY    Y+K
Sbjct: 606 IEA--DPKVSLDAICEQMGRTPPWAKGLLLRADGYTTPFYKK 645


>gi|300853539|ref|YP_003778523.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
 gi|300433654|gb|ADK13421.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
          Length = 649

 Score =  535 bits (1378), Expect = e-150,   Method: Composition-based stats.
 Identities = 212/702 (30%), Positives = 319/702 (45%), Gaps = 81/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + IDIET S   L K GV+ YAE     I L  Y+ D   VK+ D      +P +++
Sbjct: 1   MKFISIDIETFSSVNLQKSGVYRYAESEDFDILLFGYSVDGGEVKVIDLARGEKIPIEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D++V+  A N+ FERI   K LG+     +  K W CT + A T GLP SL+    
Sbjct: 61  NALTDDSVIKWAFNAQFERICLSKWLGMKAGTYLSPKSWQCTMIWAATLGLPLSLEGVGA 120

Query: 115 ALNFSEHLTKMEEGKALIARFCK---GSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEAT 170
            L F     K+ +GK LI  FC     +  +        +H  + W++F  Y KRDVE  
Sbjct: 121 VLGFK--KQKLSQGKNLIKYFCIPCSPTKSNGGRTRNLPHHDIEKWKMFTFYNKRDVETE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
             +  +L   P+S  E   + LDQ IND G  +D+D V +      + + +  +   +LT
Sbjct: 179 MAIQNKLSKFPVSKTEWQNYHLDQIINDGGINLDMDFVRQAISCDEKFKAENIKKAKELT 238

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
                +      L+ +L L  G+    +S+  +  +L  S+      + +  R   + S+
Sbjct: 239 GLE--NPNSPAQLKDWL-LKQGMKTDSLSKAVVSELLQDSDG--EIHEALSIRQQLAKSS 293

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K  ++   V SD R RG +QFYGA+RTGR+SG + Q QNLP+    +    +++    
Sbjct: 294 VKKYTSMENVVCSDSRARGLIQFYGANRTGRYSGRLIQVQNLPQNHLPDLKQARSLVKSG 353

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
                         + S+ +R+  I   G + +VAD + IEARV+AW+AGE W+I  FA 
Sbjct: 354 NFTALDLLYDSIPSVLSELIRTAFIPRYGSRFIVADFSAIEARVIAWLAGERWRIDVFAG 413

Query: 405 GEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G DIY  + ++ FN P+ K   +   R  GK+ ELALGY G     K M           
Sbjct: 414 GGDIYCASASQMFNVPVKKNGINGHLRQKGKIAELALGYGGSVGALKAMG---------- 463

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A++  L+    + +  AWR  +  +  LW 
Sbjct: 464 ------------------------------AIQMGLVEDELKPIVDAWRNSNPNITSLWW 493

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN- 581
            +             +  ++   +  + +      + I LPS RRL Y       +    
Sbjct: 494 RIDRAVK------TVVKTKQPIEIYGIGIFYQSGILFIKLPSGRRLAYVKPLIGENRFGG 547

Query: 582 --------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                     T +  R  +YG K  ENIVQAISRDIL E M     + + IV+ VHDE+V
Sbjct: 548 ESVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILAEAMLKLATHEFQIVMHVHDEVV 607

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E P     SV  +C +M++ P+WAKGL L A+GYE + Y+K
Sbjct: 608 IEAP-NKVSSVEEICRIMSETPAWAKGLILNADGYECEFYKK 648


>gi|225573258|ref|ZP_03782013.1| hypothetical protein RUMHYD_01449 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039390|gb|EEG49636.1| hypothetical protein RUMHYD_01449 [Blautia hydrogenotrophica DSM
           10507]
          Length = 645

 Score =  535 bits (1377), Expect = e-149,   Method: Composition-based stats.
 Identities = 209/698 (29%), Positives = 324/698 (46%), Gaps = 80/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YA      + L  Y  D   V++ D      +P +++
Sbjct: 4   MRTLSIDIETYSDVDLSKCGVYKYASSPAFEVLLFGYTADGGDVRVVDLACGEQIPEEVI 63

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D +V   A N++FER+     LG  +  + W CT V + T GLP SL++A  AL  
Sbjct: 64  SALSDTSVTKWAFNAMFERVCLSNFLGEWLEPEGWHCTMVWSATLGLPLSLESAGAALGL 123

Query: 119 SEHLTKMEEGKALIARFCK---GSIDSPPYDCTR-ANHVQAWQLFGEYCKRDVEATRELF 174
                K+ EGK LI  FC     +  +      R  +  + W+ F  Y  RDVE   ++ 
Sbjct: 124 E--KQKLTEGKDLIRYFCVPCRPTKANGGRTRNRPEHDPEKWERFKAYNLRDVETEMQIQ 181

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           KRL   P+ D   + + LDQ INDRG  +D++LV +   + A+ R++L + + +LT   +
Sbjct: 182 KRLSNFPVPDAIWEEYHLDQEINDRGIGVDMELVRQAIAMDARSREQLTDALQELTG--L 239

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      ++ +L    G++   + +  +  ++  +   +  K ++  R   + S++ K 
Sbjct: 240 DNPNSVQQMKQWLADH-GLETDTLGKKVVAELVRSA--PEPLKTVLSLRQQLAKSSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  AV +DGR  G  QFYGA+RTGR+SG + Q QNLP+   S+    + +      E 
Sbjct: 297 AAMENAVCADGRAHGMFQFYGANRTGRFSGRLIQLQNLPQNHMSDLAQARALMRGGNYEA 356

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                 D     S  +R+  +  +G+K +VAD + IEARV+AW AGE W++K F +G+DI
Sbjct: 357 ISMLYEDIPDTLSQLIRTAFVPQDGRKFIVADFSAIEARVIAWFAGERWRLKVFEDGDDI 416

Query: 409 YVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F+ P++K   +   R  GK+ ELALGY G     K+M               
Sbjct: 417 YSASASQMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMG-------------- 462

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A++  L     + +  AWR  +  + Q W D+  
Sbjct: 463 --------------------------ALEMGLAEEELQPLVDAWRTSNPMITQFWWDVDR 496

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKG--------DCS 578
                V++   +          L        + I LPS RRL Y   +           +
Sbjct: 497 AVKECVKKRVPME------SHGLHFDYRSAMLFITLPSGRRLAYVKPRIGENQFGRESVT 550

Query: 579 YLN-TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
           Y+  +   +  R  +YG K  ENIVQ  +RDILC  M+        IV  VHDEI+ E  
Sbjct: 551 YMGVSGAKKWERLESYGPKFVENIVQGTARDILCYAMRTL--RNCAIVAHVHDEIIIEA- 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                S+  +C  M + PSWAKGL L+A+GYE + Y+K
Sbjct: 608 -DRRMSLSAVCEQMGRTPSWAKGLKLRADGYECEFYQK 644


>gi|255306559|ref|ZP_05350730.1| DNA polymerase [Clostridium difficile ATCC 43255]
          Length = 652

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 220/700 (31%), Positives = 331/700 (47%), Gaps = 74/700 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + KVGV+ Y +     I L AYA+D+E VK+ D      +P +++
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D  V+  A N+ FER    K L I++    W CT + A T GLP SL +   AL F
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----HVQAWQLFGEYCKRDVEATRELF 174
           +E   KM+EGKALI  FCK    +        N     ++ W  F EYCK+DV   RE+ 
Sbjct: 121 NEDKQKMKEGKALIQYFCKPCKATKVNKGRTRNLPIHDMEKWNKFKEYCKQDVVVEREIR 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            +L     ++ E  LW LDQ IND G ++D +L+    E   +  +KL ++ +K+T   +
Sbjct: 181 NKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIKITG--L 238

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L      ++  +++ ++  IL   +   + + L   R   S ++I K 
Sbjct: 239 NNPNSPAQLKKWLSDKVSFEITSLTKESIPEILKQVDDENVVRTL-ELRKLMSKTSIKKY 297

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE- 351
             +  A  +D R+RG LQFYGA+RTGRW+G + Q QNLP+    +  L + +      + 
Sbjct: 298 EAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHIEDLDLARNLLKEGDFDL 357

Query: 352 ---TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  I S G + +V+D + IEARV+AW+AGE W++  F +   I
Sbjct: 358 IELLYDSVPDVLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWLAGEKWRLDVFNSHGKI 417

Query: 409 YVTTYAKAFNTPID--KVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F  PI+  K   E R  GK+ EL+ GY G      +M +             
Sbjct: 418 YEASASQMFKVPIESIKKGSELRQKGKLAELSNGYGGSVGALISMGAIK----------- 466

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                          L     + +  AWR  +  + + W D+ +
Sbjct: 467 -----------------------------MGLKEEELQPIVTAWRNANPNITKFWWDVDK 497

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS-------- 578
                +++   +  +       +    +   + I LPSSRRL Y   K +          
Sbjct: 498 AAKKAIKDRTIVEIQ-----HGIKFIYNPGVLFIELPSSRRLSYLRPKIEPHTTFSGDKI 552

Query: 579 ---YLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
               +   + Q  R  TYG KL ENIVQA +RD L E M N T  GY IV+ VHDE+V +
Sbjct: 553 TYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTDAGYSIVMHVHDELVID 612

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                  S+  + S+M K  SWAKGLPLKA+GYE   Y+K
Sbjct: 613 VDK-KGGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|167757895|ref|ZP_02430022.1| hypothetical protein CLOSCI_00226 [Clostridium scindens ATCC 35704]
 gi|167664549|gb|EDS08679.1| hypothetical protein CLOSCI_00226 [Clostridium scindens ATCC 35704]
          Length = 645

 Score =  532 bits (1370), Expect = e-149,   Method: Composition-based stats.
 Identities = 203/698 (29%), Positives = 314/698 (44%), Gaps = 80/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YA      + L  YA D   V + D      +P + +
Sbjct: 4   MRTLSIDIETYSDVDLSKCGVYKYASSPAFEVLLFGYAADGGDVHVVDLACGEQIPEEAI 63

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D +V     N++ ER+     LG  +  + W CT V + T GLP SL++A  AL  
Sbjct: 64  SALSDTSVTKWTFNAMLERVCLSNFLGEWLEPEGWYCTMVWSATLGLPLSLESAGAALGL 123

Query: 119 SEHLTKMEEGKALIARFCK---GSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
                K+ EGK LI  FC     +  +      R  H  + W+ F  Y  RDVE   ++ 
Sbjct: 124 E--KQKLTEGKDLIRYFCVPCRPTKANGGRTRNRPEHAPEKWERFKAYNLRDVETEMQIQ 181

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           KRL   P+ D   + + LDQ INDRG  +D++LV +   +  + R++L   + +     +
Sbjct: 182 KRLSNFPVPDAIWEEYHLDQEINDRGIGVDMELVRQAIAIDTRSRERLTAAMRE--LTEL 239

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      ++ +L    G++   + +  +  ++  +   +  ++++  R   + S++ K 
Sbjct: 240 ENPNSAQQMKQWLADH-GLETDTLGKKAVAELVKTA--PEPLREVLSLRQQLAKSSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  AV +D R  G  QFYGA+RTGR+SG + Q QNLP+    +    + +      E 
Sbjct: 297 TAMENAVCADSRAHGMFQFYGANRTGRFSGRLIQLQNLPQNHMGDLAEARALVRSGNYEA 356

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                 D     S  +R+  +  +G+K +VAD + IEARV+AW AGE W++K F +G DI
Sbjct: 357 LSVLYEDIPDTLSQLIRTAYVPQDGRKFIVADFSAIEARVIAWFAGERWRLKVFEDGGDI 416

Query: 409 YVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F+ P++K   +   R  GK+ ELALGY G     K+M               
Sbjct: 417 YCASASQMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMG-------------- 462

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A++  L     + +  AWR  +  + Q W D+  
Sbjct: 463 --------------------------ALEMGLAEEELQPLVDAWRGSNPMITQFWWDVDR 496

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKG--------DCS 578
                +++              L        + I LPS RRL Y   +           +
Sbjct: 497 AVKDCIRQRIPTET------HGLRFDYRSAMLFINLPSGRRLAYVKPRIGENQFGGESVT 550

Query: 579 YLN-TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
           Y+  + T +  R  +YG K  ENIVQ  +RDILC  M+        IV  VHDEI+ E  
Sbjct: 551 YMGVSGTKKWERLESYGPKFVENIVQGTARDILCYAMQTL--KNCSIVAHVHDEIIIEA- 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                SV  +C  M + P WAKGL L+A+GYE + Y+K
Sbjct: 608 -DRRMSVAAVCEQMGRTPPWAKGLKLRADGYECEFYQK 644


>gi|300764694|ref|ZP_07074685.1| hypothetical protein LMHG_11074 [Listeria monocytogenes FSL N1-017]
 gi|300514580|gb|EFK41636.1| hypothetical protein LMHG_11074 [Listeria monocytogenes FSL N1-017]
          Length = 645

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 213/700 (30%), Positives = 318/700 (45%), Gaps = 81/700 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L +D+ET S   L K GV+ Y+E     I L AY+ D  PV++ D      +P+++L
Sbjct: 1   MKHLSLDLETYSSVDLSKCGVYKYSESPDFEILLFAYSVDGGPVEVVDLKMDETIPAEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L DETV+  A N+ FER+   + LG+D  +  + W CT V   T GLP SL      L
Sbjct: 61  TSLSDETVIKHAFNASFERVCLSRFLGLDGFLNPRGWQCTMVWGATLGLPLSLVGVGAVL 120

Query: 117 NFSEHLTKMEEGKALIARFCK---GSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
                  K+ EGK LI  FC     +  +        +H    W  F  Y  RDVE    
Sbjct: 121 GL--DKQKLTEGKDLIRYFCVPCNPTKVNGGRTRNLPHHAPTKWSAFKTYNSRDVEVEIA 178

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           +  +L   P+ D     + LDQ INDRG  ID D V    +L    +  L++ + +LT  
Sbjct: 179 IQGKLSNFPVLDSVWKEYWLDQEINDRGIEIDKDFVEAAVQLDELSKAGLNQQLQELTGL 238

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
              +      +R +L    G++   + +  +  +L       L + L+L R   + S++ 
Sbjct: 239 E--NPNSVLQMRGWLLDH-GLETESLGKKAVAELLEQPIDENLKQVLVL-RQQLAKSSVK 294

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +     SD R RG  QFYGA+RTGR++G   Q QNLP+   S+    +++   +  
Sbjct: 295 KYQAMQNFACSDNRSRGLFQFYGANRTGRFAGRGIQLQNLPQNHMSDLSEARSLVKQSNF 354

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           E       +   + S+ +R+  +   G K +V+D + IEARV+AW++GE W+ + F NG 
Sbjct: 355 EMLNILYGNVPNVLSELLRTAFVPREGMKFIVSDFSAIEARVIAWLSGEKWRQEVFKNGG 414

Query: 407 DIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           DIY  + ++ F  P++K   +   R  GK+ ELALGY G     K M             
Sbjct: 415 DIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAM------------- 461

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                                       A++  L     + +  +WR  +  + +LW  +
Sbjct: 462 ---------------------------DALEMGLTEDELQPLVNSWRDSNINITELWWAV 494

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN--- 581
            +     V+E  S S         +        + I L S R+LVY   K   +      
Sbjct: 495 DKAVKTCVKERRSTST------HGIKFEYKSGFLFIQLLSGRKLVYVKPKIGENKFGGEA 548

Query: 582 ------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
                  AT +  R  +YG K  ENIVQAI+RDILC  M+N     Y IV  VHDE++ E
Sbjct: 549 VTYEGVGATKKWERLESYGPKFVENIVQAIARDILCFAMENL--RKYRIVGHVHDEVIIE 606

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            P      V  +C LM++ P WA+GL L A+GYE + Y+K
Sbjct: 607 VPMES--KVEDICQLMSQTPKWAEGLLLNADGYECEFYQK 644


>gi|313898058|ref|ZP_07831597.1| DNA-directed DNA polymerase [Clostridium sp. HGF2]
 gi|312957086|gb|EFR38715.1| DNA-directed DNA polymerase [Clostridium sp. HGF2]
          Length = 646

 Score =  530 bits (1366), Expect = e-148,   Method: Composition-based stats.
 Identities = 210/702 (29%), Positives = 314/702 (44%), Gaps = 84/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S +PL K GV+ Y E     I L AY+ D +PV++ D      +P ++L
Sbjct: 1   MKTLSIDIETYSDEPLQKTGVYRYVESPNFEILLFAYSVDHQPVQVIDLACGEQIPKEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L DE V+  A N+ FERI   + LG      +  + W C+ V A T GLP SL+    
Sbjct: 61  LALEDEDVIKWAFNAAFERICLSRFLGYPTGEYLDPESWRCSMVWAATMGLPLSLEGVGA 120

Query: 115 ALNFSEHLTKMEEGKALIARFCK---GSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEAT 170
            L       K+ EGK LI  FC+    +  +      R  H    W +F +Y  RDVE  
Sbjct: 121 VLGLE--KQKLTEGKDLIKYFCQPCAPTKTNGQRTRNRPFHAPDKWAMFKKYNIRDVETE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
             + +RL   P+     D + +DQ INDRG R+D++LV    E+  + R KL E + +  
Sbjct: 179 MGIQQRLARFPVPAQVWDEYHMDQEINDRGVRLDMELVAAAIEMDTRSRTKLTETMKE-- 236

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
              + +      ++ +L    G++   + +  +  +L  +        ++  R   + S+
Sbjct: 237 ITELENPNSVQQMKAWLSD-NGLETDTLGKKAVAELLKSA--PPKLSQVLTLRQQLAKSS 293

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   + + V +DGR RG  QFYGA+RTGR+SG   Q QNLP+   S+    +++    
Sbjct: 294 VRKYQAMEKTVCADGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLSDLAEARSLVRSG 353

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             E       D     S  +R+  I   G + +VAD + IEAR++AW AGE W+   FA 
Sbjct: 354 NFEAVELLYEDVPDTLSQLIRTAFIPREGTQFLVADFSAIEARIIAWFAGEKWRQDVFAK 413

Query: 405 GEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G DIY  + ++ F  P++K   +   R  GK+ ELALGY G     K M           
Sbjct: 414 GGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMG---------- 463

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A+   L       +  AWR  +  +++ W 
Sbjct: 464 ------------------------------ALDMGLTEDELPPLVDAWRQSNPNIVKFWW 493

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN- 581
           ++       V+   + S         L        + I LPS R+L Y   K   +    
Sbjct: 494 NVDHAVMEAVKFKHTTSEYG------LTFSCRSGMLFITLPSGRKLAYVKPKIGTNKFGG 547

Query: 582 --------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                    +T +  R  +YG K  ENIVQA +RDILC  M+        IV+ +HDE+V
Sbjct: 548 QCITYEGIGSTKKWERLDSYGPKFVENIVQATARDILCYAMQTL--RCCSIVMHIHDEVV 605

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E   +   S+  +C  M + P WAKGL L+A+GY    Y+K
Sbjct: 606 IEADPS--MSLDAICEQMGRTPPWAKGLLLRADGYATPFYKK 645


>gi|315122935|ref|YP_004063424.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496337|gb|ADR52936.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 675

 Score =  528 bits (1359), Expect = e-147,   Method: Composition-based stats.
 Identities = 492/675 (72%), Positives = 567/675 (84%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           M KLFIDIETRSP+PLPKVGVWAYAE+A ITLCAYA +DE +KLWD T    MPSDLL++
Sbjct: 1   MPKLFIDIETRSPKPLPKVGVWAYAEEAKITLCAYAHNDETIKLWDCTANPVMPSDLLKH 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           L+D+TV+CVAHNSLFERILFKK+L I IP +RWICTS LAR NGLP+SLKNAC+AL F E
Sbjct: 61  LKDDTVVCVAHNSLFERILFKKSLNITIPPRRWICTSTLARINGLPASLKNACMALKFPE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
            LTKMEEGKALIARFCKGSI+  PYD  RANHVQAWQLFGEYCKRDVEATREL+KRL PL
Sbjct: 121 TLTKMEEGKALIARFCKGSIEESPYDAKRANHVQAWQLFGEYCKRDVEATRELYKRLTPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           S+ ER LWLLDQ INDRGY IDL+LV KLQELIA ER++LDE+  +LT G+I S+R+T  
Sbjct: 181 SENERHLWLLDQEINDRGYAIDLNLVKKLQELIAFERERLDEEFKELTAGVIGSARKTDL 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           L  YLFL TG+DL DM+E T+ + LS  +I QL+K ++ NRL+SS SAILKLNTLS AVS
Sbjct: 241 LNKYLFLYTGLDLPDMAESTVLTALSQPDIPQLSKAILNNRLSSSQSAILKLNTLSGAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
            D RLRGTLQF+GASRTGRWSGCVFQPQNLPRQ  + + + + I+ L+ G  I DPL  A
Sbjct: 301 PDNRLRGTLQFFGASRTGRWSGCVFQPQNLPRQTLAVDEIERLIRGLDSGVPIKDPLRFA 360

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIAS GKKL+VADLAGIEARVLAW+AGE WK+ AFANGEDIY T Y+KAFN P
Sbjct: 361 SDCVRSCIIASPGKKLIVADLAGIEARVLAWVAGEQWKLNAFANGEDIYKTAYSKAFNVP 420

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           +  V+K+QRAIGKVMELALGYQGGA+VF+ MAS  GL+LQQFS+++K+T+T EDWEQA+ 
Sbjct: 421 LSDVTKDQRAIGKVMELALGYQGGARVFQKMASTLGLNLQQFSKSIKNTATSEDWEQAQR 480

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
             LWMQ+ +PEFAV D  IGTACELVK+AWRAKH+GV+QLWKD  E F CV+++G SISA
Sbjct: 481 RCLWMQETHPEFAVPDPFIGTACELVKEAWRAKHKGVVQLWKDCEEAFDCVIKDGRSISA 540

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRV  VP L+M++  ++V I LPS+R+LVY DVK D SYLNTAT+Q+MRERTYGGKLTEN
Sbjct: 541 RRVLGVPPLLMKKQHQNVFITLPSNRKLVYRDVKSDRSYLNTATAQIMRERTYGGKLTEN 600

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDIL  GM NATK GYDIVLTVHDEIV E PDTP FS   LCSLMT+NP+WAKG
Sbjct: 601 IVQAISRDILATGMINATKAGYDIVLTVHDEIVCEVPDTPEFSSDDLCSLMTRNPTWAKG 660

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEA RYRK
Sbjct: 661 LPLKAEGYEAVRYRK 675


>gi|220930425|ref|YP_002507334.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
 gi|220000753|gb|ACL77354.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
          Length = 652

 Score =  527 bits (1358), Expect = e-147,   Method: Composition-based stats.
 Identities = 210/699 (30%), Positives = 323/699 (46%), Gaps = 75/699 (10%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQ 59
             L IDIET S   L K GV+ Y E     I L AYA+DDEP+ + D  +   +P  + +
Sbjct: 3   KILSIDIETYSSVDLIKCGVYRYVEAPDFEILLFAYAYDDEPITVIDLADFEELPEQVTK 62

Query: 60  YLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFS 119
            L D  V+  A+N+ FER    K     +P ++W CTSV A T GLP +L      L   
Sbjct: 63  DLTDPDVIKAAYNANFERTCIAKFYNKPMPPEQWRCTSVHALTLGLPGNLDGVAKVLGLD 122

Query: 120 EHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELFK 175
               K   GK LI  F   CK +  +        +H    W+ F +YCK+DV   R + K
Sbjct: 123 AQ--KDTAGKNLIKYFSVPCKPTKVNGGRTRNFPHHAPDKWKQFKDYCKQDVVVERAIRK 180

Query: 176 RL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIR 233
           ++   P+ + E  LW LDQ IND G R+D  LV +  +   Q   +LD +  +LT   + 
Sbjct: 181 KIEKYPVPEHEWKLWTLDQKINDAGVRLDPVLVQQALKCDLQYATRLDAEAKELTG--LD 238

Query: 234 SSRQTYALRMYLFLITGIDLVDM-SEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
           +   T  L ++L    G+ + +   +  +  +L  +   +    ++  R   S ++  K 
Sbjct: 239 NPNSTTQLTVWL-KKQGLTVDNGLGKDYIPGLLDQAKGDETVTRMLELRKEMSKTSTKKY 297

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  A+ SD R RG LQF GA+RT RW+G + Q QNLP+ +  +  + + +    + E 
Sbjct: 298 EAMERAMCSDDRARGLLQFCGANRTWRWAGRLIQVQNLPQNKIPDLGVARELLHSGKFEA 357

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                  P  + S  +R+  I S+G + +V+D + IEARV+AW+AGE W++K F +   I
Sbjct: 358 IELLFNSPPFVLSQLIRTAFIPSDGCRFIVSDFSAIEARVIAWLAGESWRMKVFKSHGKI 417

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + +  F+ PI++++K    R  GK+ ELALGY G     + M               
Sbjct: 418 YEASASHMFHVPIEEITKGNPLRQKGKIAELALGYGGSIGALEAMG-------------- 463

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+K  L       +  AWR  +  +++LW D+ +
Sbjct: 464 --------------------------ALKMGLDADELPDLVTAWRNSNPKIVKLWWDVDK 497

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT-- 584
                V+E   +  +       +        + I LPS R+L Y   K            
Sbjct: 498 AAMTAVREHMPVRIQYG-----ITFSYKDGFLFIKLPSGRKLAYVKPKIKDGKFGRPALT 552

Query: 585 --------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
                       R  TYG KL ENIVQA++RD L   M      GYDI + VHDE++ + 
Sbjct: 553 YEGMDQIKKTWERIDTYGPKLVENIVQAVARDCLAVNMLRLDDAGYDIRMHVHDEVILDV 612

Query: 637 PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           P+T   ++  +  +M++   WA GLPL+A+GYE + Y+K
Sbjct: 613 PNTDTDALAQVNEIMSQPIDWAPGLPLRADGYETEFYKK 651


>gi|323484113|ref|ZP_08089483.1| hypothetical protein HMPREF9474_01234 [Clostridium symbiosum
           WAL-14163]
 gi|323402555|gb|EGA94883.1| hypothetical protein HMPREF9474_01234 [Clostridium symbiosum
           WAL-14163]
          Length = 646

 Score =  526 bits (1355), Expect = e-147,   Method: Composition-based stats.
 Identities = 210/696 (30%), Positives = 329/696 (47%), Gaps = 77/696 (11%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
            L IDIET S   L K GV+AYA+     + L AY++D    ++ D  +   +P ++   
Sbjct: 4   ILEIDIETYSDVDLIKCGVYAYADSPAFEVLLFAYSFDGGETQVIDLAQGEELPGEVSAA 63

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           + D+ VM  A N+ FER    K  G  +  + W C++V A    LP SL+     L   +
Sbjct: 64  IFDDDVMKTAFNANFERTCLSKHFGKQLSPESWHCSAVQAAMLALPRSLEEVGAVLGLEQ 123

Query: 121 HLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELFKR 176
              KM+EGK LI  F   CK +  +         H  + W+LF  YC RDV+  +E+ ++
Sbjct: 124 Q--KMKEGKDLIRYFCMPCKPTKANGGRTRNLPCHAPEKWELFKSYCIRDVDVEKEIRRK 181

Query: 177 L--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRS 234
           L   P+ + E +L+ LDQ INDRG  +D +LV +        +  + +   +LT     +
Sbjct: 182 LQHFPIPESEMELYRLDQKINDRGVLVDRELVRQAVSCDLLYKDVVTKRAYELTGLE--N 239

Query: 235 SRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNT 294
                 ++ +L    G+++  +S+ T+  ++  S+     ++L+  RL  + +++ K   
Sbjct: 240 PNSVAQIKSWLGE-NGVEMESLSKKTVAGLIEESDG--EVQELLRLRLLMAKTSVKKYEA 296

Query: 295 LSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET-- 352
           +  +V SDGR+ G LQFYGA+RTGRW+G + Q QNLP+    +  + + +    R E   
Sbjct: 297 MERSVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNHILDLEMARNLVKQGRFEDVE 356

Query: 353 --IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYV 410
                   + S+ +R+  I   G + VVAD + IEARVLAW++GE W+++ FA+   IY 
Sbjct: 357 LLYDSTPNVLSELIRTAFIPKPGYRFVVADFSAIEARVLAWLSGERWRLEVFASHGKIYE 416

Query: 411 TTYAKAFNTPIDKVSKEQR--AIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKS 468
            + +  F+ PI++V+K       GK+ ELALGY G      +M                 
Sbjct: 417 ASASAMFHVPIEEVTKGSPFRQKGKISELALGYGGAVGALTSMG---------------- 460

Query: 469 TSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGF 528
                                   A+   L+      +  AWR+ +  + Q W D+    
Sbjct: 461 ------------------------ALDMGLVEEELAPLVSAWRSANPHITQFWWDVDAAA 496

Query: 529 ACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN------- 581
              V E     A R      +V       + + LPS R+L Y   +   +          
Sbjct: 497 VKAVTEKKKTRAGR------IVFEYKSGILFVELPSGRKLSYVKPRMALNKFGRNGLTYE 550

Query: 582 --TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDT 639
                 +  R  TYG KL ENIVQ  +RD+L E M    + GY IV+  HDEI++E P+ 
Sbjct: 551 GIAENKKWDRIETYGPKLVENIVQGTARDLLAEAMLRVEEMGYPIVMHCHDEIIAEVPEG 610

Query: 640 PYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
              SV  +C++M   P WA GLPL+A+GYE   Y+K
Sbjct: 611 T-GSVEEMCAVMAVQPEWADGLPLRADGYECAFYKK 645


>gi|134299054|ref|YP_001112550.1| DNA-directed DNA polymerase [Desulfotomaculum reducens MI-1]
 gi|134051754|gb|ABO49725.1| DNA-directed DNA polymerase [Desulfotomaculum reducens MI-1]
          Length = 650

 Score =  525 bits (1352), Expect = e-146,   Method: Composition-based stats.
 Identities = 217/700 (31%), Positives = 316/700 (45%), Gaps = 76/700 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ L IDIET S   L K GV+AYAE     I L  YA+DDEPV+L D      +P ++L
Sbjct: 1   MTILGIDIETYSRVDLTKSGVYAYAEAEDFEILLFGYAFDDEPVQLIDLASGEQLPDNVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  ++  A N+ FER    K     +P ++W CT V A T GLP  L +    L  
Sbjct: 61  NALTDPEIIKTAFNANFERTCIAKHFNRPMPPEQWRCTHVHALTLGLPGHLGDVAKVLGL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
            +   K   GKALI  F   CK +  +         +    W  F  YCK+DV   R++ 
Sbjct: 121 KQQ--KDTAGKALIRYFSMPCKPTKVNGQRTRNLPEHDPDRWAKFKSYCKQDVAVERDIR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           K L   P+ + E  LW LDQ IND G  +D  LV        Q + KL     KLT   +
Sbjct: 179 KTLERFPVIEAEHKLWCLDQRINDGGVLVDSQLVTNAIACDTQYQDKLMAKAAKLTG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            + +    L+ +L    G+++  +++ ++  +L  +  +   K ++  R   + +++ K 
Sbjct: 237 DNPKSVSQLKQWLLKTDGLEVESLNKESVPELLKQTESST-VKQMLELRQEMAKTSVKKY 295

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  A   DGR+RG LQFYGA+RTGRW+G + Q QNLPR    +    + +      E 
Sbjct: 296 LAMERAKGKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPRNSIKDLDQARQLLKAGDYEM 355

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  +   G + +VAD + IEARV+AW+A E W++  F     I
Sbjct: 356 LELLFESVPTVLSQLIRTAFVPKEGHRFIVADFSAIEARVIAWLADEKWRMDVFRTHGKI 415

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + +  F+ PI++++K    R  GKV ELALGYQGG      M               
Sbjct: 416 YEASASAMFHVPIEEITKGNPLRQKGKVSELALGYQGGPGALIAMG-------------- 461

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+K+ L       + K WR     +++ W D   
Sbjct: 462 --------------------------ALKEGLTEEELPGLVKLWRQSSPNIVKFWYDTEA 495

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYL------ 580
                V+E  ++          +        + I LPS RRL Y   +   +        
Sbjct: 496 AAIKAVKEKTTVELH-----HGIHFIYESGILFIRLPSGRRLAYIKPRIQNNPRLDKPAL 550

Query: 581 -----NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
                   T Q  R  TYGGKL ENIVQA++RD L E +      GY  V+ VHDE V E
Sbjct: 551 TYEGQEQGTKQWGRLYTYGGKLVENIVQAVARDCLAEALLRLDVAGYKTVMHVHDESVME 610

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            P     S+   C +M +   WA GLP++A+G+E+  Y+K
Sbjct: 611 MPHG-VGSLEDACRIMEQPIPWAPGLPMRADGFESNYYKK 649


>gi|323693311|ref|ZP_08107529.1| DNA-dependent DNA polymerase, family A [Clostridium symbiosum
           WAL-14673]
 gi|323502794|gb|EGB18638.1| DNA-dependent DNA polymerase, family A [Clostridium symbiosum
           WAL-14673]
          Length = 646

 Score =  525 bits (1352), Expect = e-146,   Method: Composition-based stats.
 Identities = 210/702 (29%), Positives = 316/702 (45%), Gaps = 84/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S +PL K GV+ Y E     I L AY+ D + V++ D      +P ++L
Sbjct: 1   MKTLSIDIETYSDEPLQKTGVYRYVESPNFEILLFAYSVDSQSVQVIDLACGEQIPKEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L +ETV+  A N+ FERI   + LG      + S+ W C+ + A T GLP SL+    
Sbjct: 61  LALENETVIKWAFNANFERICLSRFLGYPTGEYLDSESWRCSMIWAATMGLPLSLEGVGA 120

Query: 115 ALNFSEHLTKMEEGKALIARFCK---GSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEAT 170
            L       K+ EGK LI  FC+    +  +      R  H    W +F +Y  RDVE  
Sbjct: 121 VLGLE--KQKLSEGKDLIKYFCQPCAPTKTNGQRTRNRPFHAPDKWAMFKKYNIRDVETE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
             + +RL   P+     D + +DQ INDRG R+D++LV    E+  + R +L E + +  
Sbjct: 179 MGIQQRLAKFPVPAQVWDEYHMDQEINDRGVRLDMELVAAAIEMDTRSRTELTETMKE-- 236

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
              + +      ++ +L    G++   + +  +  +L  ++       ++  R   + S+
Sbjct: 237 ITELENPNSVQQMKAWLSD-NGLETDTLGKKAVTELLKSASPK--LSQVLTLRQQLAKSS 293

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   + + V +DGR RG  QFYGA+RTGR+SG   Q QNLP+    +    +++    
Sbjct: 294 VRKYQAIEKTVCADGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLPDLAEARSLVRSG 353

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             E       D     S  +R+  I   G + +VAD + IEARV+AW AGE W+ + FA 
Sbjct: 354 NFEAVKLLYEDVPDTLSQLIRTAFIPREGTQFLVADFSAIEARVIAWFAGEKWRQEVFAK 413

Query: 405 GEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G DIY  + ++ F  P++K   +   R  GK+ ELALGY G     K M           
Sbjct: 414 GGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMG---------- 463

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A+   L       +  AWR  +  +++ W 
Sbjct: 464 ------------------------------ALDMGLTEEELPPLVDAWRQSNPNIVKFWW 493

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN- 581
           ++       V+   + S+        L        + I LPS R+L Y   K   +    
Sbjct: 494 NVDHAVMEAVKFKHTTSSYG------LTFSCRSGMLFITLPSGRKLAYVKPKLGTNKFGG 547

Query: 582 --------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                     T +  R  +YG K  ENIVQA +RDILC  MK        IV+ +HDE+V
Sbjct: 548 QCITYEGIGGTKKWERLDSYGPKFVENIVQATARDILCYAMKTL--RCCSIVMHIHDEVV 605

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E    P  S+  +C  M + P WAKGL L+A+GY    Y+K
Sbjct: 606 IEA--DPRMSLEAVCEQMGRTPPWAKGLLLRADGYATPFYKK 645


>gi|284048474|ref|YP_003398813.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
 gi|283952695|gb|ADB47498.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
          Length = 662

 Score =  525 bits (1352), Expect = e-146,   Method: Composition-based stats.
 Identities = 203/718 (28%), Positives = 308/718 (42%), Gaps = 100/718 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YAE     I L  YA D  PV++ D  +  ++P ++L
Sbjct: 1   MKTLSIDIETYSDVNLAKCGVYKYAESPAFEILLFGYAVDGGPVQVVDLAQGESIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL--------------------GIDIPSKRWICTSV 98
             L D+TV   A N+ FER+   + L                       +    W C+ V
Sbjct: 61  DALTDDTVTKWAFNANFERVCLSRHLTDLGRSLDPFHDQHPLSKKCARFLNPAGWKCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFC---KGSIDSPPYDCT-RANHVQ 154
            +   GLP SL+     LN      KM+EG+ LI  FC   K +  +         + + 
Sbjct: 121 WSAYLGLPLSLEGVGAVLNLDNQ--KMKEGRELIRYFCIPCKETKANGGRTRNLPQHALD 178

Query: 155 AWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQEL 212
            W LF  Y KRDVE    + +RL   P+     + + LDQ INDRG  IDL+L  +   L
Sbjct: 179 KWNLFKSYNKRDVEVEMAIQQRLQKYPVPKQVWEEYHLDQEINDRGIAIDLELAKQAVAL 238

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQ 272
            A+ R+ L   + + T     +      +  +L    G+    + +  ++ +L  +    
Sbjct: 239 DAKSRESLMAALKERTGLE--NPNSVIQMLDWL-EQHGLKTDSLGKKNVQELLKTAQEP- 294

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
             + ++L R   + S++ K   +      DGR RG  QFYGA+RTGR++G   Q QNLP+
Sbjct: 295 -LRSVLLLRQKLAKSSVKKYQAMEMTACKDGRARGMFQFYGANRTGRFAGRHIQLQNLPQ 353

Query: 333 QERSEEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARV 388
               +    + +      E           + S  +R+  +   G K VV+D + IEARV
Sbjct: 354 NHLPDLSEARELVRQGNYEALDLLYDSIPDVLSQLIRTAFVPRAGMKFVVSDFSAIEARV 413

Query: 389 LAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP--IDKVSKEQRAIGKVMELALGYQGGAK 446
           ++W+AGE WK + FA G+DIY +T ++ F  P     ++   R  GK+ ELA GY G   
Sbjct: 414 ISWLAGERWKSEDFAAGKDIYCSTASQMFGVPVVKHGINGNLRQKGKIAELACGYGGSVG 473

Query: 447 VFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELV 506
             K M                                         A+   +       +
Sbjct: 474 ALKAMG----------------------------------------ALDMGIPEEELGNL 493

Query: 507 KKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSR 566
            ++WR+ +  ++  W  +       +++   +       V  +        + I LPS R
Sbjct: 494 VQSWRSANPHIVDFWWQVDGAVKTTIKQRIPV------WVNNIRFFCQSGMLFIELPSGR 547

Query: 567 RLVYSDVKGDCSYLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA 617
           RL Y   +   +             AT +  +  +YG K  ENIVQ ISRDILC  M+  
Sbjct: 548 RLSYVKPRIGENRFGGESVTYEGIGATKKWEQLESYGPKFVENIVQGISRDILCYAMQTL 607

Query: 618 TKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                 IV  VHDE++ E P     SV  +C  M + P WA+GL L+A+GY  + Y+K
Sbjct: 608 --RCCAIVGHVHDELIIECPKDT--SVDAICEEMGRTPPWAEGLVLRADGYACEFYQK 661


>gi|167630957|ref|YP_001681456.1| DNA polymerase i, putative [Heliobacterium modesticaldum Ice1]
 gi|167593697|gb|ABZ85445.1| DNA polymerase i, putative [Heliobacterium modesticaldum Ice1]
          Length = 646

 Score =  523 bits (1347), Expect = e-146,   Method: Composition-based stats.
 Identities = 208/702 (29%), Positives = 313/702 (44%), Gaps = 84/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y E     I L  Y+ D   V++ D     A+PS ++
Sbjct: 1   MRALNIDIETYSSVDLAKSGVYRYTESPDFAILLFGYSVDGGEVQVVDLMCSEAIPSKVV 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D+ V   A N+ FERI   K LG+     +    W CT V +   GLP SL+    
Sbjct: 61  DALTDKDVTKWAFNAQFERICLSKWLGLPTGQYLDPMSWRCTMVWSAYMGLPLSLEGTGA 120

Query: 115 ALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRA-NHVQAWQLFGEYCKRDVEAT 170
            L       K+ EGK LI  F   CK ++ +         +    W  F  Y  RDVE  
Sbjct: 121 VLGLE--KQKLTEGKDLIRHFSVPCKPTVSNEGRTRNLPIHAPDKWAAFKAYNLRDVETE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
             + ++L   P+ +G    + LDQ INDRG  +D+DLV +  E+  + R KL   I +  
Sbjct: 179 MAIQQKLAKFPVPEGVWGEYHLDQEINDRGVALDMDLVRQAIEMDNRSRSKLTGMIRE-- 236

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
              + +      ++ +L    G++   + +  +  +L  ++       ++  R + + S+
Sbjct: 237 LTELENPNSVVQMKQWLSDH-GLETDTLGKKAVVELLKTASEP--LGKVLELRQSLAKSS 293

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   +   V +DGR RG  QFYGA+RTGRW+G + Q QNLP+    +    +++    
Sbjct: 294 VKKYTAMENVVCTDGRARGMFQFYGANRTGRWAGRLIQLQNLPQNHMPDLEQARSLVRSG 353

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
                         + S+ +R+  +   G K +VAD + IEARV+AW+AGE W+ + F +
Sbjct: 354 NFAALEMLYDSVPEVLSELIRTAFVPKKGCKFIVADFSAIEARVIAWLAGEKWRQEVFES 413

Query: 405 GEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G DIY  + ++ F+ P++K   +   R  GK+ ELALGY G     K M +      ++ 
Sbjct: 414 GGDIYCASASQMFHVPVEKNGVNGHLRQKGKIAELALGYGGSVGALKAMGALEMGLEEEE 473

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                                    + +  AWR+ +  +++LW 
Sbjct: 474 L----------------------------------------QPLVSAWRSSNPKIVRLWW 493

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT 582
           D+       V+E  +     +                I LPS RRL Y   +   +   +
Sbjct: 494 DIDRAAMKAVRERTTTETHGIR------FSYQSGMFFITLPSGRRLAYVKPRIGQNRFGS 547

Query: 583 ---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                       +  R  +YG KLTENIVQA SRDILC  M+N       IV+ VHDEIV
Sbjct: 548 DCITYEGVGGAKKWERIESYGPKLTENIVQATSRDILCYAMRNL--RHCSIVMHVHDEIV 605

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E       S   +C  M + P WAKGL L+A+GYE   Y+K
Sbjct: 606 IEA--DRRMSTEAVCKQMGQTPPWAKGLLLRADGYETDFYKK 645


>gi|254975142|ref|ZP_05271614.1| DNA polymerase [Clostridium difficile QCD-66c26]
 gi|255314269|ref|ZP_05355852.1| DNA polymerase [Clostridium difficile QCD-76w55]
 gi|255516949|ref|ZP_05384625.1| DNA polymerase [Clostridium difficile QCD-97b34]
 gi|255650051|ref|ZP_05396953.1| DNA polymerase [Clostridium difficile QCD-37x79]
 gi|260686788|ref|YP_003217921.1| dna-directed dna polymerase i [Clostridium difficile R20291]
 gi|306519586|ref|ZP_07405933.1| dna-directed dna polymerase i [Clostridium difficile QCD-32g58]
 gi|260212804|emb|CBE03971.1| dna-directed dna polymerase i [Clostridium difficile R20291]
          Length = 652

 Score =  522 bits (1345), Expect = e-146,   Method: Composition-based stats.
 Identities = 218/700 (31%), Positives = 326/700 (46%), Gaps = 74/700 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + KVGV+ Y +     I L AYA+D+E VK+ D      +P +++
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D  V+  A N+ FER    K L I++    W CT + A T GLP SL +   AL F
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRAN----HVQAWQLFGEYCKRDVEATRELF 174
           +E   KM+EGKALI  FCK    +        N     ++ W  F EYCK+DV   RE+ 
Sbjct: 121 NEDKQKMKEGKALIQYFCKPCKATKVNKGRTRNLPIHDMEKWNKFKEYCKQDVVVEREIR 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            +L     ++ E  LW LDQ IND G ++D +L+    E   +  +KL ++ +K+T   +
Sbjct: 181 NKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIKITG--L 238

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G ++  +++ ++  IL   +   + + ++  R   S ++I K 
Sbjct: 239 NNPNSPAQLKKWLSDKVGFEITSLTKESIPEILKQVDDENVVR-ILELRKLMSKTSIKKY 297

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE- 351
             +  A  +D R+RG LQFYGA+RTGRW+G + Q QNLP+    +  L + +      + 
Sbjct: 298 EAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHIEDLDLARNLLKEGDFDL 357

Query: 352 ---TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  I S G + +V+D + IEARV+AW AGE W++  F +   I
Sbjct: 358 IELLYDSVPDVLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWFAGEKWRLDVFNSHGKI 417

Query: 409 YVTTYAKAFNTPID--KVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + +  F  PI+  K     R  GK+ ELALGY G      +M +   + L +     
Sbjct: 418 YEASASHMFKVPIESIKKGDPLRQKGKISELALGYGGSIGALTSMGAIK-MGLDEEELQP 476

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
             T+                                                  W D+ +
Sbjct: 477 LVTTWRNANPNITKF---------------------------------------WWDVDK 497

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS-------- 578
                +++   +  +       +    +   + I LPS RRL Y   K +          
Sbjct: 498 AAKKAIKDRTIVKLQ-----HGIKFIYNPGVLFIELPSGRRLSYLRPKIEPHTTFSGDKI 552

Query: 579 ---YLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
               +   + Q  R  TYG KL ENIVQA +RD L E M N T  GY IV+ VHDE+V +
Sbjct: 553 TYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTDAGYSIVMHVHDELVID 612

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                  S+  + S+M K  SWAKGLPLKA+GYE   Y+K
Sbjct: 613 VDK-KGGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|153955279|ref|YP_001396044.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
 gi|219855702|ref|YP_002472824.1| hypothetical protein CKR_2359 [Clostridium kluyveri NBRC 12016]
 gi|146348137|gb|EDK34673.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
 gi|219569426|dbj|BAH07410.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 644

 Score =  522 bits (1344), Expect = e-146,   Method: Composition-based stats.
 Identities = 206/700 (29%), Positives = 314/700 (44%), Gaps = 82/700 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ + IDIET S   L K GV+ YAE     I L  Y+ D   V++ D      +P++++
Sbjct: 1   MNSISIDIETFSSANLQKCGVYRYAESDDFEILLFGYSVDGGAVQVVDLACGEKIPNEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D +V   A N++FER+   K L +   +    W C+ V +   GLP SL+     L
Sbjct: 61  NALMDNSVTKWAFNAMFERVCLSKWLNLTDYLDPTSWKCSMVWSAYMGLPLSLEGVGAVL 120

Query: 117 NFSEHLTKMEEGKALIARFCKG----SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRE 172
                  K+ EGK LI  FC        +         + +  W+ F  Y  RDVEA   
Sbjct: 121 GLE--KQKLTEGKDLIKYFCTPCSPTKSNGGRVRNLPKHDMDKWERFKAYNIRDVEAEMS 178

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + +RL   P+ +     + LDQ INDRG  ID+  V +  ++  Q R+KL   +  +T+ 
Sbjct: 179 IQQRLSKFPIPENIWSEYHLDQKINDRGIAIDMAFVKQAVKMDEQSREKLMALMQDITNL 238

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
              +      ++ +L    G++   + +  +  +L  +   +    ++  R   + S+I 
Sbjct: 239 E--NPNSIQQMKEWLAD-NGLETDSLGKKAVAEMLKTA--PEPLGTVLELRQQLAKSSIK 293

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  AV +DGR RG  QFYGA+RTGR+SG + Q QNLP+    +    + +      
Sbjct: 294 KYTAMENAVCNDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPDLEQARALVRSGNF 353

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +           + S+ +R+  +   G K +VAD + IEARV+AW+AGE W+I  F NG 
Sbjct: 354 DALTLIYDSIPEVLSELIRTAFVPQEGMKFIVADFSAIEARVIAWLAGEKWRIDVFQNGG 413

Query: 407 DIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           DIY  + ++ FN P++K   +   R  GK+ ELALGY G     K+M             
Sbjct: 414 DIYCASASQMFNVPVEKNGVNGHLRQKGKIAELALGYGGSVGALKSMG------------ 461

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                                       A++  +     + +  AWR  +  + +LW D+
Sbjct: 462 ----------------------------ALEMGIEEEELQPLVTAWRQSNPNITKLWWDV 493

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN--- 581
                  V++              +        + IVLPS RRL Y   +   +      
Sbjct: 494 DHAVKTCVKQKIPTET------HGIKFIYQSGMLFIVLPSGRRLSYVKPRMGENVFGGES 547

Query: 582 ------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
                   T +  R  +YG K  ENIVQAISRDILC  M+        IV  VHDEI+ E
Sbjct: 548 VTYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQTL--KNCSIVAHVHDEIIIE 605

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                  S+ T+C  M + P+WA GL L A+GYE + Y+K
Sbjct: 606 A--DMRMSLSTICEQMARTPTWANGLLLSADGYECQFYQK 643


>gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040870|gb|ACT57666.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|317120755|gb|ADV02576.1| DNA polymerase A [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  521 bits (1342), Expect = e-145,   Method: Composition-based stats.
 Identities = 401/677 (59%), Positives = 484/677 (71%), Gaps = 4/677 (0%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLS- 119

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
              KMEEGK LIARFCKG      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 120 -SQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG-ETIADPLG 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L     +  DPL 
Sbjct: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358

Query: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418

Query: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478

Query: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538

Query: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598

Query: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658

Query: 659 KGLPLKAEGYEAKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYESKRYRK 675


>gi|42779458|ref|NP_976705.1| DNA polymerase I [Bacillus cereus ATCC 10987]
 gi|42735374|gb|AAS39313.1| DNA polymerase I [Bacillus cereus ATCC 10987]
          Length = 644

 Score =  519 bits (1336), Expect = e-145,   Method: Composition-based stats.
 Identities = 201/700 (28%), Positives = 308/700 (44%), Gaps = 82/700 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M+ + IDIET S   L K GV+ YAE     I L  Y+ D   V++ D      +P +++
Sbjct: 1   MNSISIDIETFSGANLQKSGVYRYAESDDFEILLFGYSVDGGEVQVVDLACGEEIPDEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D++V   A N++FER+   K L +   +    W C+ + +   GLP SL+     L
Sbjct: 61  NALLDDSVTKWAFNAMFERVCLSKWLNLTEYLDPASWKCSMIWSAYMGLPLSLEGVGAVL 120

Query: 117 NFSEHLTKMEEGKALIARFCKG----SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRE 172
                  K+ EGK LI  FC        +         + +  W+ F  Y  RDVEA   
Sbjct: 121 GLE--KQKLTEGKDLIKYFCTPCSPTKSNGGRVRNLPEHDMDKWERFKAYNLRDVEAEMS 178

Query: 173 LFKRLIPLS--DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + +R       +   + + LDQ INDRG  ID+  V +   +    R+KL   +  +T+ 
Sbjct: 179 IQQRFSKFLVPENIWEEYHLDQEINDRGIAIDMTFVKQAVVMDEHSREKLMALMQDITNL 238

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
              +      ++ +L    G++   + +  +  +L  +   +    ++  R   + S++ 
Sbjct: 239 E--NPNSVQQMKDWLAD-NGLETDTLGKKAVAEMLKTA--PEPLGTVLELRQQLAKSSVK 293

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  AV +DGR RG  QFYGA+RTGR+SG + Q QNLP+    +    + +      
Sbjct: 294 KYTAMENAVCNDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPDLEQARALVRSGNF 353

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +           + S+ +R+  I   G K +VAD + IEARV+AW+AGE W+I  F NG 
Sbjct: 354 DALTLLYDSIPEVLSELIRTAFIPREGMKFIVADFSAIEARVIAWLAGEKWRIDVFQNGG 413

Query: 407 DIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           DIY  + ++ FN P++K   +   R  GK+ ELALGY G     K+M             
Sbjct: 414 DIYCASASQMFNVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMG------------ 461

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                                       A++  +     + +  AWR  +  + +LW D+
Sbjct: 462 ----------------------------ALEMGIEEEELQPLVTAWRQSNPNITKLWWDV 493

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN--- 581
                  V++              +        + I LPS RRL Y   +   +      
Sbjct: 494 DRAVKTCVKQKTPTET------HGIKFIYQSGMLFIALPSGRRLAYVKPRMGENMFGGES 547

Query: 582 ------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
                   T +  R  +YG K  ENIVQAISRDILC  M+        IV  VHDEI+ E
Sbjct: 548 VTYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQTL--KNCSIVAHVHDEIIIE 605

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                  S+  +C  M K P+WA GL L A+GYE + Y+K
Sbjct: 606 ADMGT--SLSAICEQMAKMPTWANGLLLSADGYECQFYQK 643


>gi|205375254|ref|ZP_03228044.1| DNA-directed DNA polymerase [Bacillus coahuilensis m4-4]
          Length = 649

 Score =  519 bits (1336), Expect = e-145,   Method: Composition-based stats.
 Identities = 225/700 (32%), Positives = 330/700 (47%), Gaps = 77/700 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+AY+E     I L AYA DDE V++ D      +P+++L
Sbjct: 1   MKTLIIDIETYSKVDLVKCGVYAYSESADFEILLFAYAVDDEEVEIVDLASGEKIPANIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + + D TV+  A+N+ FER    K   I +P ++W CTSV A   GLP  L      L  
Sbjct: 61  KAMIDPTVIKTAYNANFERTCLAKHFQIPMPPEQWRCTSVHALMLGLPGYLDGVAKCLKL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRA-NHVQAWQLFGEYCKRDVEATRELF 174
                KM+EGKALI  F   CK +  +         +    W  F +YCK+DVE  RE+ 
Sbjct: 121 QGQ--KMKEGKALIRYFSIPCKPTKVNGGRTRNLPKHDPARWDTFKDYCKQDVEVEREIR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           K+L   PL   E++LW LDQ IND G  ID +LV    +     + +L E+   +    +
Sbjct: 179 KKLEVFPLPTMEQELWELDQKINDEGVVIDTNLVNHAIKADKAFQDELIEEA--VRLTGL 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L L  G+++  +++  +++++S        K L+  R A S +++ K 
Sbjct: 237 ENPNSPAQLKGWL-LKQGLEVDSLAKKNVEALMSEVENP-EVKRLLELRRAMSKTSVKKY 294

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  +V SD R+RG LQFYGASRTGRW+G + Q  NLPR    +  + + +    + E 
Sbjct: 295 EAMERSVGSDQRVRGLLQFYGASRTGRWAGRLVQIHNLPRNSLKDLQVARELLESGKYEA 354

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  I S G + VVAD + IEARV+AW+AGE W++  F +   I
Sbjct: 355 LEVLFESVSDVLSQLIRTAFIPSKGHRFVVADFSAIEARVIAWLAGERWRMDVFQSHGKI 414

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + A+ F  PI+ + K    R  GK+ ELALGY G       M               
Sbjct: 415 YEASAAQMFKVPIETIDKGSPLRQKGKIAELALGYGGSKGALMQMG-------------- 460

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A++  L       +  AWR  +  +++LW  +  
Sbjct: 461 --------------------------ALEMGLTEDELPELVSAWREANPKIVKLWWGIEA 494

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC--------- 577
                V+E   +  +       L     K  + I LPS R L Y   K            
Sbjct: 495 AAIKAVKEKAVVKMQ-----HGLTFHYTKGILFITLPSGRSLAYVRPKIGIDERFGKEQL 549

Query: 578 SYLNT--ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
           +Y  T   + Q  R  TYGGKLTENI+QAI+RD L   M    + GY I   VHDE++ +
Sbjct: 550 TYEGTEQGSKQWGRIPTYGGKLTENIIQAIARDCLAVSMLRLDEAGYRINFHVHDEVILD 609

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            P     S+  + ++M ++  WA GLPL A+ +E   Y+K
Sbjct: 610 VPI-ATGSMEEVENIMGQSIDWAPGLPLGADSFETFYYKK 648


>gi|57234138|ref|YP_181815.1| family A DNA-dependent DNA polymerase [Dehalococcoides ethenogenes
           195]
 gi|57224586|gb|AAW39643.1| DNA-dependent DNA polymerase, family A [Dehalococcoides ethenogenes
           195]
          Length = 662

 Score =  519 bits (1336), Expect = e-145,   Method: Composition-based stats.
 Identities = 214/718 (29%), Positives = 319/718 (44%), Gaps = 100/718 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + IDIET S   L K GV+ YAE     I L  YA D   V++ D  +   +P +++
Sbjct: 1   MKNISIDIETFSDIDLNKCGVYKYAESPNFEILLFGYAVDGGKVQVIDLAQGEHIPQEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKT---LGID-----------------IPSKRWICTSV 98
             L D+ V   A N+ FER+   +    LG+                  +  + W C+ V
Sbjct: 61  DALTDDEVTKWAFNANFERVCLSRYLSDLGVSLDPFHDNHPLSTECARFLNPEGWRCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQ 154
            A T GLP SLK     L   +   KM+EGKALI  F   C  +  +         H  +
Sbjct: 121 WAATMGLPLSLKGVGQVLKLEDQ--KMDEGKALIKYFSVPCAPTKANGGRTRNMPFHDPE 178

Query: 155 AWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQEL 212
            W+ F  Y KRDVE    + +RL   P+ D   D + +DQ INDRG R+D+DLV K  E+
Sbjct: 179 KWETFKAYNKRDVEVEMAIQQRLTNFPVPDFVWDEYRIDQEINDRGVRLDMDLVAKAIEM 238

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQ 272
             + R +L   +       + +      ++ +L    G++   + +  +  ++  +    
Sbjct: 239 DTRSRTELTTAMKD--ITELDNPNSVQQMKQWLSD-NGLETDSLGKKVVAELIKTA--PS 293

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
             + ++  R   + S++ K  T+  AV  DGR RG   FYGA+RTGRW+G + Q QNLP+
Sbjct: 294 ELQTVLELRQQLAKSSVKKYQTMERAVCDDGRARGMFMFYGANRTGRWAGRLIQLQNLPQ 353

Query: 333 QERSEEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARV 388
               +    + +      +       D     S  +R+  I  +G +L V+D + IEARV
Sbjct: 354 NHLEDLADARALVKSGDFDAVKLLYEDVPDTLSQLIRTAFIPKDGTQLYVSDFSAIEARV 413

Query: 389 LAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAK 446
           +AW AGE W+ K FA+G DIY  + ++ F+ P++K   +   R  GK+ ELALGY G   
Sbjct: 414 IAWYAGEMWRQKVFADGGDIYCASASQMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVG 473

Query: 447 VFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELV 506
             K M                                         A++  L       +
Sbjct: 474 ALKAMG----------------------------------------AIEMGLSEDELPPL 493

Query: 507 KKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSR 566
             AWR  +  +++ W D+       V+   + S+        L        + I LPS R
Sbjct: 494 VDAWRQTNPHIVKFWWDVDRAVMEAVKHKHTTSSYG------LTFSCRSGMLFITLPSGR 547

Query: 567 RLVYSDVKGDCSYLN---------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA 617
            L Y   K   +             AT +  R  +YG K  ENIVQA SRDILC  MK  
Sbjct: 548 NLAYVKPKVGTNKFGGECITYEGVGATKKWERLDSYGPKFVENIVQATSRDILCYAMKTL 607

Query: 618 TKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                +IV+ +HDE+V E    P+ S+  LC  M + P WA+GL L+A+GY    Y+K
Sbjct: 608 --RNCEIVMHIHDELVIEA--DPHMSLDVLCEQMGRTPPWARGLQLRADGYTTPFYKK 661


>gi|256617076|ref|ZP_05473922.1| DNA polymerase I [Enterococcus faecalis ATCC 4200]
 gi|257088361|ref|ZP_05582722.1| DNA polymerase I [Enterococcus faecalis D6]
 gi|256596603|gb|EEU15779.1| DNA polymerase I [Enterococcus faecalis ATCC 4200]
 gi|256996391|gb|EEU83693.1| DNA polymerase I [Enterococcus faecalis D6]
          Length = 645

 Score =  518 bits (1335), Expect = e-145,   Method: Composition-based stats.
 Identities = 208/700 (29%), Positives = 321/700 (45%), Gaps = 81/700 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIE+ S   + K G + Y+E     I L AY+ D +PV++ D  +   +P D++
Sbjct: 1   MKHLSIDIESFSSADISKCGAYKYSESSDFEILLFAYSVDGQPVEVVDLAQGETIPEDVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
           + L DETV+  A N+ FER+   + LG++  +  + W CT V A T GLP SL      L
Sbjct: 61  KSLSDETVIKHAFNANFERVCLSRFLGLNGFLNPRGWHCTMVWAATLGLPLSLAGVGAVL 120

Query: 117 NFSEHLTKMEEGKALIARFCKG---SIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
                  K+ EGK L+  FC     +  +         H +  W+ F  Y  RDVE    
Sbjct: 121 GL--DKQKLSEGKDLVRYFCMPCNATKVNQGRTRNLPRHSLDKWRDFVAYNIRDVEVEVA 178

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L   P++    + + LDQ INDRG  ID+ L      L    + +++E + KLT  
Sbjct: 179 IQQKLSNFPVTQEIWEEYWLDQEINDRGIEIDMILADSAVNLDEVSKNEINEQLKKLTGL 238

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
              +      +R +L    G+++  + +  +K ++  +N  +L K+++L R   + S++ 
Sbjct: 239 E--NPNSVLQMRSWLSQH-GLEVESLGKAAVKELIEQTNDDKL-KEVLLLRQQLAKSSVR 294

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +      D R RG  QFYGA+RTGR++G   Q QNLP+   S+    + +      
Sbjct: 295 KYQAMQNYACLDNRARGLFQFYGANRTGRFAGRGIQLQNLPQNHMSDLAEARELVRNGEY 354

Query: 351 E----TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           E       +   + S+ +R+  I   G K +V+D + IEARV+AW+AGE W+ + F NG 
Sbjct: 355 ELLALLYDNVPEVLSELIRTAFIPKPGMKFIVSDFSAIEARVIAWLAGEKWRKEVFRNGG 414

Query: 407 DIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           DIY  + ++ F  P++K   +   R  GK+ ELALGY G       M             
Sbjct: 415 DIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALTAMG------------ 462

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                                       A+   L     + +  +WR  +  + +LW D+
Sbjct: 463 ----------------------------ALNMGLTEDELQPLVASWRETNPAITKLWWDI 494

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTA- 583
                  V  G             +        + I L S RRL Y   +   +    A 
Sbjct: 495 DSAAKGCVSVGAKTET------HGITFEYKSGFMFIQLLSGRRLAYVKPRIGQNRFGGAA 548

Query: 584 --------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
                   T +  R  +YG K  ENIVQA++RDILC  M+N     Y IV  VHDE++ E
Sbjct: 549 VTYEGVGTTKKWERLESYGPKFVENIVQAMARDILCFAMQNL--KDYRIVGHVHDEVIIE 606

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            P     +V  + S+M++ P+WAKGL L A+GYE   Y+K
Sbjct: 607 VPKE--VTVEEVNSIMSQTPNWAKGLLLNADGYECDFYQK 644


>gi|315121967|ref|YP_004062456.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495369|gb|ADR51968.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 673

 Score =  518 bits (1335), Expect = e-145,   Method: Composition-based stats.
 Identities = 499/675 (73%), Positives = 564/675 (83%), Gaps = 2/675 (0%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           M KLFIDIETRSP+PLPKVGVWAYAE+A ITLCAYA +DE +KLWD T    MPSDLL++
Sbjct: 1   MPKLFIDIETRSPKPLPKVGVWAYAEEAKITLCAYAHNDETIKLWDCTANPVMPSDLLKH 60

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           L+D+TV+CVAHNSLFERILFKK+L I IP +RWICTS LAR NGLP+SLKNAC+AL F E
Sbjct: 61  LKDDTVVCVAHNSLFERILFKKSLNITIPPRRWICTSTLARINGLPASLKNACMALKFPE 120

Query: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180
            LTKMEEGKALIARFCKGSI+  PYD  RANHVQAWQLFGEYCKRDVEATREL+KRL PL
Sbjct: 121 TLTKMEEGKALIARFCKGSIEESPYDAKRANHVQAWQLFGEYCKRDVEATRELYKRLTPL 180

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
           S+ ER LWLLDQ INDRGY IDL+LV KLQELIA ER+KLDE++  LT G+I SSR+T  
Sbjct: 181 SENERHLWLLDQEINDRGYAIDLNLVKKLQELIAFEREKLDEELKTLTFGVIGSSRKTDL 240

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           L  YLFL  G+DL DM+E T+ + LS  NITQ AKD++ NRL+SS SAILKLNTLS AVS
Sbjct: 241 LNKYLFLYMGLDLPDMAESTIATALSQPNITQRAKDILNNRLSSSQSAILKLNTLSGAVS 300

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
            D RLRGTLQFYGASRTGRWSGCVFQPQNLPR   S E + + I++ N      DPL  A
Sbjct: 301 PDLRLRGTLQFYGASRTGRWSGCVFQPQNLPRPNTSHETIEEAIESSN--FPSDDPLRFA 358

Query: 361 SDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP 420
           SDCVRSCIIAS GKKLVVADLAGIEARVLAWIAGE WK+ AFANGEDIY T Y+KAFN P
Sbjct: 359 SDCVRSCIIASTGKKLVVADLAGIEARVLAWIAGEQWKLNAFANGEDIYKTAYSKAFNIP 418

Query: 421 IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAES 480
           +  V+K+QRAIGKVMELALGYQGGA+VF+TMAS+ GLDL+QFS+++K T+T +DWEQA+ 
Sbjct: 419 LSNVTKDQRAIGKVMELALGYQGGARVFQTMASNLGLDLKQFSKSIKQTATGDDWEQAQR 478

Query: 481 HHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISA 540
             LWMQ+ YPEFAV D  IGTACELVK AWRAKH+GV+QLWKD  E F CV+++G SISA
Sbjct: 479 RCLWMQETYPEFAVHDPFIGTACELVKTAWRAKHKGVVQLWKDCEEAFDCVIKDGRSISA 538

Query: 541 RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTEN 600
           RRVA VP L+M++  ++V I LPS+R+LVY DVK D SYLNTAT+Q+MRERTYGGKLTEN
Sbjct: 539 RRVAGVPPLLMKKQHQNVFITLPSNRKLVYRDVKSDRSYLNTATAQIMRERTYGGKLTEN 598

Query: 601 IVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKG 660
           IVQAISRDIL  GM NAT+ GYDIVLTVHDEIV ETPDTP FS   LC LMT+NP WAKG
Sbjct: 599 IVQAISRDILACGMINATRAGYDIVLTVHDEIVCETPDTPEFSSDELCFLMTQNPKWAKG 658

Query: 661 LPLKAEGYEAKRYRK 675
           LPLKAEGYEA RYRK
Sbjct: 659 LPLKAEGYEALRYRK 673


>gi|297587100|ref|ZP_06945745.1| DNA-directed DNA polymerase [Finegoldia magna ATCC 53516]
 gi|297575081|gb|EFH93800.1| DNA-directed DNA polymerase [Finegoldia magna ATCC 53516]
          Length = 643

 Score =  518 bits (1334), Expect = e-144,   Method: Composition-based stats.
 Identities = 219/698 (31%), Positives = 332/698 (47%), Gaps = 79/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M KL ID+ET S   L K GV+ YAE     I L AY+ +D  VK+ D      +P ++L
Sbjct: 1   MKKLSIDLETYSSVDLGKSGVYKYAESEDFEILLFAYSINDGEVKVIDLANGEIIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L DE V   A N+ FER+   + LG  +  + W CT + +   GLP SL+     L  
Sbjct: 61  SALSDENVEKWAFNANFERVCLSRFLGKRLKPQGWYCTMIWSAYLGLPLSLEKVGEVLKL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
                KM EGKALI  F   CK +  +       ++H ++ W  F EY +RDVE    + 
Sbjct: 121 --DKQKMNEGKALIRYFSTPCKPTKTNGMRIRNLSHHDLEKWSTFKEYNQRDVETEMAIK 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           K+L   P+S  E + + +DQ INDRG  ID  LV    +     R++  +  ++LT    
Sbjct: 179 KKLSAFPMSHSEWENYWIDQNINDRGILIDEVLVDSAIKFDGILREENMDRAIELTGLE- 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G+++  +++  ++S L ++      K+++  R   S S++ K 
Sbjct: 238 -NPNSPLQLKEWLNKK-GLEIDSLAKKDVESALKNTEGD--IKEVLELRQELSKSSVRKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           + +      D R RG +QFYGA+RTGR+SG + Q QNL R    +  L +++      ET
Sbjct: 294 DAMKNVKGKDNRARGLIQFYGANRTGRYSGRLIQVQNLRRNNLKDLDLARSLVKNRDYET 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                  P  + S  +R+  IA  G + +++D + IEARVLAW+AGE W + AF NGEDI
Sbjct: 354 MEILYESPSDILSQLIRTAFIAKEGTRFIISDFSAIEARVLAWLAGEQWVLDAFENGEDI 413

Query: 409 YVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  T ++ F  P++K   +   R  GK+  LA GYQG     K M               
Sbjct: 414 YCRTASRMFGVPVEKHGVNGHLRQKGKIATLACGYQGALGALKAMG-------------- 459

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                      ++  L     + +  +WR  +  ++ LW D+  
Sbjct: 460 --------------------------GIEMGLSEDELQSIVDSWREANPNIVSLWWDIDS 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT-- 584
               VV+       R       LV+   K  + I LPS RRL Y   K   +     +  
Sbjct: 494 VVKRVVK------TRTKEKYKSLVISYEKGILFIELPSKRRLAYPKAKIGTNRFGGESIV 547

Query: 585 -------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                  ++  +  +YGGK  ENIVQAI+RDIL E M    K G++IV+ +HDE+V E+ 
Sbjct: 548 YEGIVVGNKWDKIESYGGKFVENIVQAIARDILAEAMMRLEKKGFNIVMHIHDEVVIESD 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +       +  +M+  PSWA GL L A+G+E++ Y+K
Sbjct: 608 SSSIE---EINQIMSLVPSWAPGLILDADGFESEFYKK 642


>gi|227498331|ref|ZP_03928481.1| DNA polymerase I [Acidaminococcus sp. D21]
 gi|226903793|gb|EEH89711.1| DNA polymerase I [Acidaminococcus sp. D21]
          Length = 662

 Score =  518 bits (1333), Expect = e-144,   Method: Composition-based stats.
 Identities = 202/718 (28%), Positives = 297/718 (41%), Gaps = 100/718 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + IDIET S   L K GV+ YAE     I L  YA D   V++ D      +P D+L
Sbjct: 1   MKTISIDIETFSDVNLAKCGVYKYAESPAFEILLFGYAIDGGKVQVVDLARGERIPDDIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLG--------------------IDIPSKRWICTSV 98
             L DE+V   A N+ FER+   + L                       +    W C+ +
Sbjct: 61  DALTDESVTKWAFNASFERVCLSRYLRDLRISLDPFHDHHPLSRDCARFLNPAGWKCSMI 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPY----DCTRANHVQ 154
            +   GLP SL+ A   L       KM+EGK LI  FC    ++            +   
Sbjct: 121 WSAYMGLPLSLEGAGAVLKL--DSQKMKEGKDLIRYFCVPCKETKLNGGRTRNLPRHAPD 178

Query: 155 AWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQEL 212
            W LF  Y KRDVE    + +RL   P+ +   D + LDQ INDRG  ID  L      +
Sbjct: 179 KWTLFKSYNKRDVEVEMVIQERLKKYPVPEPIWDEYHLDQEINDRGIAIDRTLAENAIVI 238

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQ 272
            A+ R  L   +   T     +      +  +L    G+    + +  ++ +L  +    
Sbjct: 239 DARSRDSLMAVLKGKTGLE--NPNSVIQMIGWL-EQHGMKTDSLGKKQVQELLKTAEEP- 294

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
             + ++L R   + S++ K   +      D R RG  QFYGA+RTGR++G   Q QNLP+
Sbjct: 295 -LRSVLLLRQKLAKSSVKKYQAMEMTACEDSRARGMFQFYGANRTGRFAGRHIQLQNLPQ 353

Query: 333 QERSEEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARV 388
               +    + +      E           + S  +R+  +   G K VV+D + IEARV
Sbjct: 354 NHLPDLAEARELVRQGNYEALELLYDSIPDVLSQLIRTAFVPRKGMKFVVSDFSAIEARV 413

Query: 389 LAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAK 446
           L+W+AGE W++  FA   DIY  + +  F  P++K   +   R  GK+ ELALGY G   
Sbjct: 414 LSWLAGETWRLDVFARNGDIYCASASSMFGVPVEKHGVNGHLRQKGKIAELALGYGGSTG 473

Query: 447 VFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELV 506
             K M                                         A+   L       +
Sbjct: 474 ALKAMG----------------------------------------ALDMGLTENELYPL 493

Query: 507 KKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSR 566
            ++WR+ +  ++  W  +       ++E   + A        +        + I LPS R
Sbjct: 494 VQSWRSANPHIVDFWWQVDATVKTAIKEQIPMRA------GCIRFLCQSGMLFIQLPSGR 547

Query: 567 RLVYSDVKGDCSYLN---------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA 617
           RL Y   +   +             AT +  R  +YG K  ENIVQ ISRDILC  M+  
Sbjct: 548 RLSYVKPRIGENRFGGESVTYEGIGATKKWERLESYGPKFVENIVQGISRDILCYAMQTL 607

Query: 618 TKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                 IV  VHDE++ E       SV  +C  M + P WA+GL L+A+GYE + Y+K
Sbjct: 608 --RCCAIVGHVHDELIIECSRDA--SVDAICEQMGRTPPWAEGLLLRADGYECEFYQK 661


>gi|220930221|ref|YP_002507130.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
 gi|220000549|gb|ACL77150.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
          Length = 647

 Score =  517 bits (1332), Expect = e-144,   Method: Composition-based stats.
 Identities = 201/700 (28%), Positives = 311/700 (44%), Gaps = 82/700 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           ++ L +D+ET S   L K GV+ YAE     I L  Y+ D   V++ D      +P +++
Sbjct: 4   INSLSLDLETYSSVNLQKSGVYRYAESDDFEILLFGYSVDSGEVQVVDLAGGEEIPDEII 63

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D++V   A N++FER+   K L +   +    W C+ V +   GLP SL+     L
Sbjct: 64  NALMDDSVTKWAFNAMFERVCLSKWLNLTEYLDPASWKCSMVWSAYMGLPLSLEGVGAVL 123

Query: 117 NFSEHLTKMEEGKALIARFCKG----SIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRE 172
                  K+ EGK LI  FC        +         + +  W+ F  Y  RDVE+   
Sbjct: 124 GLE--KQKLTEGKDLIKYFCTPCSPTKSNGGRVRNLPEHDMDKWERFKVYNIRDVESEML 181

Query: 173 LFKRLIPL--SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + +RL      +     + LDQ INDRG  ID+  V +  E+    R+KL   +  +T+ 
Sbjct: 182 IQQRLSKFQVPENIWKEYHLDQVINDRGIAIDMTFVKQAVEMDEHSREKLIALMQDITNL 241

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
              +      ++ +L    G++   + +  +  +L  +   +    ++  R   + S++ 
Sbjct: 242 E--NPNSVQQMKDWLAD-NGLETDSLGKKVVAEMLKTA--PEPLGTVLELRQQLAKSSVK 296

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  AV SDGR RG  QFYGA+RTGR+SG + Q QNLP+    +    + +      
Sbjct: 297 KYTAMENAVCSDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPDLEQARALVRSGNF 356

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +           + S+ +R+  I   G K +VAD + IEARV+AW+AGE W++  F  G 
Sbjct: 357 DALTLLYDSIPEVLSELIRTAFIPREGMKFIVADFSAIEARVIAWLAGEKWRLNVFQKGG 416

Query: 407 DIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           DIY  + ++ FN P++K   +   R  GK+ ELALGY G     K+M             
Sbjct: 417 DIYCASASQMFNVPVEKHGVNGHLRQKGKIAELALGYGGAVGALKSMG------------ 464

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                                       A++  +     + +  AWR  +  + +LW D+
Sbjct: 465 ----------------------------ALEMGIEEEELQPLVTAWRQSNPNITKLWWDV 496

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT-- 582
                  V++    +         +        + IVLPS RRL Y   +   +   +  
Sbjct: 497 DRAVKTCVKQKTPTAT------HGIKFIYQSGMLFIVLPSGRRLAYVKPRMGENMFGSES 550

Query: 583 -------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
                   T +  R  +YG K  ENIVQAISRDILC  M+        IV  VHDEI+ E
Sbjct: 551 VTYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQTL--KNCSIVAHVHDEIIIE 608

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                  S+  +C  M K P+WA GL L A+GYE + Y+K
Sbjct: 609 ADMG--MSLSAICEQMAKTPTWANGLLLSADGYECQFYQK 646


>gi|300909419|ref|ZP_07126880.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
 gi|300893284|gb|EFK86643.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
          Length = 644

 Score =  516 bits (1330), Expect = e-144,   Method: Composition-based stats.
 Identities = 192/698 (27%), Positives = 300/698 (42%), Gaps = 78/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +L IDIET S   L + G + YA+     + L  YA D  PVK+ D T+   +PS ++
Sbjct: 1   MKQLSIDIETYSSTNLNQTGGYRYADSDDFELLLFGYAVDFGPVKVVDLTQGEKIPSQII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           Q L D  ++  A N+ FER+   + +G  +    W C+ V + T GLP SL++    L  
Sbjct: 61  QALDDPAIIKSAFNAQFERVCLSRFVGHRLKPAGWHCSRVWSATLGLPLSLRDVGTVLGL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTR-ANHVQAWQLFGEYCKRDVEATRELF 174
                    GK L+  F   CK +  +         +    WQ F +Y +RDVE   E+ 
Sbjct: 121 PRQKI--TAGKELVRYFCTSCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEIT 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           ++    P+   E + + +DQ INDRG RID  LV    +   +   +  +         +
Sbjct: 179 QKFSRFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQKEFHAQYLQ--TSQQLTGL 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G++   +++ ++  +L  +  T     ++  R   S S++ K 
Sbjct: 237 ANPNSPLQLKNWLHQ-QGVETDSLAKASVAQLLQTTTGT--VHQVLALRQLLSKSSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             + +A+  DG + G LQFYGA+RTGRW+G + Q QNLPR    +    + +        
Sbjct: 294 QAMQKAMCKDGCVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARALVKQGNTTA 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  I S G    VAD + +EARV+AW++GE+W+  AFA  EDI
Sbjct: 354 LAMLYESVPDVLSQLIRTAFIPSKGHHFYVADFSAVEARVIAWLSGEEWRQAAFAKNEDI 413

Query: 409 YVTTYAKAFNTP--IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F  P     ++ E R  GK+ ELALGY G     K M +             
Sbjct: 414 YCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATK----------- 462

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                          L       + + WR     ++Q W D+ +
Sbjct: 463 -----------------------------LGLTDDELPPLVQMWRNASPHIVQFWWDVDK 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYL------ 580
                ++     +         +        + + L S R L Y   K   +        
Sbjct: 494 AAKECIKTHLPQTT------HGMKFIYRSGCMFLRLRSGRYLCYPQPKIGINRFGSESIT 547

Query: 581 ---NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
              N    +  R  TYG KL ENIVQA SRD+L   M+     G  +V+ +HDE V + P
Sbjct: 548 FMGNNTVKKWDRIETYGAKLVENIVQATSRDLLAGAMRRLETAGNPVVMHIHDEAVIDAP 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                S+ T+  +MT+ P WA GL L A G+    Y+K
Sbjct: 608 TDR--SLDTIVKIMTEVPDWADGLILNAAGFVGGFYKK 643


>gi|293400006|ref|ZP_06644152.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306406|gb|EFE47649.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 651

 Score =  516 bits (1330), Expect = e-144,   Method: Composition-based stats.
 Identities = 211/696 (30%), Positives = 332/696 (47%), Gaps = 76/696 (10%)

Query: 9   ETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRDETV 66
           ET S   L   GV+ Y E     I L AYA DDEPVK+ D      +PS++L  + +  +
Sbjct: 2   ETYSSVDLISCGVYKYVESEDFEILLFAYAVDDEPVKVVDLACGEKIPSEVLDLIDEPAI 61

Query: 67  MCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLTKME 126
           +  AHN++FER+   + LG  + + +W C+ + A   GLP+SLK+    L  SE   KM 
Sbjct: 62  IKYAHNAVFERLCLSRYLGTQLDTDQWHCSMIHAMMLGLPASLKDVGAVLGLSEDKQKMR 121

Query: 127 EGKALIARFCKGSI----DSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IPL 180
            GK LI+ FCK       +      T A+  + WQLF +YC RDVE  RE+  +L   P+
Sbjct: 122 IGKTLISYFCKPCKPTRVNGQRSRNTPADAPEKWQLFKDYCHRDVETEREISNKLDKFPI 181

Query: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240
              E +LW  DQ +ND G RID+++V  +     +  ++L  +  ++T+G     ++   
Sbjct: 182 PASEHELWCWDQKMNDHGARIDMEMVHTVLVFGHRYDEELINECERITNG--IGPKKIAQ 239

Query: 241 LRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVS 300
           L+ ++       +  + +  +  +L  S+I+   + ++  R  S  ++I K   +  +V 
Sbjct: 240 LKEWICRKEDRSIESLDKDAVIELLKDSSISPETRRVLQIRQESGKTSITKYAAIQRSVC 299

Query: 301 SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLA 360
           +D RL G LQFYGA+RTGRW+G +FQPQNLPR   ++  L + +      E++    G  
Sbjct: 300 NDQRLHGFLQFYGANRTGRWAGRIFQPQNLPRNAFNDIELARKLVKEKDFESLDMLYGSY 359

Query: 361 SD----CVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKA 416
           +      +R+ +I  NG    +AD + IEAR+ AW   E+W+ + FA    IY  + A+ 
Sbjct: 360 NQVFSTLIRTAVIPPNGHMFAIADYSAIEARLTAWFCNEEWRQEVFATTGKIYEASAAQM 419

Query: 417 FNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFED 474
           F+ PI+ V+K  + R  GKV ELALGY GG    + M                       
Sbjct: 420 FHVPIESVTKGSDLRKKGKVAELALGYGGGVSALERMG---------------------- 457

Query: 475 WEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQE 534
                                  L     + +   WR     + ++W  + +     V+E
Sbjct: 458 ------------------GADMGLSEDEMQDIVNKWRLASPNIKKMWYRVQDAAYTAVRE 499

Query: 535 GGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-------GDCSYLNTA---- 583
                 +RV+ V  +        +   LPS RRL Y   K        + +Y        
Sbjct: 500 -----RKRVSVVHGVRYFYSSGILFAELPSGRRLAYVRPKLKKGRYGDELTYEGYGSDQD 554

Query: 584 ---TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTP 640
              T +  R++T+GGKL EN++QAI+RD L + M      GY I++ +HDE+V E P   
Sbjct: 555 GKQTKKWCRQKTWGGKLFENLIQAIARDCLAKAMLKLDDVGYKIIMHIHDEVVVEVPSET 614

Query: 641 YFS-VGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             S +  +  +M +   WA GL L A+G+ ++ YRK
Sbjct: 615 AESCLIDIERIMGEPIPWAPGLILTADGFISEYYRK 650


>gi|57233569|ref|YP_180826.1| family A DNA-dependent DNA polymerase [Dehalococcoides ethenogenes
           195]
 gi|57224017|gb|AAW39074.1| DNA-dependent DNA polymerase, family A [Dehalococcoides ethenogenes
           195]
          Length = 646

 Score =  516 bits (1329), Expect = e-144,   Method: Composition-based stats.
 Identities = 208/702 (29%), Positives = 311/702 (44%), Gaps = 84/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y E     I L  Y+ D   V++ D T    +PSD++
Sbjct: 1   MKSLSIDIETYSSANLAKSGVYRYVESPDFEILLFGYSVDGGEVQVVDLTSGEKLPSDVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L DETV+  A N+ FERI   + LG+     I    W C+ V A T GLP SL+    
Sbjct: 61  TALTDETVIKWAFNANFERICLSRFLGLPTGKYINPASWKCSMVWAATMGLPLSLEGVGS 120

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCT----RANHVQAWQLFGEYCKRDVEAT 170
            L       K+ EGK LI  F +    +            +    W  F +Y  RD+E  
Sbjct: 121 VLKL--DKQKLTEGKDLIKYFSQPCAPTKSNGQRTRNHLYHAPDKWSAFKKYNIRDIETE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
             + ++L   P+ D   D + LDQ INDRG  +D+ LV +   +  + R +L        
Sbjct: 179 MSIQEKLTRFPVQDSIWDEYHLDQEINDRGVALDMTLVQEAIAMDGRSRSELTT--AMKH 236

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
              + +      ++ +L    G++   + +  +  +L  + +     D++  R   + S+
Sbjct: 237 LTELDNPNSVQQMKQWLAD-NGMETDTLGKKIVAELLKTAPLD--LADVLSLRQQLAKSS 293

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   +  AV +DGR RG  QF+GA+RTGRW+G + Q QNLP+    +    + +    
Sbjct: 294 VRKYQAMENAVCTDGRARGMFQFFGANRTGRWAGRLIQMQNLPQNHLEDLAEARALVRFG 353

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             +       D     S  +R+  +   G +L+V+D + IEARV+AW+AGE+W+   FA 
Sbjct: 354 DFDALEMLYEDVPDTLSQLIRTAFVPKAGARLIVSDFSAIEARVIAWMAGEEWRQDVFAK 413

Query: 405 GEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G DIY  + ++ F  P++K   +   R  GK+ ELALGY G     K M           
Sbjct: 414 GGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMG---------- 463

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A+   L       +  AWR  +  +++ W 
Sbjct: 464 ------------------------------ALDMGLEEDELPQLVDAWRQANPCIVKFWW 493

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT 582
           D+ +           +  +R  +   +        + I LPS RRL Y   +   +    
Sbjct: 494 DVDKAAMEA------VRYKRTNSTHGITFSCQSGMLFITLPSGRRLAYVKPRIGENKFGG 547

Query: 583 ---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                    AT +  R  +YG K  ENIVQA +RDILC  M+        IV+ VHDEIV
Sbjct: 548 QCITYEGVGATKKWERLDSYGPKFVENIVQATARDILCNAMQTLQH--CSIVMHVHDEIV 605

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E    P  S+  +C  M + PSWAKGL L+A+GYE   Y+K
Sbjct: 606 IEA--DPRMSLKAVCEQMGRTPSWAKGLLLRADGYETDFYKK 645


>gi|116630096|ref|YP_815268.1| DNA polymerase I [Lactobacillus gasseri ATCC 33323]
 gi|238854131|ref|ZP_04644478.1| DNA polymerase [Lactobacillus gasseri 202-4]
 gi|116095678|gb|ABJ60830.1| DNA polymerase I - 3'-5' exonuclease and polymerase domain
           [Lactobacillus gasseri ATCC 33323]
 gi|238833207|gb|EEQ25497.1| DNA polymerase [Lactobacillus gasseri 202-4]
          Length = 644

 Score =  516 bits (1328), Expect = e-144,   Method: Composition-based stats.
 Identities = 200/698 (28%), Positives = 312/698 (44%), Gaps = 78/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M ++ IDIET S   L + GV+ YA+     + L  YA D  PVK+ D T+   +P  ++
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYATDLGPVKVVDLTQGEKIPQPIV 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D T++  A N+ FER+   + +G  +    W C+ V + T GLP SL +    L  
Sbjct: 61  KALDDPTIIKSAFNAQFERVCLSRFVGHRLKPAGWHCSRVWSATLGLPLSLSDVGTVLGL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTR-ANHVQAWQLFGEYCKRDVEATRELF 174
                    GK L+  F   CK +  +         +    WQ F +Y +RDVE   E+ 
Sbjct: 121 PRQKI--TAGKELVRYFCTPCKPTKSNQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEIT 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           ++L   P+S  E + + +DQ INDRG RID  LV    +       +  +   KLT   +
Sbjct: 179 QKLERFPVSQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQENFHDQYLQVSQKLTG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G+++  +S+ ++  +L  +        ++  R   S S++ K 
Sbjct: 237 ANPNSPLQLKDWLNQR-GMNIDSLSKASVAQLLQTTTGK--VHQVLSLRQLLSKSSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNR--- 349
             + +A+  DGR+ G LQFYGA+RTGRW+G + Q QNLPR    +    + +        
Sbjct: 294 QAMQKAMCRDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNTTA 353

Query: 350 -GETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  I S G    VAD + +EARV+AW++GE+W+ KAFAN EDI
Sbjct: 354 LSMLYDSVPDVLSQLIRTAFIPSQGHHFYVADFSAVEARVIAWLSGEEWRQKAFANNEDI 413

Query: 409 YVTTYAKAFNTP--IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F  P     V+ E R  GK+ ELALGY G     K M +             
Sbjct: 414 YCASASQMFGVPVVKHGVNGELRQKGKIAELALGYGGSIGALKAMGATN----------- 462

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                          L       + + WR     ++Q W D+ +
Sbjct: 463 -----------------------------LGLTEEELHSLVQMWRNASPHIVQFWWDIDK 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT-- 584
                ++     +         +        + + L S R+L YS  K   +   + +  
Sbjct: 494 AAKECIKSHLPQAT------HGIKFIYRSGCMFLRLRSGRKLCYSKPKIGINRFGSESIT 547

Query: 585 -------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                   +  R  TYG KL ENIVQA SRD+L E M+     G  +V+ +HDE V + P
Sbjct: 548 FMGINAVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEDAGNPVVMHIHDEAVIDAP 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               +S+  +  +MT+ P WA GL L A G+ +  Y+K
Sbjct: 608 AN--YSLEKMVKIMTEVPRWADGLILNAAGFVSDFYKK 643


>gi|308174986|ref|YP_003921691.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           DSM 7]
 gi|307607850|emb|CBI44221.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           DSM 7]
          Length = 648

 Score =  516 bits (1328), Expect = e-144,   Method: Composition-based stats.
 Identities = 224/699 (32%), Positives = 329/699 (47%), Gaps = 76/699 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+AY E     I L AYA+D+EP+K+ D  +  A+P ++L
Sbjct: 1   MKTLSIDIETFSSVDLLKCGVYAYTEASDFEILLFAYAFDEEPIKVIDLAQGEALPHEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L    V+  A+N+ FER    K     +P  +W CT+V A T GLP +L     AL  
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNTMLPPTQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
           SE   K +EGKALI  F   CK +  +         H    W+ F  YC +DVE  R + 
Sbjct: 121 SEQ--KDKEGKALIRYFSVPCKPTKANGQRVRNLPEHAPDKWEKFKTYCGQDVEVERSIK 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            R+        E++LW LDQ INDRG RID DLV        Q +  L  +  +LT   +
Sbjct: 179 NRISKFEPLKAEQELWALDQDINDRGVRIDADLVKHAIACDEQYQAGLMVEAKELTG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +   T  L+ +L    G+ +  +++  ++ ++  ++   + + L L R   + +++ K 
Sbjct: 237 PNPNSTAQLKKWLEDK-GLSVSSLAKDKIEELIEKTDDASVHRVLRL-RQEMAKTSVKKY 294

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             + +A+  D R+RG LQFYGASRTGRW+G + Q QNLP+ + ++    +T+      E 
Sbjct: 295 LAMEKALCPDSRVRGLLQFYGASRTGRWAGRLVQVQNLPQNKIADLDTARTLLKGGHYEA 354

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  VR+  I S G +  V+D + IEARV+AW+AGE W++  F     I
Sbjct: 355 IELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEGWRLDVFNTHGKI 414

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + A+ F  P++ ++K    R  GKV ELALGYQGG      M               
Sbjct: 415 YEASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMG-------------- 460

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   L       + KAWR  ++ ++Q W D+  
Sbjct: 461 --------------------------ALTMGLDEDELPGLVKAWRTANKKIVQFWYDVEA 494

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC--------- 577
                V+E   +  +       L        + + LPS RRL Y+  K +          
Sbjct: 495 AAVKAVKERKPVKIQ-----HGLTFLCESGILFVQLPSGRRLAYAKPKLEIDDRFGKEAL 549

Query: 578 SYLNT-ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
           +Y     + +  R  TYGGKL ENIVQA++RD L   +      GY  V+ VHDE V + 
Sbjct: 550 TYEGKLESGKWGRLNTYGGKLVENIVQAVARDCLAVTLIRLDDAGYKTVMHVHDETVLDV 609

Query: 637 PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           P      +  + S+M +   WAKGLPL A+G+    Y+K
Sbjct: 610 PRGKNE-LDKVESIMGEPIPWAKGLPLTADGFITDYYKK 647


>gi|295114921|emb|CBL35768.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [butyrate-producing bacterium SM4/1]
          Length = 646

 Score =  514 bits (1324), Expect = e-143,   Method: Composition-based stats.
 Identities = 208/702 (29%), Positives = 309/702 (44%), Gaps = 84/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L ID+ET S QPL K GV+ Y E     I L AY+ D  PV+  D      +PS++L
Sbjct: 1   MQTLSIDLETYSDQPLAKTGVYRYVESPDFEILLFAYSVDGAPVQQIDLACGEKIPSEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D+ V   A N+ FERI   + LG      +    W C+ V A   GLP SL+ A  
Sbjct: 61  CALEDDKVTKWAFNANFERICLSRFLGYPTGDYLEPDSWKCSMVWAAYMGLPLSLEGAGA 120

Query: 115 ALNFSEHLTKMEEGKALIARFCK---GSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEAT 170
            L       K+ EGK LI  FC+    +  +         H    W  F +Y  RDVE  
Sbjct: 121 VLGLE--KQKLAEGKDLIKYFCQPCAPTKSNGQRTRNLPKHSPDKWLAFKKYNIRDVETE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
             +  RL   P+ D   + + LDQ INDRG  +D++LV +  ++  + R +L + + +LT
Sbjct: 179 MSIQARLLKYPVPDSVWEEYHLDQEINDRGVGLDMELVRQAIQMDGRSRSELTQAMKELT 238

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
              + +      ++ +L    G++   + +  +  +L  +   Q  + ++  R   + S+
Sbjct: 239 S--LDNPNSVQQMKQWLAD-NGVETDTLGKKAVAELLKTA--PQQLQKVLTLRQQLAKSS 293

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   +  AV +DGR RG  QFYGA+RTGRW+G + Q QNLP+    +    + +    
Sbjct: 294 VKKYQAMETAVCADGRARGMFQFYGANRTGRWAGRIIQMQNLPQNHLDDLTEARGLVRAG 353

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             +       D     S  +R+  +    +K +VAD + IEARV+AW+A E W+   FA 
Sbjct: 354 GFDALEMLYEDVPDTLSQLIRTAFVPQGNRKFIVADFSAIEARVIAWLADEKWRQDVFAE 413

Query: 405 GEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G+DIY  + ++ F  P++K   +   R  GK+ ELALGY G     K M           
Sbjct: 414 GKDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMG---------- 463

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A++  L       +  AWR  +  ++Q W 
Sbjct: 464 ------------------------------ALEMGLSEDELPALVSAWRQANPKIVQFWW 493

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN- 581
            +       V    +           ++       + I LPS R L Y   K   +    
Sbjct: 494 AVDRAVMDAVTRKTTTKT------HGIIFSARNGMLFITLPSGRSLSYVKPKIGENRFGG 547

Query: 582 --------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                     T +  R  +YG K  ENIVQA SRDILC  MK        IV+ +HDE+V
Sbjct: 548 DCITYEGVGGTKKWERIDSYGPKFVENIVQATSRDILCYAMKTL--RCCSIVMHIHDEVV 605

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E       S+  +C  M + P WA GL L+A+GYE   Y+K
Sbjct: 606 IEA--DRRMSLQAVCDQMGRTPPWANGLQLRADGYETDFYKK 645


>gi|317132759|ref|YP_004092073.1| DNA-directed DNA polymerase [Ethanoligenens harbinense YUAN-3]
 gi|315470738|gb|ADU27342.1| DNA-directed DNA polymerase [Ethanoligenens harbinense YUAN-3]
          Length = 662

 Score =  514 bits (1324), Expect = e-143,   Method: Composition-based stats.
 Identities = 222/718 (30%), Positives = 324/718 (45%), Gaps = 100/718 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + IDIET S   L K GV+ Y       I L  Y+ D  PVK+ D      +P D+L
Sbjct: 1   MKTISIDIETFSDVDLGKCGVYRYCSSPAFEILLFGYSVDGGPVKVVDLACGEKIPEDIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL-----GID---------------IPSKRWICTSV 98
             L D+TV+  A N+ FER+   + L     G+D               +  + W C+ V
Sbjct: 61  DALTDDTVLKWAFNANFERVCLSRYLRDMGRGLDPFHDNHPLSLEHARFLNPEGWRCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQ 154
            A T GLP SLK     L  ++   KM+EGKALI  F   C  +  +        ++   
Sbjct: 121 WAATMGLPLSLKGVGAVLQLADQ--KMDEGKALIKYFSVPCAPTKANGGRTRNLPSDDPG 178

Query: 155 AWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQEL 212
            W  F +Y +RDVE    + ++L   P+ D   D + +DQ INDRG RID+DLV K  ++
Sbjct: 179 KWATFKKYNQRDVEVEMMIQRKLRSFPVPDFVWDEYHIDQEINDRGVRIDMDLVEKAIDM 238

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQ 272
             + R +L E +  +T+    +      ++ +L    G+++  + +  + ++L  +    
Sbjct: 239 DTRSRSELTEKMQAITNLE--NPNSVQQMKQWLSD-NGMEVDSLGKKAVTALLKTA--PP 293

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++  R   + S++ K  T+  AV SD R RG   FYGA+RTGRW+G + Q QNLP+
Sbjct: 294 ELTEVLELRQQLAKSSVKKYQTMQRAVCSDSRARGMFMFYGANRTGRWAGRLIQLQNLPQ 353

Query: 333 QERSEEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARV 388
               +    + +      E       D     S  +R+  I  +G +  VAD + IEARV
Sbjct: 354 NHLPDLDAARALVKSGDYEAVKMIYEDVPDTLSQLIRTAFIPKDGCRFYVADFSAIEARV 413

Query: 389 LAWIAGEDWKIKAFANGEDIYVTTYAKAFNTP--IDKVSKEQRAIGKVMELALGYQGGAK 446
           +AW AGE WK  AFANGEDIY +T  + F+ P     V+ E RA GK+ ELA GY G   
Sbjct: 414 IAWYAGEKWKSDAFANGEDIYCSTARRMFHKPVVKHGVNGELRAKGKIAELACGYGGSTG 473

Query: 447 VFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELV 506
             K M                                         A++  L       +
Sbjct: 474 ALKAMG----------------------------------------ALEMGLSEDELPDI 493

Query: 507 KKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSR 566
             +WR  +Q +++ W D+ +     V+   +    R      L        + I LPS R
Sbjct: 494 VSSWRDANQQIVKFWWDVDKAVMAAVKNHKTTRLGR------LAFFWQAGMLFITLPSGR 547

Query: 567 RLVYSDVKGDCSYLN---------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA 617
            L Y   K   +              T +  R  +YG K  ENIVQA SRDILC  MK  
Sbjct: 548 NLAYVKPKVGMNRFGGECITYEGVGGTKKWERLESYGPKFVENIVQATSRDILCNSMKML 607

Query: 618 TKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                D+ + +HDE+V E    P  S+ TLC  M + P+WA GL L+A+GY    Y+K
Sbjct: 608 --RHCDVCMHIHDELVIEA--DPRVSLDTLCEQMGRVPAWADGLVLRADGYVCDFYKK 661


>gi|328913309|gb|AEB64905.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           LL3]
          Length = 648

 Score =  514 bits (1324), Expect = e-143,   Method: Composition-based stats.
 Identities = 223/699 (31%), Positives = 330/699 (47%), Gaps = 76/699 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+AY E     I L AYA+D+EP+K+ D  +  A+P +++
Sbjct: 1   MKTLSIDIETFSSVDLLKCGVYAYTEAPDFEILLFAYAFDEEPIKVIDLAQGEALPHEVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L    V+  A+N+ FER    K     +P  +W CT+V A T GLP +L     AL  
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNTMLPPTQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
           SE   K +EGKALI  F   CK +  +         H    W+ F  YC +DVE  R + 
Sbjct: 121 SEQ--KDKEGKALIRYFSVPCKPTKANGQRVRNLPEHAPDKWEKFKAYCGQDVEVERSIK 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            R+    L   E++LW LDQ INDRG RID DLV        Q +  L  +  +LT   +
Sbjct: 179 NRISKFELLKAEQELWALDQDINDRGVRIDADLVKHAIACDEQYQAGLMVEAKELTG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +   T  L+ +L    G+ +  +++  ++ ++  ++   + + L L R   + +++ K 
Sbjct: 237 PNPNSTAQLKTWLEDK-GLSVSSLAKDKIEELIEKTDDASVHRVLRL-RQEMAKTSVKKY 294

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             + +A+  D R+RG LQFYGASRTGRW+G + Q QNLP+ + ++    +T+      E 
Sbjct: 295 LAMEKALCPDSRVRGLLQFYGASRTGRWAGRLVQVQNLPQNKIADLDTARTLLKGGHYEA 354

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  VR+  I S G +  V+D + IEARV+AW+AGE W++  F     I
Sbjct: 355 IELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEGWRLDVFNTHGKI 414

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + A+ F  P++ ++K    R  GKV ELALGYQGG      M               
Sbjct: 415 YEASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMG-------------- 460

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   L       + KAWR  ++ ++Q W D+  
Sbjct: 461 --------------------------ALTMGLDEDELPGLVKAWRTANKKIVQFWYDVEA 494

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC--------- 577
                V+E   +  +       L        + + LPS RRL Y+  K +          
Sbjct: 495 AAVKAVKERKPVKIQ-----HGLTFLCESGILFVQLPSGRRLAYAKPKLEIDDRFGKEAL 549

Query: 578 SYLNT-ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
           +Y     + +  R  TYGGKL ENIVQA++RD L   +      GY  V+ VHDE V + 
Sbjct: 550 TYEGKLESGKWGRLNTYGGKLVENIVQAVARDCLAVTLIRLDDAGYKTVMHVHDEAVLDV 609

Query: 637 PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           P      +  + ++M +   WAKGLPL A+G+    Y+K
Sbjct: 610 PRGKNE-LDKVEAIMGEPIPWAKGLPLTADGFITDYYKK 647


>gi|118852|sp|P06225|DPOL_BPSP2 RecName: Full=DNA polymerase
 gi|216151|gb|AAA32600.1| DNA polymerase (gene L; ttg start codon) [Bacillus phage SPO2]
 gi|579197|emb|CAA25691.1| unnamed protein product [Bacillus phage SPO2]
          Length = 648

 Score =  514 bits (1323), Expect = e-143,   Method: Composition-based stats.
 Identities = 218/699 (31%), Positives = 325/699 (46%), Gaps = 76/699 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+AY E     I L AYA+DD+PVK+ D  +   +P ++L
Sbjct: 1   MKTLSIDIETFSSVDLLKAGVYAYTEAPDFEILLFAYAFDDDPVKIIDLAQGDTLPHEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L    V+  A+N+ FER    K   + +   +W CT+V A T GLP +L     AL  
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNLMLLPAQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPP----YDCTRANHVQAWQLFGEYCKRDVEATRELF 174
           S    K + GKALI  F      +            +  + W+ F  YC +DVE  R + 
Sbjct: 121 SAQ--KDKAGKALIRYFSVPCKPTKANGQRVRNLPEHDPEKWEKFKVYCIQDVEVERAIK 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            R+      + E  LW LDQ INDRG RID+DLV        Q +  L  +  KLT   +
Sbjct: 179 NRISKFEPLESEHKLWALDQEINDRGVRIDVDLVKHAIACDEQYQAGLIAEAKKLTG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +   T  L+ +L    G+ +  +++  ++ ++ ++N   + + L L R   + +++ K 
Sbjct: 237 PNPNSTAQLKKWLEEK-GLTISSLAKDKIEELIENTNDETVHRVLRL-RQEMAKTSVKKY 294

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             + +A+  D R+RG LQFYGASRTGRW+G + Q QNLP+ +  +    + +      E 
Sbjct: 295 LAMEKALCPDNRVRGLLQFYGASRTGRWAGRLVQVQNLPQNKIEDLDTARNLLKGGHYEA 354

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  VR+  I S G +  V+D + IEARV+AW+AGE+W+++ F     I
Sbjct: 355 IELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEEWRLEVFNTHGKI 414

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + A+ F  P++ ++K    R  GKV ELALGYQGG      M               
Sbjct: 415 YEASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMG-------------- 460

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   L       + KAWR  ++ +++ W D+  
Sbjct: 461 --------------------------ALNMGLAEGELPELVKAWRTANKKIVKFWYDVEA 494

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD---------C 577
                V+E   +  +       L        + + LPS RRL Y+  K +          
Sbjct: 495 AAIKAVKERKPVKLQ-----HGLTFLYESGILFVQLPSGRRLAYAKPKLELDERFGKEAL 549

Query: 578 SYLNT-ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
           +Y     + +  R  TYGGKL ENIVQA +RD L   +      GY  V+ VHDE V + 
Sbjct: 550 TYEGKLESGKWGRLNTYGGKLVENIVQATARDCLAITLMRLDNAGYKTVMHVHDEAVLDV 609

Query: 637 PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           P      +  + ++M +  SWAKGLPL A+G+    Y+K
Sbjct: 610 PRGKNE-LDKVEAIMGEPISWAKGLPLTADGFVTDYYKK 647


>gi|212712317|ref|ZP_03320445.1| hypothetical protein PROVALCAL_03405 [Providencia alcalifaciens DSM
           30120]
 gi|212685063|gb|EEB44591.1| hypothetical protein PROVALCAL_03405 [Providencia alcalifaciens DSM
           30120]
          Length = 685

 Score =  514 bits (1323), Expect = e-143,   Method: Composition-based stats.
 Identities = 269/692 (38%), Positives = 373/692 (53%), Gaps = 25/692 (3%)

Query: 1   MS-KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQ 59
           M   L++D+ET S +P+ K G  +YAE   I L A+A ++  V++WD T++S +P++L Q
Sbjct: 1   MKNTLWLDLETFSEKPI-KYGTHSYAETVEIMLFAWALNNNLVQVWDVTDKSPIPTELKQ 59

Query: 60  YLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFS 119
            L D   +  AHNS F+R +     GI I   RW  T V A  +GLP +L   C  L   
Sbjct: 60  ALSDPNTIIYAHNSHFDRTML-NHSGIKIDVSRWRDTMVQALAHGLPGALGALCEVLGVP 118

Query: 120 EHLTKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL- 177
               K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE+ KRL 
Sbjct: 119 LDKAKDKEGKALIQLFCKPRPKNSALRRATSKTHPEEWKRFVAYAGLDIEAMREVHKRLP 178

Query: 178 -IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
                D E + W  DQ INDRG  +D+ L     E +  E+K+L +    LTD  ++++ 
Sbjct: 179 SWNYCDNELEHWHRDQRINDRGVYMDIQLATAAIEAVEIEQKRLAKLTQDLTDNEVQAAT 238

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  ++    G+DL DM + TL+  ++  +I    ++L+  RL SS ++  K   L 
Sbjct: 239 QRDALLQHISAAFGVDLPDMQKSTLERRINDPDIPLPLRELLAIRLQSSTTSTSKYKALM 298

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---I 353
             VSSDGRLRGTLQF GASRTGRW+G +FQPQNLPR    +  + + I+AL  G      
Sbjct: 299 NGVSSDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPTLDQNTIDKGIEALKAGCADLIY 358

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI----- 408
            D + L S  +R CI+A  GKKLVV+DL+ IE R+LAW+AGE WKI AF+  +       
Sbjct: 359 DDIMQLTSSTLRGCIMAPEGKKLVVSDLSNIEGRMLAWLAGEAWKITAFSEFDKGIGADL 418

Query: 409 YVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKS 468
           Y   YA+AFN   + V K  R IGKVMEL LGY GG   F T A    LDL + ++    
Sbjct: 419 YKLAYARAFNISPEDVDKHMRQIGKVMELGLGYGGGVAAFLTFALTYSLDLDELAEAALP 478

Query: 469 TSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGF 528
               +    A S +    +    + + + +  T C+ +K+ WR  H   +  W +L +  
Sbjct: 479 NIPPKVKHDALSWYQKSVETKKTYGLSETVFIT-CDSLKRMWRNAHPETVSFWYELEDTV 537

Query: 529 ACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYL-----NTA 583
              +   G     R     +L +RR K  + IVLPS R + Y   + D   +     N  
Sbjct: 538 RHAISSPGITFPCR-----KLKVRRDKAWLRIVLPSGRAVCYPSPRNDNGQISYMGVNPY 592

Query: 584 TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFS 643
           + +  R +TYGGKL EN+ QA +RD+L   M     +GYDIVLTVHDE+++E PD P F+
Sbjct: 593 SRKWQRLKTYGGKLVENVTQAAARDVLAGNMPTIEDHGYDIVLTVHDEVLTEAPDNPAFN 652

Query: 644 VGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
              L  L+  NP WA  LPL A G+EA  YRK
Sbjct: 653 HEHLSELLATNPEWALDLPLSAGGFEAYHYRK 684


>gi|167761124|ref|ZP_02433251.1| hypothetical protein CLOSCI_03522 [Clostridium scindens ATCC 35704]
 gi|167661243|gb|EDS05373.1| hypothetical protein CLOSCI_03522 [Clostridium scindens ATCC 35704]
          Length = 662

 Score =  513 bits (1321), Expect = e-143,   Method: Composition-based stats.
 Identities = 210/718 (29%), Positives = 311/718 (43%), Gaps = 100/718 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YAE     I L  Y+ D   VK+ D  +   +P +L+
Sbjct: 1   MQTLSIDIETYSSINLSKCGVYKYAEAPDFEILLFGYSVDGCDVKVIDLAQGEHLPQELI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKT---LGIDIPS-----------------KRWICTSV 98
             L D++++  A N+ FER+   +    LGI +                   + W C+ V
Sbjct: 61  DALTDDSIIKWAFNANFERVCLSRYLRDLGISLDPFHDSHHLSQECSHFLNSESWRCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQ 154
            A T GLP SL+     L       K+ EGK LI  F   C  +  +      R  H  +
Sbjct: 121 WAATMGLPLSLEGVGSVLGLE--KQKLTEGKELIKYFSVPCAPTKANGGRTRNRPFHDPE 178

Query: 155 AWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQEL 212
            W  F  Y  RDVE    +  RL   P+ +     + +DQ INDRG RID+DLV +  E+
Sbjct: 179 KWDAFKRYNIRDVETEMGIKDRLSKFPVPEAVWYEYHIDQEINDRGVRIDMDLVTEAIEM 238

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQ 272
             + R +L   I K     + +      ++ +L    G++   + +  +  ++  +    
Sbjct: 239 DTRSRTELTSAIKK--MTDLENPNSVQQMKQWLSN-NGLETDSLGKKVVAELIKTA--PP 293

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
             ++++  R   + S++ K  T+  AV  DGR RG   FYGA+RTGRW+G + Q QNLP+
Sbjct: 294 ELQNVLELRQQLAKSSVRKYQTMERAVCDDGRARGMFAFYGANRTGRWAGRLIQLQNLPQ 353

Query: 333 QERSEEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARV 388
               +    + +      +       D     S  +R+  I  +  +  V+D + IEARV
Sbjct: 354 NHLEDLADARALVKSGDFDAVKLLYEDVPDTLSQLIRTAFIPKSDTQFYVSDFSAIEARV 413

Query: 389 LAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAK 446
           +AW AGE W+ K FA G DIY  + ++ F+ P++K   +   R  GK+ ELALGY G   
Sbjct: 414 IAWYAGETWRQKVFAEGGDIYCASASQMFHVPVEKHGINGHLRQKGKIAELALGYGGSIG 473

Query: 447 VFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELV 506
             K M                                         A++  L       +
Sbjct: 474 ALKAMG----------------------------------------AIEMGLSEDELPPL 493

Query: 507 KKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSR 566
             AWR  +  +++ W D+       V+   + S         L        + I LPS R
Sbjct: 494 VDAWRQTNPNIVKFWWDVDRAVMEAVKHKHTTS------CYGLTFSCRSGMLFITLPSGR 547

Query: 567 RLVYSDVKGDCSYLNTA---------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNA 617
            L Y   K   +              T +  R  +YG K  ENIVQA SRDILC  MK  
Sbjct: 548 NLAYVKPKIGTNKFGGECITYEGVGSTKKWERLDSYGPKFVENIVQATSRDILCYAMKTL 607

Query: 618 TKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                +IV+ +HDE+V E    P  S+  LC  M + P WA+GL L+A+GY    Y+K
Sbjct: 608 --RNCEIVMHIHDELVIEA--DPCMSLDVLCEQMGRTPPWARGLKLRADGYTCPFYKK 661


>gi|153814242|ref|ZP_01966910.1| hypothetical protein RUMTOR_00451 [Ruminococcus torques ATCC 27756]
 gi|145848638|gb|EDK25556.1| hypothetical protein RUMTOR_00451 [Ruminococcus torques ATCC 27756]
          Length = 644

 Score =  513 bits (1321), Expect = e-143,   Method: Composition-based stats.
 Identities = 198/698 (28%), Positives = 328/698 (46%), Gaps = 78/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   LP  GV  YA  EQ  I L AY+ +DEP K+ D      MP +++
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTKIIDIASGQTMPEEIM 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D++V+  A N+ FER    +  G+ +  + W CT+V A    LP SL+    ALN 
Sbjct: 61  ECLMDDSVVKTAFNAAFERNCINRFFGLSLKPEGWRCTAVQASMLSLPLSLEGVGEALNL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                KM EGK LI  F   CK +  +        ++  + W+LF  YC RDV+  +++ 
Sbjct: 121 --DKKKMSEGKDLIRYFCMPCKPTKANGGRTRNLPSDAPEKWELFKTYCIRDVDVEKQIR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            +L   P+ D E++L+ +DQ INDRG  +D +L+          ++   +   +++    
Sbjct: 179 NKLAKFPIPDREQELYCMDQRINDRGIMVDRELISNAVACDLLYKEAASKRAYEISGLE- 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    GI++  +++  ++ ++  +       +++  RL+ S +++ K 
Sbjct: 238 -NPNSVSQLKDWLNEK-GIEVDSLAKAAVEELVEKTEG--EVSEMMKLRLSMSKTSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE- 351
             +  +V  DGR+ G LQFYGA+RTGRW+G + Q  NLP+    +  L ++I    R + 
Sbjct: 294 EAMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELARSIVKEGRYDL 353

Query: 352 ---TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S+ +R+  +A  G + +V+D + IEARV+ ++AGE W ++ F     I
Sbjct: 354 VELLYDSTPEVLSELIRTAFVAKPGCRFIVSDFSAIEARVMGYLAGEGWVMEEFRGAGKI 413

Query: 409 YVTTYAKAFNTPIDKVSKEQRAIG--KVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  T +K F+ PI++++K        KV  LA  Y G      +M +   ++ +      
Sbjct: 414 YEQTASKMFHIPIEEITKGSPYRARGKVASLACQYGGAEGALVSMGALNFVEEE------ 467

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                                + + ++WR  +  ++  W ++  
Sbjct: 468 -----------------------------------ELKGLVQSWRTANPHIVNYWYEIDG 492

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT-- 584
                V+E    +      V R+ +      + I LPS R L Y   +   +   + +  
Sbjct: 493 AVKAAVKERKMTT------VGRVTVYYQSGMLKIALPSGRVLSYVRPRMTVNRFGSESVS 546

Query: 585 -------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                   +  R  +YG K  ENIVQA +RD+L E M    K G+DIV  +HDE+V E P
Sbjct: 547 YEGVGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLRLEKKGFDIVCHIHDEVVLEVP 606

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +    SV  +  +M   P W +GLPLKA G+E+  Y+K
Sbjct: 607 EGTS-SVEEVNEIMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|291556513|emb|CBL33630.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [Eubacterium siraeum V10Sc8a]
          Length = 660

 Score =  512 bits (1319), Expect = e-143,   Method: Composition-based stats.
 Identities = 203/716 (28%), Positives = 311/716 (43%), Gaps = 98/716 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y E     I L  Y+ D  PV++ D      +P +++
Sbjct: 1   MKTLSIDIETYSSVDLAKCGVYKYTEATDFDILLFGYSTDGGPVQVVDLACGETIPQEVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL------------------GIDIPSKRWICTSVLA 100
             L ++ V   A N+ FERI   + L                  G  +    W CT + +
Sbjct: 61  AALTNDNVTKWAFNAQFERICLSRWLRDHGGFDNACYSIPEDTVGNYLDPASWKCTMIWS 120

Query: 101 RTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKG----SIDSPPYDCTRANHVQAW 156
              GLP SL+     L       K+ EGK LI  FC+       +S        N    W
Sbjct: 121 AYMGLPLSLEGVGAVLGLG--KQKLTEGKELIKYFCQPCAPTKANSGRTRNLPENAPDKW 178

Query: 157 QLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIA 214
             F  Y  RDVE    + ++L   P+ D   + + LDQ INDRG  +D+DLV +  ++  
Sbjct: 179 ASFKRYNARDVEVEMSIQEKLAKFPVPDVVWEQYHLDQEINDRGVALDMDLVRQAIDMDT 238

Query: 215 QERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLA 274
           + R +L   + K     + +      ++ +L    G+++  + +  +  +L  +      
Sbjct: 239 RSRAELTAAMKK--LTALDNPNSVQQMKQWLSD-NGLNVDSLGKKEVAEMLKTA--PAEL 293

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
           + ++L R   + S++ K   + +AV +DGR RG  QFYGA+RTGRW+G + Q QNLP+  
Sbjct: 294 QQVLLLRQQLAKSSVKKYQAMEKAVCADGRARGMFQFYGANRTGRWAGRIIQMQNLPQNH 353

Query: 335 RSEEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
             +    + +      +       D     S  +R+  +   G K +V+D + IEARVLA
Sbjct: 354 LPDLAEARALVRCGDFDGVELLYEDVPDTLSQLIRTAFVPRPGYKFIVSDFSAIEARVLA 413

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVF 448
           W AGE W+ + F  G DIY  + ++ F  P++K   +   R  GK+ ELALGY G     
Sbjct: 414 WFAGETWRQEVFEKGGDIYCASASQMFKVPVEKHGVNGHLRQKGKIAELALGYGGSVGAL 473

Query: 449 KTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKK 508
           K M                                         A++  L     + +  
Sbjct: 474 KAMG----------------------------------------ALEMGLSEGELQPLVT 493

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRL 568
           AWR  +Q +++ W D+       V+          + +  +        + I LPS RRL
Sbjct: 494 AWRNSNQNIVKFWWDIDRAAMNAVK------YHMDSEICGIKFSYKSGMLFITLPSGRRL 547

Query: 569 VYSDVKGDCSYLN---------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK 619
            Y   K   +              T +  R  TYG KL ENIVQA SRDILC  M+    
Sbjct: 548 SYVKPKLGTNQFGGECITYEGIGGTKKWERLDTYGPKLVENIVQATSRDILCYAMRTL-- 605

Query: 620 NGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +   I + +HDE+V E       ++ ++C  M + P+WA GL L+A+GYE   Y+K
Sbjct: 606 SHCFITMHIHDELVIEASLG--VNLKSICEQMGRTPTWANGLKLRADGYETMFYKK 659


>gi|315654969|ref|ZP_07907874.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii ATCC 51333]
 gi|315490930|gb|EFU80550.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii ATCC 51333]
          Length = 640

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 215/694 (30%), Positives = 312/694 (44%), Gaps = 74/694 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET SP  L K GV+ Y       I L +YA D   V+  D      +P  +L
Sbjct: 1   MRTLSIDIETYSPVILAKAGVYKYCNHPDFKILLFSYAIDSCTVRTVDLASGEQLPDAVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A+N+ FER      LG  +    W C+ V A T GLP SLK+    LN 
Sbjct: 61  DALADSAVTKWAYNASFERTCLSAYLGRLLDPAGWRCSMVWAATLGLPLSLKDVGKVLNL 120

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL- 177
                KM+EGK LI  FC    +S       ++    W+LF  Y  RDVE    + ++L 
Sbjct: 121 DAQ--KMDEGKDLIKHFCVPDDNS--QRRLPSSDPAGWKLFKMYNARDVEVETAIRQKLA 176

Query: 178 -IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
             P+ D   + + +DQ INDRG RID  L      +  + R +      KLT   + +  
Sbjct: 177 DFPVPDYLWEQYEVDQRINDRGIRIDTTLAANAIAIDEEHRAQALARAHKLTG--LDNPA 234

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
               L+ +L    G  +  M++ ++   L+++      ++ +  R   S S++ K   + 
Sbjct: 235 SPLQLQEWLNQH-GCPIESMAKESVDDALANATGQ--VREALELRQELSRSSVAKYRKMI 291

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---- 352
           +   +D R  G LQFYGA+RTGRW+G + Q QNLPR    +    + +     GET    
Sbjct: 292 DVTCTDQRAHGLLQFYGANRTGRWAGRLVQVQNLPRNYLPDLTQARGLVRDGNGETLEML 351

Query: 353 IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTT 412
            +      S  +R+  I S   + +VAD + IEARVLAW+AGE+  + AF NGED+Y  T
Sbjct: 352 YSSVPDTLSQLIRTAFIPSGAHRFIVADYSAIEARVLAWLAGEETTLAAFKNGEDLYCAT 411

Query: 413 YAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTS 470
            +  F  P++K   + E R  GK+  LA GY G     K M                   
Sbjct: 412 ASAMFGVPVEKHGVNSELRQKGKIAVLACGYNGSVGALKAMG------------------ 453

Query: 471 TFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFAC 530
                                 A+K  L     + +  AWR  +  ++QLW  +      
Sbjct: 454 ----------------------ALKMGLSEDELQPIVDAWRQANPNIVQLWHKVDNAATR 491

Query: 531 VVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT------ 584
            +  G  ++ R       L   +    + I LPS RRL Y       +     +      
Sbjct: 492 AISTGRPLTLR------NLGFEKKSGILFITLPSGRRLAYVKPGIGVNRFGGTSITYWGQ 545

Query: 585 ---SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPY 641
               +  +  TYGGKL ENIVQA +RD+L E +      G+ IV+ +HDE+V + P    
Sbjct: 546 GVARKWQKLETYGGKLVENIVQATARDLLAEAITRIENAGHQIVMHIHDEVVIDEPINSG 605

Query: 642 FSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +V  +C+LM + P WA+GLP+ A GYE   Y+K
Sbjct: 606 TTVADICALMNELPQWAEGLPIDAAGYECGFYQK 639


>gi|302876795|ref|YP_003845428.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|307687477|ref|ZP_07629923.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|302579652|gb|ADL53664.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
          Length = 663

 Score =  511 bits (1317), Expect = e-142,   Method: Composition-based stats.
 Identities = 202/714 (28%), Positives = 311/714 (43%), Gaps = 98/714 (13%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
            L IDIET S   L K GV+ Y+E   + + L AY+ D   V + D     ++P ++LQ 
Sbjct: 6   TLSIDIETYSSIDLAKCGVYKYSESSDSEVLLFAYSVDGGSVIVIDVANGESIPDEILQA 65

Query: 61  LRDETVMCVAHNSLFERI----LFKKTL--------------GIDIPSKRWICTSVLART 102
           L D++V+  A N+ FER+      K+                G  +    W C+ + +  
Sbjct: 66  LVDDSVIKWAFNAAFERVFLSIWLKRNYPELFCSYSIPEDSVGNYLDPSAWRCSMIWSAY 125

Query: 103 NGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPY----DCTRANHVQAWQL 158
            GLP SL+     L   E   K  EGK LI  FCK    +            +    W+L
Sbjct: 126 MGLPLSLEGVGAVLGLEEQKLK--EGKDLIRYFCKPCAATKVNGGRTRNLPEHAPDKWEL 183

Query: 159 FGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
           F  Y KRDVE    + K+L   P+ +   + + LDQ INDRG  +D+D+V     + A  
Sbjct: 184 FKAYNKRDVEVEMNIQKKLSHYPVPEFVWEEYHLDQEINDRGIALDMDVVENAIRIDAIS 243

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKD 276
           +  L   +       + +      ++ +L    G+D   + +  +  +L    +     D
Sbjct: 244 KATLMATMQD--LTDLENPNSVAQMKGWLAAK-GVDTDSLDKKAVIELLKT--VPTDVAD 298

Query: 277 LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERS 336
           ++  R   + S++ K   +  AV  DGR RG  QFYGA+R+GRW+G + Q QNLP+    
Sbjct: 299 VLTLRQQLAKSSVKKYQAMQNAVCDDGRARGMFQFYGANRSGRWAGRIIQLQNLPQNHME 358

Query: 337 EEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
           +  + + I      E       +  G+ S+ +R+  I   G K  VAD + IEARV+A +
Sbjct: 359 DLDVARDIVKSGDYEILNMFYDNVPGVLSELIRTAFIPREGYKFAVADFSAIEARVIAHL 418

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKT 450
           A E W++K FA+  DIY  + +  F  P++K   +   R  GK+ ELALGY G      +
Sbjct: 419 AKERWRMKVFADNGDIYCASASAMFGVPVEKHGQNAHLRQKGKIAELALGYGGSVGALTS 478

Query: 451 MASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
           M                                         A+   L     + +  AW
Sbjct: 479 MG----------------------------------------ALDMGLAEEELQPLVDAW 498

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           RA +  ++Q W D+       ++E  +     +              + IVLPS RRL Y
Sbjct: 499 RAANPNIVQFWWDVDNAVKRAIKERTATKTHGIR------FIYKSAMLFIVLPSGRRLAY 552

Query: 571 SDVKGDCSYLNTAT---------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNG 621
              +   +     +          +  R  +YG K  ENIVQAISRDILC  ++    + 
Sbjct: 553 VKPRIGENKFGGESVTYEGVGTNKKWERIESYGPKFVENIVQAISRDILCYALRTL--SH 610

Query: 622 YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             IV  VHDE++ E       S+  +C  M + P W +GL L+A+GYE + Y+K
Sbjct: 611 CFIVGHVHDEVIIECRQDA--SLEAICEQMGRVPEWIEGLLLRADGYETQFYKK 662


>gi|227496457|ref|ZP_03926741.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
 gi|226834039|gb|EEH66422.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
          Length = 651

 Score =  511 bits (1317), Expect = e-142,   Method: Composition-based stats.
 Identities = 227/696 (32%), Positives = 317/696 (45%), Gaps = 75/696 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   LP VGV+ YA  E   I L AYA D   V++ D      +P D+L
Sbjct: 9   MRTLSIDIETFSKASLPSVGVYRYAADESFEILLFAYAVDGGEVQIVDLARGEQIPGDVL 68

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V+  A N+ FER+     LG  +  + W C+ V A   G+P  L     AL+ 
Sbjct: 69  DALEDPGVVKSAFNAAFERVCLSAHLGHRLDPEGWRCSMVWASFAGVPLDLAGVAKALHL 128

Query: 119 SEHLTKMEEGKALIARFC---KGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
                KM EGK LI  F    K +  +   +     H    W+ F  YCKRDVE    + 
Sbjct: 129 ETE--KMGEGKNLIRYFSLPAKPTKANGGRERNLPEHAPDDWETFKAYCKRDVEVELAIT 186

Query: 175 KRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           KRL   P+   E D +  DQ INDRG RID DL     +     R    E + +LT    
Sbjct: 187 KRLHAMPMPAREWDNYWDDQRINDRGVRIDADLATAAVDADNTGRASALERMRELTRVD- 245

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+ +  +++  + + L    +     +++  R   + S++ K 
Sbjct: 246 -NPASVTQLLAWLRS-QGLQIDSLAKADVAAALE-GALEGDVAEVLALRQEMAKSSVKKY 302

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +      DGR  G LQF GA RTGRW+G + Q QNLPRQ  S+      +      + 
Sbjct: 303 ERMLACRCPDGRAHGLLQFMGAGRTGRWAGRLVQVQNLPRQSISDLEAAADLVRTGHADM 362

Query: 353 I----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
           +         + S+ +R+  +A  G + +VAD + IEAR +AW+AGE W +  F  G DI
Sbjct: 363 LETLWGSAPQVLSELIRAAFVAEPGSRFLVADYSAIEARTIAWLAGEQWVLDLFEAGGDI 422

Query: 409 YVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKS 468
           Y  T  + F   ++K S   R   KV  LA GYQGG    KTM                 
Sbjct: 423 YCETGTRMFRQVVEKHSP-LRQRAKVAVLACGYQGGVGALKTMG---------------- 465

Query: 469 TSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGF 528
                                     K  L       +  AWRA +  + QLW D+    
Sbjct: 466 ------------------------GEKLGLSEDEMADIVAAWRAANPKIAQLWWDINAAA 501

Query: 529 ACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT---- 584
             V+++GG+        V R+ +   K  + I LPS R LVY   +   +     +    
Sbjct: 502 IAVIKDGGA------RAVGRIRLAHDKGALIITLPSGRPLVYPSPRIGENRFGGESITHM 555

Query: 585 -----SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDT 639
                 +  R  TYGGKLTENIVQA +RDIL   +    ++GY +V+ +HDE+V+E P+ 
Sbjct: 556 GVGVNRKWGRIETYGGKLTENIVQATARDILAHAIARLERSGYPVVMHIHDEVVTEVPEG 615

Query: 640 PYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
              SV  LC+LM++ P WA GLPL AEG+E+  YRK
Sbjct: 616 R-GSVEELCALMSQAPPWADGLPLAAEGFESTYYRK 650


>gi|154504839|ref|ZP_02041577.1| hypothetical protein RUMGNA_02349 [Ruminococcus gnavus ATCC 29149]
 gi|153794722|gb|EDN77142.1| hypothetical protein RUMGNA_02349 [Ruminococcus gnavus ATCC 29149]
          Length = 644

 Score =  511 bits (1316), Expect = e-142,   Method: Composition-based stats.
 Identities = 196/698 (28%), Positives = 327/698 (46%), Gaps = 78/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   LP  GV  YA  EQ  I L AY+ +DEP ++ D      +P +++
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTQIIDLASGEKIPDEIM 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           +YL D++V+  A+N+ FER    +  G+ +  + W CT V A    LP SL+    ALN 
Sbjct: 61  EYLTDDSVIKTAYNAAFERNCINRFFGLSLKPEGWRCTLVQASMLSLPLSLEGVGEALNL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                KM EGK LI  F   CK +  +        ++  + W+LF  YC RDV+  +++ 
Sbjct: 121 --DKKKMSEGKDLIRYFCMPCKPTKANGGRTRNLPSDAPEKWELFKTYCTRDVDVEKQIR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            +L   P+ D E+ L+ +DQ INDRG  +D +L+          ++ + +   +++    
Sbjct: 179 NKLAKFPIPDREQKLYCMDQRINDRGIMVDQELIGHAVACDLLYKETVTKKAYEISGLE- 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    GI++  +++  ++ ++ ++       +++  RLA S +++ K 
Sbjct: 238 -NPNSVSQLKDWLNEK-GIEVDSLAKAAVEELVENTQGD--VAEMMKLRLAMSKTSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE- 351
             +  +V  DGR+ G LQFYGA+RTGRW+G + Q  NLP+    +  L +++    R + 
Sbjct: 294 EAMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELARSLVKEGRYDL 353

Query: 352 ---TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S+ +R+  +A  G + +V+D + IEARV+ ++AGE W ++ F     I
Sbjct: 354 VELLYDSTPDVLSELIRTAFVARPGCRFIVSDFSAIEARVMGYLAGEGWVMEEFRGAGKI 413

Query: 409 YVTTYAKAFNTPIDKVSKEQRAIG--KVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  T +K F+ PI +++K        KV  LA  Y G      +M +   ++ +      
Sbjct: 414 YEQTASKMFHIPIGEITKGSPYRARGKVASLACQYGGAEGALISMGALNFVEEE------ 467

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                                + + ++WR  +  ++  W ++  
Sbjct: 468 -----------------------------------ELKGLVQSWRTANPHIVNYWYEIDG 492

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT-- 584
                V+E           V  + +      + I LPS R L Y   +   +   + +  
Sbjct: 493 AVKAAVKERKMT------KVGMVTVYYQSGMLKITLPSGRVLSYVRPRMTVNRFGSESVS 546

Query: 585 -------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                   +  R  +YG K  ENIVQA +RD+L E M    K G+DIV  +HDE+V E P
Sbjct: 547 YEGIGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLRLEKKGFDIVCHIHDEVVLEVP 606

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +    SV  +  +M   P W +GLPLKA G+E+  Y+K
Sbjct: 607 EGTS-SVEEVNGIMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|256847832|ref|ZP_05553277.1| DNA polymerase I [Lactobacillus coleohominis 101-4-CHN]
 gi|256715521|gb|EEU30497.1| DNA polymerase I [Lactobacillus coleohominis 101-4-CHN]
          Length = 644

 Score =  510 bits (1314), Expect = e-142,   Method: Composition-based stats.
 Identities = 196/698 (28%), Positives = 302/698 (43%), Gaps = 78/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +L IDIET S   L + GV+ YA+     + L  YA D  PVK+ D T+  ++P  ++
Sbjct: 1   MKQLSIDIETYSNTNLNQTGVYRYADSKDFELLLFGYAIDFGPVKVIDLTQGESIPPQVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D T++  A N+ FER+   + +   +    W C+ V + T GLP SL++    L  
Sbjct: 61  KALDDPTIIKSAFNAQFERVCLSRFVSHRLKPAGWHCSRVWSATLGLPLSLRDVGTVLGL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTR-ANHVQAWQLFGEYCKRDVEATRELF 174
                    GK L+  F   CK +  +         +    WQ F +Y +RDVE   E+ 
Sbjct: 121 PRQKI--TAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEIT 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           ++L   P+   E + + +DQ INDRG RID  LV    +       +  +   KLT   +
Sbjct: 179 QKLECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKKLTG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    GI    +S+ ++  +L  +  T     ++  R   S S+I K 
Sbjct: 237 ANPNSPLQLKDWLHQ-QGIKTDSLSKASVAQLLQTTTGT--VHQVLALRQLLSKSSIKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             + +A+  DGR+ G LQFYGA+RTGRW+G + Q QNLPR    +    + +        
Sbjct: 294 QAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNVPA 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  I S      VAD + +EARV+AW++ E W+ ++FA  EDI
Sbjct: 354 LAMLYDSVPDVLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEKWRQESFAKNEDI 413

Query: 409 YVTTYAKAFNTP--IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F  P     ++ E R  GK+ ELALGY G     K M +             
Sbjct: 414 YCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATN----------- 462

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                          L       + + WR     ++Q W D+ +
Sbjct: 463 -----------------------------LGLTDDELPPLVQMWRNASPHIVQFWWDVDK 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYL------ 580
                ++     +         +        + + L S R L Y   K   +        
Sbjct: 494 AAKECIKTHLPQTT------HGMKFIYRSGCMFLRLRSGRYLCYPQPKIGINRFGSESIT 547

Query: 581 ---NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
              N    +  R  TYG KL ENIVQA SRD+L   M+     G  +V+ +HDE V + P
Sbjct: 548 FMGNNTVKKWDRIETYGAKLVENIVQATSRDLLAGAMRRLETAGNPVVMHIHDEAVIDAP 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                S+ T+  +MT+ P WA GL L A G+    Y+K
Sbjct: 608 TDR--SLDTIVKIMTEVPDWADGLILNAAGFVGGFYKK 643


>gi|313618507|gb|EFR90506.1| DNA polymerase [Listeria innocua FSL S4-378]
          Length = 684

 Score =  510 bits (1314), Expect = e-142,   Method: Composition-based stats.
 Identities = 214/702 (30%), Positives = 317/702 (45%), Gaps = 84/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y  A+   + L  YA D + VK+ D  +   +P ++L
Sbjct: 39  MKNLEIDIETYSSTNLQKSGVYRYVEADDFEVILFGYAVDGDEVKVIDLMDGEKIPKEIL 98

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L DET+   A N+ FER+   + LG      +    W C+ V +   GL  SL+    
Sbjct: 99  DALTDETITKWAFNAQFERVCLSRYLGYPTGTYLNPSSWKCSMVWSAYMGLALSLEGVGA 158

Query: 115 ALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHVQA-WQLFGEYCKRDVEAT 170
            L       K+ EGK LI  F   C  +  +       +      WQ F  Y KRDVEA 
Sbjct: 159 VLGLE--KQKLTEGKDLIRYFCLPCTPTKINGGRTRNLSTDEIDKWQQFKAYNKRDVEAE 216

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
            ++ +RL   P+ +   D + LDQ INDRG ++D+D V +   +     +KL   + ++T
Sbjct: 217 IQIQQRLIKFPVPEDIWDEYHLDQEINDRGIKVDMDFVKQAIAMDDISHEKLLTVMQQIT 276

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
           +  + +      ++ +L    G+++  + +  +   L  ++      +++  R   + S+
Sbjct: 277 N--LDNPNSVQQMKSWLCE-NGLEMETLGKKAVAEKLKETDG--ELNEVLSLRQQLAKSS 331

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   +  AV SD R RG  QFYGA+RTGR++G + Q QNLP+    +    + I    
Sbjct: 332 VKKYTAMENAVCSDSRARGMFQFYGANRTGRFAGRLVQLQNLPQNHMPDLKEARNIVRNG 391

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             ET      D     S  +R+  +   G K +VAD + IEARVL+W+AGE W+ K FA+
Sbjct: 392 DVETLEMLYEDIPDTLSQLIRTAFVPRVGHKFIVADFSAIEARVLSWLAGETWRTKVFAS 451

Query: 405 GEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G DIY  + ++ F  P++K   +   R  GK+ ELALGY G     K M +      ++ 
Sbjct: 452 GGDIYCASASQMFKVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMGALEMGLEEEE 511

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                                    + +  AWR  +  + Q W 
Sbjct: 512 L----------------------------------------KPLVNAWRMSNPNITQFWW 531

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN- 581
           D+       V+E  S           +        + IVLPS RRL Y   +   +    
Sbjct: 532 DVDRAAKQCVKENKSQET------HSIEFHCFSGMLFIVLPSGRRLAYVKPRIGENQFGG 585

Query: 582 --------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                     T +  R  +YG K  ENIVQAISRDIL   MK+     Y IV  VHDE++
Sbjct: 586 ESVTYEGVGGTKKWERLESYGPKFVENIVQAISRDILMHAMKSL--RHYRIVAHVHDEVI 643

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            ET   P  SV  +C  M++ P WAKGL L A+GYE   Y+K
Sbjct: 644 IET--NPQISVTEVCKQMSQVPPWAKGLLLDADGYECDFYQK 683


>gi|323159211|gb|EFZ45201.1| DNA-directed DNA polymerase [Escherichia coli E128010]
          Length = 687

 Score =  510 bits (1313), Expect = e-142,   Method: Composition-based stats.
 Identities = 259/691 (37%), Positives = 374/691 (54%), Gaps = 24/691 (3%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           + L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  RDETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
            D   +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +
Sbjct: 62  ADPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQ 121

Query: 121 HLTKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP 179
              K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 180 LSDG--ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQ 237
            +    E  LW  DQ INDRG  +D++L     + + QE+K+L +   ++TDG ++++ Q
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 238 TYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE 297
             AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L +
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMK 301

Query: 298 AVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IA 354
            VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       
Sbjct: 302 GVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFD 361

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG-----EDIY 409
           + + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF         D+Y
Sbjct: 362 NIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLY 421

Query: 410 VTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
              YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +      
Sbjct: 422 KLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPN 481

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
              +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L     
Sbjct: 482 IPRDVIREAKSWYDESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTVR 540

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTAT 584
             +        ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ +
Sbjct: 541 TAIATP-----QKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYS 595

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R +TYGGKL ENI QA +RDIL   M      GY IVLTVHDE+++E PDT  F+ 
Sbjct: 596 RKWQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFND 655

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +L++ +P WA  +PL A G+EA  Y+K
Sbjct: 656 KALSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|317501098|ref|ZP_07959304.1| DNA-dependent DNA polymerase, family A [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|316897485|gb|EFV19550.1| DNA-dependent DNA polymerase, family A [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 662

 Score =  509 bits (1311), Expect = e-142,   Method: Composition-based stats.
 Identities = 205/718 (28%), Positives = 308/718 (42%), Gaps = 100/718 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ YAE     I L  Y+ D   V + D  +   +P  ++
Sbjct: 1   MQTLSIDIETYSDVNLSKCGVYKYAESPDFEILLFGYSADGSEVTVIDLAQGEHLPQKII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKT---LGID-----------------IPSKRWICTSV 98
             L D+TV+  A N+ FER+   +    LG+                  +  + W C+ V
Sbjct: 61  DALTDDTVIKWAFNANFERVCLSRYLRDLGVSLDPFHDNHPLSTECARFLNPESWRCSMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQ 154
            A T GLP SL+     L       K+ EGK LI  F   C  +  +         H   
Sbjct: 121 WAATMGLPLSLEGVGAVLGLE--KQKLTEGKDLIKYFSVPCAPTKANGGRTRNHPFHAPD 178

Query: 155 AWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQEL 212
            W+ F +Y  RDVE    +  RL   P+ +   D + +DQ INDRG R+D+DLV +  E+
Sbjct: 179 KWEAFKKYNIRDVETEIGIKDRLAKFPVPEAVWDEYHIDQEINDRGVRLDMDLVKEAIEM 238

Query: 213 IAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQ 272
             + R +L   +       + +      ++ +L    G++   + +  +  ++  +    
Sbjct: 239 DTRSRSELTAAMKD--MTALDNPNSVQQMKQWLSD-NGLETDSLGKKVVAELIKTA--PP 293

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
             + ++  R   + S++ K  T+  AV  DGR RG   FYG +RTGRW+G + Q QNLP+
Sbjct: 294 ELQTVLELRQQLAKSSVKKYQTMERAVCDDGRARGMFAFYGVNRTGRWAGRLIQLQNLPQ 353

Query: 333 QERSEEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARV 388
               +    + +      +       D     S  +R+  I  +G +  V+D + IEARV
Sbjct: 354 NHLPDLADARALVKSGNFDAVKLLYEDVPDTLSQLIRTAFIPKDGTQFYVSDFSAIEARV 413

Query: 389 LAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAK 446
           +AW AGE W+ K F  G DIY  + ++ F+ P++K   +   R  GK+ ELALGY G   
Sbjct: 414 IAWYAGETWRQKVFETGGDIYCASASQMFHVPVEKHGINGHLRQKGKIAELALGYGGSVG 473

Query: 447 VFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELV 506
             K M                                         A++  L       +
Sbjct: 474 ALKAMG----------------------------------------AIEMGLSEDELPPL 493

Query: 507 KKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSR 566
             AWR  +  +++ W D+       V+   + S+        L        + I LPS R
Sbjct: 494 VDAWRQTNPNIVKFWWDVDRSVMEAVKYKHTTSSYG------LTFSCRSGMLFITLPSGR 547

Query: 567 RLVYSDVKGDCSYLNTA---------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNA 617
            L Y   K   +              T +  +  +YG K  ENIVQA SRDILC  MK  
Sbjct: 548 NLAYVKPKIGTNKFGGECVTYEGIGSTKKWEQLDSYGPKFVENIVQATSRDILCYAMKTL 607

Query: 618 TKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                 IV+ +HDE+V E    P+ S+  LC  M + P WAKGL L+A+GY    Y+K
Sbjct: 608 --RCCSIVMHIHDELVIEA--DPHMSLDVLCEQMGRTPPWAKGLKLRADGYVTPFYKK 661


>gi|331083931|ref|ZP_08333040.1| hypothetical protein HMPREF0992_01964 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330403356|gb|EGG82916.1| hypothetical protein HMPREF0992_01964 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 646

 Score =  509 bits (1311), Expect = e-142,   Method: Composition-based stats.
 Identities = 203/702 (28%), Positives = 305/702 (43%), Gaps = 84/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y E     I L  Y+ D   VK+ D      +P ++ 
Sbjct: 1   MKNLEIDIETYSSANLSKSGVYRYVESPDFEIILFGYSIDGGEVKVVDLACGETIPKEVY 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D++V   A N+ FERI   K LG      +    W C+ V +   GLP SL+   +
Sbjct: 61  DALEDDSVTKWAFNAQFERICLSKFLGYKQGTYLEPDSWKCSMVWSAYMGLPLSLEGVGV 120

Query: 115 ALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEAT 170
            L       K+ EGK LI  F   C  +  +        +H  + W+ F  Y  RDVEA 
Sbjct: 121 VLGLE--KQKLTEGKELIKYFCTPCNPTKVNGGRMRNLPHHDTEKWERFKAYNIRDVEAE 178

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
            ++  RL   P+ D   D + LDQ INDRG ++D+D V K  E+    R+ L   +    
Sbjct: 179 MQIQSRLQKFPVPDFVWDEYHLDQEINDRGIKVDMDFVEKCLEIDNVSRESLMTKMQ--V 236

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
              + +      ++ +L    GI+   + +  + +++    +     +++  R   + S+
Sbjct: 237 LTSLTNPNSVVQMKGWLSD-NGIETETLGKKAVAALIDE--VPDEMSEILALRQKLAKSS 293

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   +  +V  DGR+RG  QFYGA+RTGR++G + Q QNLP+    +    + +    
Sbjct: 294 VRKYQAMQNSVCEDGRVRGMFQFYGANRTGRFAGRLVQLQNLPQNHMEDLAEARGLVRSG 353

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             ++      D     S  +R+  I +  +  +VAD + IEARV+AW AGE W+   FA 
Sbjct: 354 DYDSLDLLYDDIPDTLSQLIRTAFIPTVNESFIVADFSAIEARVIAWFAGESWRADVFAK 413

Query: 405 GEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G DIY  + ++ F  P++K   +   R  GK+ ELALGY G     K M           
Sbjct: 414 GGDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSTGALKAMG---------- 463

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A++  L       +  AWR  +  +++ W 
Sbjct: 464 ------------------------------ALEMGLAEEELPELVSAWRCSNPNIVRFWW 493

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT 582
           D+       ++   S +         +        + I LPS R L Y       +    
Sbjct: 494 DVDSAVKKAIKSKTSTAT------HGVHFSCRSGMLFITLPSGRVLSYVKPCMGENKFGG 547

Query: 583 A---------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                     T +  R  +YG K  ENIVQA SRDIL   MK        IV  VHDEI+
Sbjct: 548 ESVTYEGVGSTKKWERLESYGPKFVENIVQATSRDILMYAMKTL--RCCSIVAHVHDEII 605

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E    P  S+  +C  M + P WA+GL L+A+GYE + Y+K
Sbjct: 606 IEA--DPRMSLDAICEQMGRTPPWAEGLLLRADGYECQFYKK 645


>gi|300909464|ref|ZP_07126925.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
 gi|300893329|gb|EFK86688.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
          Length = 644

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 194/698 (27%), Positives = 304/698 (43%), Gaps = 78/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M ++ IDIET S   L + GV+ YA+     + L  YA D  PVK+ D T+   +P  ++
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYATDFGPVKVVDLTQGEKIPPQII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L +  ++  A N+ FER+   + +G  +    W C+ V + T GLP SL++    L  
Sbjct: 61  EVLDNPNIIKSAFNAQFERVCLSRFVGHRLKPTGWHCSRVWSATLGLPLSLRDIGSVLGL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTR-ANHVQAWQLFGEYCKRDVEATRELF 174
                    GK L+  F   CK +  +         +    WQ F +Y +RDVE   E+ 
Sbjct: 121 PRQKI--TAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEIT 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           ++L   P+   E + + +DQ INDRG RID  LV    +       +  +   +LT   +
Sbjct: 179 QKLECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKELTG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    GI    +S+ ++  +L  +  T     ++  R   S S++ K 
Sbjct: 237 ANPNSPLQLKDWL-QQQGIKTNSLSKASVAQLLQTTTGT--VHQVLALRQLLSKSSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             + +A+  DGR+ G LQFYGA+RTGRW+G + Q QNLPR    +    + +        
Sbjct: 294 QAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNVPA 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  I S      VAD + +EARV+AW++ E W+ ++FA  EDI
Sbjct: 354 LAMLYDSVPDVLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEKWRQESFAKNEDI 413

Query: 409 YVTTYAKAFNTP--IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F  P     ++ E R  GK+ ELALGY G     K M +             
Sbjct: 414 YCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATK----------- 462

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                          L       + + WR     ++Q W D+ +
Sbjct: 463 -----------------------------LGLTDDELPPLVQMWRNASPHIVQFWWDVDK 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT-- 584
                ++     +         +        + + L S R L Y   K   +   + +  
Sbjct: 494 AAKECIKTHLPQTT------HGMKFIYRSGCMFLRLRSGRYLCYPQPKIGINRFGSESIT 547

Query: 585 -------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                   +  R  TYG KL ENIVQA SRD+L E M+     G  +V+ +HDE V + P
Sbjct: 548 FMGINTVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATGNTVVMHIHDEAVIDAP 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                S+ T+  LMTK P WA GL L A G+ +  Y+K
Sbjct: 608 FNR--SLDTMVQLMTKVPDWANGLILNAAGFVSDFYKK 643


>gi|302873662|ref|YP_003842295.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|307686614|ref|ZP_07629060.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|302576519|gb|ADL50531.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
          Length = 645

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 219/698 (31%), Positives = 338/698 (48%), Gaps = 77/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+AY       I L AYA+D + VK+ D      +P++++
Sbjct: 1   MQTLSIDIETFSDVDLIKSGVYAYTASPNFEILLFAYAFDSDEVKIIDFASGEELPAEII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L +E ++  A N+ FERI   + L   + +  W CT+V A T G P SL      L  
Sbjct: 61  EALLNENIIKSAFNAQFERICLSRHLNKKLTANAWQCTAVQAATLGFPLSLDGVAQVLGL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
           +E   KM+EGK LI  F   CK +  +         H  + W  F +YC RDVE  R + 
Sbjct: 121 TEQ--KMKEGKELIRYFSIPCKPTRVNEGRTRNLPQHSSEKWNDFKKYCIRDVEVERAIR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           K+L   P+S+ E+  ++LD  INDRG  +DLDLV +  E       K D          +
Sbjct: 179 KKLSRYPISENEQRNYILDHEINDRGVFVDLDLVARAMECD--RLHKEDTFTEAQRLTGL 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G+++  +S+  +  +   ++     + L+  RL  + ++I K 
Sbjct: 237 DNPNSVAQLKQWLIE-NGVEVDSLSKKAVSDLAKEADG--EVERLLNLRLQLAKTSIKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  AV  D R+RG LQFYGA+RTGRW+G + Q QNLP+    +  L + +      +T
Sbjct: 294 EAIERAVCPDKRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLKDLTLARNLVKSGDFDT 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S+ +R+  I  +  + +VAD + IEARV+AW+AGE W++  FA    I
Sbjct: 354 LALLFESVPHVLSELIRTAFIPKSNHRFIVADFSAIEARVIAWLAGEKWRMDVFATHGKI 413

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F  PI++++K    R  GK+ ELALGY G       M               
Sbjct: 414 YEASASQMFKVPIEEITKTSALRQKGKISELALGYGGSVGALTAMG-------------- 459

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   +     + +  AWR  +  + +LW D+ +
Sbjct: 460 --------------------------ALDMGVAEDELQGLVTAWRQANPNITKLWWDIDK 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN----- 581
                V++  ++       V ++ ++     + I LPS RRL Y   + + +        
Sbjct: 494 AAIKAVKKKTTVM------VGKIKLQYESGIMFITLPSGRRLSYIKPRIEPNKFERDAVT 547

Query: 582 ----TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                AT +  R  TYG KL ENIVQAI+RD+L E M    +NGY+IV+ +HDEIV E P
Sbjct: 548 YEGIGATKKWERIETYGPKLVENIVQAIARDLLAEAMLRVAENGYEIVMHIHDEIVIEAP 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
              + S+  +C +M   P+WA+ LPL+A+G+E + YRK
Sbjct: 608 LN-FGSLKDVCEVMAIAPTWAESLPLRADGFECEYYRK 644


>gi|218555134|ref|YP_002388047.1| putative DNA polymerase from bacteriophage origin [Escherichia coli
           IAI1]
 gi|218361902|emb|CAQ99502.1| putative DNA polymerase from bacteriophage origin [Escherichia coli
           IAI1]
          Length = 687

 Score =  508 bits (1308), Expect = e-141,   Method: Composition-based stats.
 Identities = 259/691 (37%), Positives = 374/691 (54%), Gaps = 24/691 (3%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           + L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGVGIPHGLYEAI 61

Query: 62  RDETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
            D   +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +
Sbjct: 62  ADPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQ 121

Query: 121 HLTKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP 179
              K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 180 LSDG--ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQ 237
            +    E  LW  DQ INDRG  +D++L     + + QE+K+L +   ++TDG ++++ Q
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 238 TYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE 297
             AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L +
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMK 301

Query: 298 AVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IA 354
            VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       
Sbjct: 302 GVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFD 361

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG-----EDIY 409
           + + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF         D+Y
Sbjct: 362 NIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLY 421

Query: 410 VTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
              YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +      
Sbjct: 422 KLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPN 481

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
              +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L     
Sbjct: 482 IPRDVIREAKSWYDESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTVR 540

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTAT 584
             +        ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ +
Sbjct: 541 TAIATP-----QKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYS 595

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R +TYGGKL ENI QA +RDIL   M      GY IVLTVHDE+++E PDT  F+ 
Sbjct: 596 RKWQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFND 655

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +L++ +P WA  +PL A G+EA  Y+K
Sbjct: 656 KALSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|218133416|ref|ZP_03462220.1| hypothetical protein BACPEC_01281 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990791|gb|EEC56797.1| hypothetical protein BACPEC_01281 [Bacteroides pectinophilus ATCC
           43243]
          Length = 644

 Score =  508 bits (1307), Expect = e-141,   Method: Composition-based stats.
 Identities = 197/698 (28%), Positives = 328/698 (46%), Gaps = 78/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   LP  GV  YA  EQ  I L AY+ +DEP ++ D      MP +++
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTRIIDLASGQTMPDEIM 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D++V+  A N+ FER    +  G+ +  + W CT+V A    LP SL+    ALN 
Sbjct: 61  ECLMDDSVVKTAFNAAFERNCINRFFGLSLKPEGWRCTAVQASMLSLPLSLEGVGEALNL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                KM EGK LI  F   CK +  +        ++  + W+LF  YC RDV+  +++ 
Sbjct: 121 --DKKKMSEGKDLIRYFCMPCKPTKANGGRTRNLPSDAPEKWELFKTYCIRDVDVEKQIR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            +L   P+ D E++L+ +DQ INDRG  +D +L+          ++   +   +++    
Sbjct: 179 NKLAKFPIPDREQELYCMDQRINDRGIMVDRELISHAVTCDLLYKEAASKRAYEISGLE- 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    GI++  +++  ++ ++  +       +++  RL+ S +++ K 
Sbjct: 238 -NPNSVSQLKEWLNEK-GIEVDSLAKAAVEELVEKTEG--EISEMMKLRLSMSKTSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE- 351
             +  +V  DGR+ G LQFYGA+RTGRW+G + Q  NLP+    +  L ++I    R + 
Sbjct: 294 EAMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELARSIVKEGRYDL 353

Query: 352 ---TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S+ +R+  +A  G + +V+D + IEARV+ ++AGE W ++ F     I
Sbjct: 354 VELLYDSTPDVLSELIRTAFVAKPGCRFIVSDFSAIEARVMGYLAGEGWVMEEFRGAGKI 413

Query: 409 YVTTYAKAFNTPIDKVSKEQRAIG--KVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  T +K F+ PI++++K        KV  LA  Y G      +M +   ++ +      
Sbjct: 414 YEQTASKMFHIPIEEITKGSPYRARGKVASLACQYGGAEGALVSMGALNFVEEE------ 467

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                                + + ++WR  +  ++  W ++  
Sbjct: 468 -----------------------------------ELKGLVQSWRTANPHIVNYWYEIDG 492

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT-- 584
                V+E    +      V R+ +      + I LPS R L Y   +   +   + +  
Sbjct: 493 AVKAAVKERKMTT------VGRVTVYYQSGMLKIALPSGRVLSYVRPRMTVNRFGSESVS 546

Query: 585 -------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                   +  R  +YG K  ENIVQA +RD+L E M    K G+DIV  +HDE+V E P
Sbjct: 547 YEGIGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLCLEKKGFDIVCHIHDEVVLEVP 606

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +    SV  +  +M   P W +GLPLKA G+E+  Y+K
Sbjct: 607 EGTS-SVEEVNGIMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|304439199|ref|ZP_07399117.1| DNA-directed DNA polymerase [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372331|gb|EFM25919.1| DNA-directed DNA polymerase [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 643

 Score =  507 bits (1306), Expect = e-141,   Method: Composition-based stats.
 Identities = 214/698 (30%), Positives = 327/698 (46%), Gaps = 79/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M K+ ID+ET S   L K GV+ YAE     I L AY+ DD  VK+ D      +P ++L
Sbjct: 1   MKKISIDLETYSSVDLGKSGVYKYAESEDFEILLFAYSIDDGEVKVIDLASGEIIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L DE++   A N+ FER+   + L   +  + W CT + +   GLP SL+     L  
Sbjct: 61  SALSDESIEKWAFNANFERVCLSRFLEERLKPQGWYCTMIWSAYLGLPLSLEKVGEVLKL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHVQ-AWQLFGEYCKRDVEATRELF 174
                KM EGKALI  F   CK +  +        +H    W +F EY +RDVE   E+ 
Sbjct: 121 --DKQKMNEGKALIRYFSIPCKPTKTNGMRTRNLPHHDLGKWYIFKEYNQRDVETEMEIK 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           K+L   P+   E + + +DQ INDRG  ID  LV    +     R++  +  ++LT    
Sbjct: 179 KKLSVFPMPQSEWENYWVDQNINDRGILIDEILVDSAIKFDEILREENMDRAIELTGLE- 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G+++  +++  ++S + ++      K+++  R   S S++ K 
Sbjct: 238 -NPNSPLQLKEWLNKK-GLEIDSLAKKDVESAIKNAEGD--IKEVLELRQELSKSSVRKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           + +      + R RG +QFYGA+RTGR+SG + Q QNL R    +  L +++      ET
Sbjct: 294 DAMKNVKGKENRARGLIQFYGANRTGRYSGRLIQVQNLRRNNLKDLDLARSLVKNRDYET 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                  P  + S  +R+  I   G + +++D + IEARVLAWIA E W + AF NGEDI
Sbjct: 354 MEFLYESPSDILSQLIRTAFIPKEGTRFIISDFSAIEARVLAWIAEEQWVLDAFENGEDI 413

Query: 409 YVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  T ++ F  P++K   +   R  GK+  LA GYQG     K M               
Sbjct: 414 YCRTASRMFGVPVEKHGINGHLRQKGKIATLACGYQGALGALKAMG-------------- 459

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                      ++  L     + +  +WR  +  ++ LW D+  
Sbjct: 460 --------------------------GIEMGLSEDELQSIVDSWREANPNIVSLWWDIDS 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT-- 584
               VV+       R       LV+   K  + I LPS RRL Y   K   +     +  
Sbjct: 494 VVKRVVK------TRSKEEYKNLVISYEKGILFIELPSKRRLAYPKAKIGMNRFGGESVV 547

Query: 585 -------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                  ++  +  +YGGK  ENIVQAI+RDIL E M    K G++IV+ +HDE+V E+ 
Sbjct: 548 YEGIVVGNKWDKIESYGGKFVENIVQAIARDILAEAMMRLEKKGFNIVMHIHDEVVIESD 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +    V  +   M+  P WA GL L A+G+E++ Y+K
Sbjct: 608 SSSIEEVNQI---MSIVPGWASGLILDADGFESEFYKK 642


>gi|291283829|ref|YP_003500647.1| DNA polymerase I - 3''''-5'''' exonuclease and polymerase domains
           [Escherichia coli O55:H7 str. CB9615]
 gi|290763702|gb|ADD57663.1| DNA polymerase I - 3''''-5'''' exonuclease and polymerase domains
           [Escherichia coli O55:H7 str. CB9615]
          Length = 687

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 259/691 (37%), Positives = 370/691 (53%), Gaps = 24/691 (3%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           + L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  RDETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
            D   +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +
Sbjct: 62  ADPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQ 121

Query: 121 HLTKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP 179
              K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL  
Sbjct: 122 DKAKNKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 180 LSDG--ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQ 237
            +    E  LW  DQ INDRG  +D+ L     E + QE+K+L +   ++TDG ++++ Q
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDMQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 238 TYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE 297
             AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L +
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIADPHLPSAVKELLAIRLQASTTSTSKYKALMK 301

Query: 298 AVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IA 354
            VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       
Sbjct: 302 GVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCAGLLFD 361

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG-----EDIY 409
           + + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF         D+Y
Sbjct: 362 NIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLY 421

Query: 410 VTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
              YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +      
Sbjct: 422 KLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPN 481

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
              +   +A+S +         F + +++   AC+ +K+ WR  H      W +L     
Sbjct: 482 IPRDVIREAKSWYNESVKHKSTFGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTVR 540

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD---CSYL--NTAT 584
             +        ++      L +RR    + I LPS R + Y     +    +Y+  N+ +
Sbjct: 541 TAIATP-----QKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPIIEKGNITYMGVNSYS 595

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE+++E PDT  F+ 
Sbjct: 596 RKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFND 655

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 656 KALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|303239094|ref|ZP_07325624.1| DNA-directed DNA polymerase [Acetivibrio cellulolyticus CD2]
 gi|302593432|gb|EFL63150.1| DNA-directed DNA polymerase [Acetivibrio cellulolyticus CD2]
          Length = 649

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 220/702 (31%), Positives = 328/702 (46%), Gaps = 81/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L   GV+ Y  A    I L  YAWDD+PV+L D      +P  ++
Sbjct: 1   MRTLAIDIETFSSVDLTSCGVYTYTAAPDFQILLFGYAWDDDPVELIDLACGERLPDAIV 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             +    V+  A N+ FERI   K L   + +  W CT++ A   GLP  L     AL  
Sbjct: 61  NAIESPEVIKTAFNAGFERICLSKHLNKHLKADSWRCTAIQAAMLGLPLHLDGVGTALKL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
                K   GK LI  F   CK +  +        +H  + WQ F +YC RDVE  RE+ 
Sbjct: 121 KVQ--KDRAGKDLIRYFSIPCKSTKSNGGRTRNLPHHAPEKWQKFKDYCVRDVEVEREVR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           +++   P+ + E  LWLLDQ IND G  +D+ LV +  +   Q   +L+ +    T   +
Sbjct: 179 RKIERYPIPEKELKLWLLDQKINDTGVLVDMALVNQAVKCDTQYSSRLEVEAK--TLTKL 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G+++  +S+  ++++L+ ++     + L+  R   + S+I K 
Sbjct: 237 DNPNSVAQLKEWLKE-QGLEVESLSKQAVQNLLTDADG--EIERLLTLRQEMAKSSIAKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  +V  D R+RG  QFYGA+RTGRW+G +FQ QNLP+    +  + + +    R + 
Sbjct: 294 AAVQRSVCPDSRVRGLFQFYGANRTGRWAGRIFQIQNLPQNHMKDLEIARMLVKQGRFKE 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S+ +R+ +I   G + +VAD + IEARVLAW+A E W +  F     I
Sbjct: 354 LELLYESVPIVLSELIRTVLIPEQGCRFIVADFSAIEARVLAWLANEAWVLDTFKGHGKI 413

Query: 409 YVTTYAKAFNTPIDKVSK-----EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
           Y  T ++ F  P++K++K     E RA GKV  LA GYQGG    K M +          
Sbjct: 414 YEQTASRMFGVPVEKIAKGNPEYELRAKGKVAVLACGYQGGVNALKAMGADK-------- 465

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                             L  T  + + +AWR+ +Q +++ W D
Sbjct: 466 --------------------------------MGLSDTELDDIVRAWRSANQRIVRFWYD 493

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD------- 576
           + +     V+E           V  L  +     + I LPS RRL Y   K +       
Sbjct: 494 VEKAAVLAVREREPQR------VGILRFKVENGILFITLPSGRRLAYIRPKIEKDLRFDK 547

Query: 577 --CSYLN-TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
              +Y       Q  R++TYGG+L ENIVQ  +RD L E M      GY IV  VHDEI+
Sbjct: 548 DGLTYEGLGINKQWWRQKTYGGRLVENIVQGAARDCLAEAMLRVDAKGYKIVGHVHDEII 607

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +E       S+  LC +M +   WA GLPL+A+G+E   Y+K
Sbjct: 608 TEMRKGQ-GSLEELCGIMGQEIPWALGLPLRADGFETMFYKK 648


>gi|191173996|ref|ZP_03035513.1| DNA polymerase [Escherichia coli F11]
 gi|190905687|gb|EDV65309.1| DNA polymerase [Escherichia coli F11]
 gi|324014350|gb|EGB83569.1| hypothetical protein HMPREF9533_01582 [Escherichia coli MS 60-1]
          Length = 687

 Score =  505 bits (1301), Expect = e-141,   Method: Composition-based stats.
 Identities = 261/691 (37%), Positives = 373/691 (53%), Gaps = 24/691 (3%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           + L+ D+ET    P+   G  AYAE   + L A+A +DEPV +WD T    +P  L + +
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDEPVNVWDITAGGGIPHGLYEAI 61

Query: 62  RDETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
                +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +
Sbjct: 62  AAPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQ 121

Query: 121 HLTKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP 179
              K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 180 LSDG--ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQ 237
            +    E  LW  DQ INDRG  +D+ L     E + QE+K+L +   ++TDG ++++ Q
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDIQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 238 TYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE 297
             AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L +
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMK 301

Query: 298 AVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IA 354
            VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       
Sbjct: 302 GVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFD 361

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG-----EDIY 409
           + + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF         D+Y
Sbjct: 362 NIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLY 421

Query: 410 VTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
              YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +      
Sbjct: 422 KLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPN 481

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
              +   +A+S +     +   F + +++   AC+ +K+ WR  H      W +L     
Sbjct: 482 IPRDVIREAKSWYNESVKRKSTFGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTVR 540

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTAT 584
             +        ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ +
Sbjct: 541 TAIATP-----QKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYS 595

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE+++E PDT  F+ 
Sbjct: 596 RKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITEAPDTEDFND 655

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 656 KALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|331654014|ref|ZP_08355015.1| putative DNA polymerase (P45) [Escherichia coli M718]
 gi|331048863|gb|EGI20939.1| putative DNA polymerase (P45) [Escherichia coli M718]
          Length = 687

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 256/691 (37%), Positives = 371/691 (53%), Gaps = 24/691 (3%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           + L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  RDETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
                +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +
Sbjct: 62  AAPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQ 121

Query: 121 HLTKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP 179
              K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 180 LSDG--ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQ 237
            +    E  LW  DQ INDRG  +D++L     + + QE+K+L +   ++TDG ++++ Q
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 238 TYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE 297
             AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L +
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMK 301

Query: 298 AVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IA 354
            VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       
Sbjct: 302 GVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFD 361

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG-----EDIY 409
           + + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF         D+Y
Sbjct: 362 NIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLY 421

Query: 410 VTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
              YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL   +      
Sbjct: 422 KLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDGLANAALPN 481

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
              +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L     
Sbjct: 482 IPRDVIREAKSWYDESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELECTVR 540

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD---CSYL--NTAT 584
             +        ++      L +RR    + I LPS R + Y     +    +Y+  N+ +
Sbjct: 541 TAIATP-----QKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEQGNITYMGVNSYS 595

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE+++E+PDT  F+ 
Sbjct: 596 RKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDTEDFND 655

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 656 KALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|331648300|ref|ZP_08349389.1| putative DNA polymerase (P45) [Escherichia coli M605]
 gi|331042849|gb|EGI14990.1| putative DNA polymerase (P45) [Escherichia coli M605]
          Length = 687

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 259/691 (37%), Positives = 373/691 (53%), Gaps = 24/691 (3%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           + L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +
Sbjct: 3   NILWGDLETYCDIPI-NNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  RDETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
            D   +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +
Sbjct: 62  ADPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQ 121

Query: 121 HLTKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP 179
              K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE+ KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVCKRLPK 181

Query: 180 LSDG--ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQ 237
            +    E  LW  DQ INDRG  +D+ L     E + QE+K+L +   ++TDG ++++ Q
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDMQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 238 TYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE 297
             AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L +
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMK 301

Query: 298 AVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IA 354
            VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       
Sbjct: 302 GVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFD 361

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG-----EDIY 409
           + + L S  +R CIIA  GKK+VV+DL+ IE R+LAW+AGE+WK+ AF         D+Y
Sbjct: 362 NIMELTSSALRGCIIAPTGKKMVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLY 421

Query: 410 VTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
              YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +      
Sbjct: 422 KLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPN 481

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
              +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L     
Sbjct: 482 IPRDVIREAKSWYGESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTVR 540

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTAT 584
             +        ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ +
Sbjct: 541 TAIATP-----QKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYS 595

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE+++E+PDT  F+ 
Sbjct: 596 RKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDTEDFND 655

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 656 KALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|194429286|ref|ZP_03061813.1| DNA polymerase [Escherichia coli B171]
 gi|194412694|gb|EDX28989.1| DNA polymerase [Escherichia coli B171]
          Length = 687

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 258/691 (37%), Positives = 374/691 (54%), Gaps = 24/691 (3%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           + L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  RDETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
            D   +   HNS F+R + +  +  +  P +RW  T V A  +GLP SL   C  L   +
Sbjct: 62  ADPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQ 121

Query: 121 HLTKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP 179
              K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 180 LSDG--ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQ 237
            +    E  LW  DQ INDRG  +D++L     + + QE+K+L +   ++TDG ++++ Q
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 238 TYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE 297
             AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L +
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMK 301

Query: 298 AVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IA 354
            VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       
Sbjct: 302 GVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFD 361

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG-----EDIY 409
           + + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF         D+Y
Sbjct: 362 NIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLY 421

Query: 410 VTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
              YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL + +      
Sbjct: 422 KLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPN 481

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
              +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L     
Sbjct: 482 IPRDVIREAKSWYDESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELERTVR 540

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCSYL--NTAT 584
             +        ++      L +RR    + I LPS R + Y      KG+ +Y+  N+ +
Sbjct: 541 TAIATP-----QKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYS 595

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R +TYGGKL ENI QA +RDIL   M      GY IVLTVH+E+++E PDT  F+ 
Sbjct: 596 RKWQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHNEVITEAPDTEDFND 655

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +L++ +P WA  +PL A G+EA  Y+K
Sbjct: 656 KALSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|197303496|ref|ZP_03168535.1| hypothetical protein RUMLAC_02218 [Ruminococcus lactaris ATCC
           29176]
 gi|197297494|gb|EDY32055.1| hypothetical protein RUMLAC_02218 [Ruminococcus lactaris ATCC
           29176]
          Length = 661

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 192/716 (26%), Positives = 303/716 (42%), Gaps = 98/716 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +L ID+ET S   + K G + YAE     I L   + D+ PV ++D      +P+++L
Sbjct: 2   MKELSIDLETYSDIDISKCGAYKYAESNNFEILLFGVSVDNGPVVVYDLASGDEIPAEIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID------------------IPSKRWICTSVLA 100
             L DE ++  A N+ FER+     L                     +    W CT + +
Sbjct: 62  AALSDENIIKWAFNASFERVCLSNWLRKHHPEYFKTYNTQGDPVQNFLDPASWKCTMIWS 121

Query: 101 RTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFC---KGSIDSPPYDCTRANH-VQAW 156
              GLP SL+     L   +   KM+EGK LI  FC   K +  +         H    W
Sbjct: 122 AYMGLPLSLEGVGAVLKLQDQ--KMKEGKDLIKYFCSPCKPTKVNGGRTRNLPEHAPDKW 179

Query: 157 QLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIA 214
           + F  Y +RDVE    + +RL   P+ D     + +DQ IND G  +D+D+V        
Sbjct: 180 ETFKTYNRRDVEVELAIKQRLSKFPVPDSVWHEYHIDQEINDSGIMLDMDVVENAIAFDE 239

Query: 215 QERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLA 274
           + +  L   +  +T+  + +      ++ +L    G++   + +  +  ++  ++     
Sbjct: 240 RSKSALITAMKNITN--LDNPNSVVQMKQWLSD-NGVETESLGKKEVAGLIKETDGD--I 294

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
              +  RL  + S++ K   +  AV  DGR  G  QFYGA+R+GRW+G + Q QNLP+  
Sbjct: 295 SKALKLRLQLAKSSVKKYQAMQNAVCKDGRAHGMFQFYGANRSGRWAGRLIQLQNLPQNH 354

Query: 335 RSEEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
            S+    + +      +T      D     S  +R+  IA  G K +V+D + IEARVLA
Sbjct: 355 MSDLTEARELVRTGDYDTLDMLYDDIPDTLSQLIRTAFIARPGYKFIVSDYSAIEARVLA 414

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVF 448
            +AGE W+ K FA G+DIY  + ++ F  P+ K   +   R  GK+ ELALGY G     
Sbjct: 415 HLAGETWRSKVFAEGKDIYCASASQMFGVPVKKHGINSHLRQKGKIAELALGYGGSVGAL 474

Query: 449 KTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKK 508
           K+M                                         A++  L     + +  
Sbjct: 475 KSMG----------------------------------------ALEMGLTEEELQPLVD 494

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRL 568
           +WR+ +  +   W ++       ++            V  +        + I  PS R L
Sbjct: 495 SWRSSNPMITAFWWNVDNAIKTAIKMHIPTE------VNGIHFCYKSGMLLIKRPSGRVL 548

Query: 569 VYSDVKGDCSYLNTA---------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK 619
            Y   K   +              T +  R  +YG K  ENIVQA+SRDILC  MK    
Sbjct: 549 SYVKPKIGENRFGGESVTYEGIGSTKKWERIESYGPKFVENIVQAVSRDILCNAMKTL-- 606

Query: 620 NGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               IV  VHDE++ E   +    +  +C  M ++  W  G+ L+A+GYE   Y+K
Sbjct: 607 RHCFIVGHVHDELIIEC--SSGVDLNEICKQMGRSLDWMPGILLRADGYETNFYKK 660


>gi|227530261|ref|ZP_03960310.1| DNA-directed DNA polymerase [Lactobacillus vaginalis ATCC 49540]
 gi|227349815|gb|EEJ40106.1| DNA-directed DNA polymerase [Lactobacillus vaginalis ATCC 49540]
          Length = 644

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 194/698 (27%), Positives = 302/698 (43%), Gaps = 78/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M ++ IDIET S   L + GV+ YA+     + L  YA D  PVK+ D T+  ++P  ++
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSKDFELLLFGYAIDFGPVKVIDLTQGESIPPQVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D T++  A N+ FER+   + +   +    W C+ V + T GLP SL++    L  
Sbjct: 61  KALDDPTIIKSAFNAQFERVCLSRFVSHRLKPAGWHCSRVWSATLGLPLSLRDVGSVLGL 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTR-ANHVQAWQLFGEYCKRDVEATRELF 174
                    GK L+  F   CK +  +         +    WQ F +Y +RDVE   E+ 
Sbjct: 121 PRQKI--TAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEIT 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           ++L   P+   E + + +DQ INDRG RID  LV    +       +  +   +LT   +
Sbjct: 179 QKLECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKELTG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L     I    +S+ ++  +L  +  T     ++  R   S S+I K 
Sbjct: 237 ANPNSPLQLKDWL-QQQDIKTNSLSKASVAQLLQTTTGT--VHQVLALRQLLSKSSIKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             + +A+  DGR+ G LQFYGA+RTGRW+G + Q QNLPR    +    + +        
Sbjct: 294 QAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNVPA 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     + S  +R+  I S      VAD + +EARV+AW++ E W+ ++FA  EDI
Sbjct: 354 LAMLYDSVPDVLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEKWRQESFAKNEDI 413

Query: 409 YVTTYAKAFNTP--IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F  P     ++ E R  GK+ ELALGY G     K M +             
Sbjct: 414 YCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATN----------- 462

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                          L       + + WR     ++Q W D+ +
Sbjct: 463 -----------------------------LGLTDDELPPLVQMWRNASPHIVQFWWDVDK 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYL------ 580
                ++     +         +        + + L S R L Y   K   +        
Sbjct: 494 AAKECIKTHLPQTT------HGMKFIYRSGCMFLRLRSGRYLCYPQPKIGINRFGSESIT 547

Query: 581 ---NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
              N    +  R  TYG KL ENIVQA SRD+L E M+        +V+ +HDE V + P
Sbjct: 548 FMGNNTVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATENTVVMHIHDEAVIDAP 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                S+ T+  LMT+ P WA GL L A G+ +  Y+K
Sbjct: 608 SNR--SLDTMVQLMTEVPDWANGLILNAAGFVSDFYKK 643


>gi|325687766|gb|EGD29787.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK72]
          Length = 643

 Score =  503 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 214/699 (30%), Positives = 333/699 (47%), Gaps = 81/699 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y +     I L AY  D+   ++ D  +   +P ++L
Sbjct: 1   MKTLSIDIETYSDVDLTKCGVYRYVDSLAFEILLFAYKEDENETQVVDLVQGEQIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D+ ++  A N+ FER+   K LG  + +K W CT+VLA + GLP SL+     LN 
Sbjct: 61  LALLDDAIIKTAFNANFERVCLSKFLGEHLSAKSWSCTAVLAASLGLPLSLEGVGRVLNI 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
            E   KM+EG  LI  F   CK +  +   +    +H  + W+LF  YCKRDVE  + + 
Sbjct: 121 EEQ--KMKEGSRLIRYFCLPCKATKANGMRERNFPHHAPEDWELFKSYCKRDVEVEQAIR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            RL   PL + E+  + LDQ INDRG  +D  LV +        ++++ +   +L+    
Sbjct: 179 VRLRNYPLLESEQFFYQLDQEINDRGIEVDQQLVEQAILCDLSYKEQVTKRAYELSGLE- 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G+ +  + +  +   L  ++      +++  RL  S +++ K 
Sbjct: 238 -NPNSVSQLKGWL-EEQGVFMDSLGKKEVAKHLKEADG--EVLEMLKLRLLMSKTSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +   V SDGR+ G LQFYGA+RTGRW+G + Q QNLP+ +  +  L +T+    + ET
Sbjct: 294 QAIERCVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLSLARTLVKEGQFET 353

Query: 353 IA----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
           +     +  G+ S+ +R+  +   G + +VAD A IEARVLAW++GE W+++ F  G DI
Sbjct: 354 LDTLYENVPGVLSELIRTAFVPKAGHQFIVADFAAIEARVLAWLSGESWRLEVFEQGGDI 413

Query: 409 YVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQFSQN 465
           Y  + +  F  P++K   +   R  GK+ ELALGY G       M +   GL+ ++    
Sbjct: 414 YCASASSMFGVPVEKHGANSHLRQKGKIAELALGYGGSVGALTAMGALDMGLEEEEL--- 470

Query: 466 VKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLT 525
                                                 + +   WR+ +  ++  W ++ 
Sbjct: 471 --------------------------------------QPLVNQWRSANPHIVAFWWEID 492

Query: 526 EGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTA-- 583
           +              R    +  LV+      + I LPS R+L Y   +   +       
Sbjct: 493 KVAKQ------VYETREPKKIKNLVISYQSGMLFITLPSGRKLAYVKPRMGMNAFGKPGL 546

Query: 584 -------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
                  + +  R  TYG KL ENIVQ I+RD+L  GM    + G  IVL VHDE V E 
Sbjct: 547 TYEGIGESKKWTRLETYGPKLVENIVQGIARDLLAYGMIQLKQKGLAIVLHVHDEAVVEV 606

Query: 637 PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +    SV  +C L+   P WA+GLPL+A+GY  + Y+K
Sbjct: 607 RE---ESVAKVCQLLATKPDWAEGLPLRADGYACEFYKK 642


>gi|320530602|ref|ZP_08031654.1| DNA-directed DNA polymerase [Selenomonas artemidis F0399]
 gi|320137129|gb|EFW29059.1| DNA-directed DNA polymerase [Selenomonas artemidis F0399]
          Length = 653

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 221/700 (31%), Positives = 326/700 (46%), Gaps = 76/700 (10%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L ID+ET S   +  VG + YAE A I L AYAWDD PV++ D T +  +P+D+L  L 
Sbjct: 2   ILSIDLETYSALDIKTVGGYRYAENAEILLFAYAWDDTPVQIVDLTAEETIPADVLSALT 61

Query: 63  DETVMCVAHNSLFERILFKKTLGID------IPSKRWICTSVLARTNGLPSSLKNACLAL 116
           D  +M  A N+ FER +    L  +      +    W CT V A T GLP SL      L
Sbjct: 62  DNDIMKCAFNAQFERTVLSHYLHKEGEPFAFLDPAGWSCTMVHALTLGLPGSLAEVSKTL 121

Query: 117 NFSEHLTKMEEGKALIARFCKGSI----DSPPYDCTRANHVQAWQLFGEYCKRDVEATRE 172
              E   KM  G  LI  FCK       +         +  + W  F  YC RDVEA RE
Sbjct: 122 KLGEEKEKMSVGTQLITYFCKPCKPTKSNGGRTRNLPNDAPEKWATFKAYCVRDVEAERE 181

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + +RL   P+ + ER LW LDQ INDRG RID  L        +  R ++  +   L+  
Sbjct: 182 VRRRLSGYPVPETERALWALDQRINDRGVRIDEILAQNAIAFDSAFRAEVTAEASALSGL 241

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
              +      L+ +++   G   + +++ T+  ++  +      K ++  ++  S +++ 
Sbjct: 242 E--NPNSGEQLKHWIYEQEGARPLSLTKETIPELIETAKSET-VKTMLQLKMLLSKTSVK 298

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   + +A  SDGR  G LQFYGA+RTGRW+G + Q QNLPR   +E    + +      
Sbjct: 299 KYEAMVQAQCSDGRAHGLLQFYGANRTGRWAGRLVQVQNLPRNTMAELDDARALLRCGDT 358

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +       +P  + S  +R+  I + G +  VAD + IEARV+AW+AGE W++  FA+G 
Sbjct: 359 DALEMLFDNPPDVLSQLIRTAFIPAVGMRFTVADFSAIEARVIAWLAGEKWRMDVFADGG 418

Query: 407 DIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           DIY  + +K F+ P++K   +   R  GKV ELALGY GG    K M +           
Sbjct: 419 DIYCASASKMFHVPVEKHGVNGHLRQKGKVAELALGYGGGVSALKRMGADK--------- 469

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                                            L     E +K++WR     +++LW D 
Sbjct: 470 -------------------------------LGLTDAELEEIKQSWRKASPRIVRLWSDF 498

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD-------- 576
                  V+E  ++S +       + +      + I LPS R L Y   + +        
Sbjct: 499 ESAALEAVRERSTVSLQ-----HGIKLECRSGILFIRLPSGRSLAYVKPRIEYEESFDRE 553

Query: 577 -CSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
             +Y         ++RTYGG+L EN +QAI+RD L   M      GY IV+ +HDE+V E
Sbjct: 554 GLTYYGRDVGGWGKQRTYGGRLVENAIQAIARDCLAVAMTRLEAAGYPIVMHIHDEVVVE 613

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           TP +    +  +C +M+K   WA GL L A+GY    Y+K
Sbjct: 614 TPRS-VDCLADVCEIMSKPVDWAPGLVLTADGYTTNYYKK 652


>gi|327461124|gb|EGF07457.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK1057]
          Length = 643

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 214/699 (30%), Positives = 333/699 (47%), Gaps = 81/699 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y +     I L AY  D+   ++ D  +   +P ++L
Sbjct: 1   MKTLSIDIETYSDVDLTKCGVYRYVDSLAFEILLFAYKEDENETQVVDLVQGEQIPEEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D+ ++  A N+ FER+   K LG  + +K W CT+VLA + GLP SL+     LN 
Sbjct: 61  LALLDDAIIKTAFNANFERVCLSKFLGEHLSAKSWSCTAVLAASLGLPLSLEGVGRVLNI 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
            E   KM+EG  LI  F   CK +  +   +    +H  + W+LF  YCKRDVE  + + 
Sbjct: 121 EEQ--KMKEGSRLIRYFCLPCKATKANGMRERNFPHHAPEDWELFKSYCKRDVEVEQAIR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            RL   PL + E+  + LDQ INDRG  +D  LV +        ++++ +   +L+    
Sbjct: 179 VRLRNYPLLESEQFFYQLDQEINDRGIEVDQQLVEQAILCDLSYKEQVTKRAYELSGLE- 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G+ +  + +  +   L  ++      +++  RL  S +++ K 
Sbjct: 238 -NPNSVSQLKGWL-EEQGVFMDSLGKKEVAKHLKEADG--EVLEMLKLRLLMSKTSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +   V SDGR+ G LQFYGA+RTGRW+G + Q QNLP+ +  +  L +T+    + ET
Sbjct: 294 QAIERCVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLSLARTLVKEGQVET 353

Query: 353 IA----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
           +     +  G+ S+ +R+  +   G + +VAD A IEARVLAW++GE W+++ F  G DI
Sbjct: 354 LDTLYENVPGVLSELIRTAFVPKAGHQFIVADFAAIEARVLAWLSGESWRLEVFEQGGDI 413

Query: 409 YVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMAS-HCGLDLQQFSQN 465
           Y  + +  F  P++K   +   R  GK+ ELALGY G       M +   GL+ ++    
Sbjct: 414 YCASASSMFGVPVEKHGANSHLRQKGKIAELALGYGGSVGALTAMGALDMGLEEEEL--- 470

Query: 466 VKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLT 525
                                                 + +   WR+ +  ++  W ++ 
Sbjct: 471 --------------------------------------QPLVNQWRSANPHIVAFWWEID 492

Query: 526 EGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTA-- 583
           +              R    +  LV+      + I LPS R+L Y   +   +       
Sbjct: 493 KVAKQ------VYETREPKKIKNLVISYQSGMLFITLPSGRKLAYVKPRMGMNAFGKPGL 546

Query: 584 -------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
                  + +  R  TYG KL ENIVQ I+RD+L  GM    + G  IVL VHDE V E 
Sbjct: 547 TYEGIGESKKWTRLETYGPKLVENIVQGIARDLLAYGMIQLKQKGLAIVLHVHDEAVVEV 606

Query: 637 PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +    SV  +C L+   P WA+GLPL+A+GY  + Y+K
Sbjct: 607 RE---ESVAKVCQLLATKPDWAEGLPLRADGYACEFYKK 642


>gi|150391701|ref|YP_001321750.1| DNA-directed DNA polymerase [Alkaliphilus metalliredigens QYMF]
 gi|149951563|gb|ABR50091.1| DNA-directed DNA polymerase [Alkaliphilus metalliredigens QYMF]
          Length = 649

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 207/702 (29%), Positives = 308/702 (43%), Gaps = 84/702 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           +  L  DIET S   L K GV+ Y  A+   I L AY+ D   VK+ D      +P  +L
Sbjct: 4   IKTLHCDIETYSSVNLAKCGVYRYVQADDFEILLFAYSTDGSEVKIIDLARGEKIPPLIL 63

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----IPSKRWICTSVLARTNGLPSSLKNACL 114
             L D+ V+  AHN+ FERI F + LG      I  + W CT   A   GLP SL     
Sbjct: 64  SALEDDKVIKYAHNASFERICFSRFLGYPVGKYISPESWRCTMTWAAYMGLPLSLVGVGA 123

Query: 115 ALNFSEHLTKMEEGKALIARFCKGSIDSPPY----DCTRANHVQAWQLFGEYCKRDVEAT 170
            L       KM EGK LI  FC     +           ++  + W+ F  Y  RDVEA 
Sbjct: 124 VLGLG--KQKMTEGKDLIRFFCGPCSPTKTNGNRTRNLPSDDPEKWERFKSYNIRDVEAE 181

Query: 171 RELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
            E+ ++L   P+ D   D + L + IND G ++D+D V +   +      KL + + +  
Sbjct: 182 MEIEQKLIKFPVPDFIWDEYHLSERINDSGIKVDMDFVKQAIAMNEISHTKLMDQMQE-- 239

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
              + +      ++ +L    G++   + +  +  +L  +       +++  R   + S+
Sbjct: 240 ITELDNPNSVQQMKDWLSD-NGLETDTLGKKAVAELLKDAPEH--LAEVLKLRQQLAKSS 296

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   +  AV SDGR+RG   F GA+RTGR+S  + Q QNLP+    +    ++I    
Sbjct: 297 VKKYTAMENAVCSDGRIRGMFTFLGANRTGRFSSKIVQLQNLPQNHMMDLKEARSIVKNG 356

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             E       D     S  +R+  +   G K +VAD + IEARVL+W+AGE W+ + FAN
Sbjct: 357 DSEALELLYEDIPDTLSQLIRTAFVPKEGNKFIVADFSAIEARVLSWLAGEQWRNEVFAN 416

Query: 405 GEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           G DIY  + ++ F  P++K   +   R  GK+ ELALGY G     K M +      ++ 
Sbjct: 417 GGDIYCASASQMFRVPVEKHGVNAHLRQKGKIAELALGYGGSVGALKAMGALEMGLEEEE 476

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                                    + +  AWRA +  +++ W 
Sbjct: 477 L----------------------------------------KPLVNAWRASNPNIVKFWW 496

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN- 581
           D+       ++E       +   V  +        + IVLPS R+L Y       +    
Sbjct: 497 DVDREVKKCIKEK------KSQEVQNIKFHYMSGMLFIVLPSGRKLAYVKPNIGENIFGG 550

Query: 582 --------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                    AT +  R  +YG K  ENIVQAISRDIL   MK    +   IV  VHDE++
Sbjct: 551 ESVTYEGVGATKKWERIESYGPKFVENIVQAISRDILMYAMKTL--STCSIVAHVHDEVI 608

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            E       S+  +C  M + P WAKGL L A+GYE   Y+K
Sbjct: 609 IEA--DQSLSLDMVCKQMGRVPPWAKGLLLDADGYECDFYKK 648


>gi|260845239|ref|YP_003223017.1| putative DNA polymerase [Escherichia coli O103:H2 str. 12009]
 gi|257760386|dbj|BAI31883.1| putative DNA polymerase [Escherichia coli O103:H2 str. 12009]
          Length = 687

 Score =  502 bits (1292), Expect = e-139,   Method: Composition-based stats.
 Identities = 255/691 (36%), Positives = 371/691 (53%), Gaps = 24/691 (3%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           + L+ D+ET    P+   G  AYAE   + L A+A +D PV +WD T    +P  L + +
Sbjct: 3   NILWGDLETYCEIPI-TNGTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAI 61

Query: 62  RDETVMCVAHNSLFERILFKKTLG-IDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
                +   HNS F+R + +  +  +  P +RW  T V A  +GLP +L   C  L   +
Sbjct: 62  AAPETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGALGELCEVLGVPQ 121

Query: 121 HLTKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP 179
              K +EGKALI  FCK    +S     T   H + W+ F  Y   D+EA RE++KRL  
Sbjct: 122 DKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPK 181

Query: 180 LSDG--ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQ 237
            +    E  LW  DQ INDRG  +D++L     + + QE+K+L +   ++TDG ++++ Q
Sbjct: 182 WNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQ 241

Query: 238 TYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE 297
             AL  ++    G++L DM   TL+  ++  ++    K+L+  RL +S ++  K   L +
Sbjct: 242 RDALIKHIVESYGVELPDMQRSTLERRIADPDLPSAVKELLAIRLQASTTSTSKYKALMK 301

Query: 298 AVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IA 354
            VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E + + I+AL  G       
Sbjct: 302 GVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFD 361

Query: 355 DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG-----EDIY 409
           + + L S  +R CIIA  GKKLVV+DL+ IE R+LAW+AGE+WK+ AF         D+Y
Sbjct: 362 NIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLY 421

Query: 410 VTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
              YAKAF+   D V K  R IGKVMEL LGY GG   F T A   GLDL   +      
Sbjct: 422 KLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDGLANAALPN 481

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
              +   +A+S +     +   + + +++   AC+ +K+ WR  H      W +L     
Sbjct: 482 IPRDVIREAKSWYDESVKRKSTYGLSERVFI-ACDSLKRLWRRAHPATCDFWYELECTVR 540

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD---CSYL--NTAT 584
             +        ++      L +RR    + I LPS R + Y     +    +Y+  N+ +
Sbjct: 541 TAIATP-----QKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEQGNITYMGVNSYS 595

Query: 585 SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSV 644
            +  R +TYGGKL EN+ QA +RD+L   M      GY IVLTVHDE+++E+PDT  F+ 
Sbjct: 596 RKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDTEDFND 655

Query: 645 GTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             L +L++ NP WA  +PL A G+EA  YRK
Sbjct: 656 KALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|300933386|ref|ZP_07148642.1| DNA-directed DNA polymerase [Corynebacterium resistens DSM 45100]
          Length = 653

 Score =  501 bits (1291), Expect = e-139,   Method: Composition-based stats.
 Identities = 222/708 (31%), Positives = 320/708 (45%), Gaps = 89/708 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +LF+D+ET SP  L K GV+ YAE     + L  Y+ D  PVK+ D      +P++++
Sbjct: 1   MHELFVDLETFSPVNLTKSGVYPYAEHPDFDVLLFGYSIDGNPVKVVDVASSEQLPAEVV 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----------IPSKRWICTSVLARTNGLPSS 108
           + L D  V   A N+ FER+     L             +   +W CT V +   GLP S
Sbjct: 61  EALVDPGVTKWAFNAAFERVCLSAWLARHHPDLIAGRNFLDPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKNACLALNFSEHLTKMEEGKALIARFCKGSI----DSPPYDCTRANHVQAWQLFGEYCK 164
           L+     L+    + K   GK LI RFC  +     +        A+    W+ F  Y +
Sbjct: 121 LEQVATVLDLP--VRKDSAGKKLITRFCTPARPSVLNQGEMRNLPASDPDGWEQFISYNR 178

Query: 165 RDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           RDVE    +  RL   P+ + E   + LDQ IND G R+D  LV    +   Q R     
Sbjct: 179 RDVEVELAIHDRLAGFPMPEAEWATYALDQNINDTGIRLDRVLVDHAVQCDRQHRATTLA 238

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
              +LT     +      L+ +L    G  L  +++  + + L  +      ++++  R 
Sbjct: 239 RAQELTGLE--NPNSPIQLKDWLT-AHGTPLQSLTKDEVAAALDTATG--EVREVLQLRG 293

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
             + S++ K  T+      DGR RG LQFYGA RTGR++G + Q QNLPR    +    +
Sbjct: 294 ELAKSSVKKYETMQHVAGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPDLCEAR 353

Query: 343 TIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
            +      E             S  +R+  + ++G + VVAD + IEARV+AW+AGE   
Sbjct: 354 DLVRTGEFEAVELLYDSVPDTLSQLIRTAFVPADGHRFVVADFSAIEARVIAWLAGEATT 413

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCG 456
           ++AF +G+D+Y  T ++ F  P+DK   + E R  GK+  LA GYQGG    K M     
Sbjct: 414 LQAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGALKAMG---- 469

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
                                               A++  L  +  + +  AWRA +  
Sbjct: 470 ------------------------------------ALRMGLAESELQPLVDAWRAANPN 493

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           V+QLW D+             IS R+   V  L        + + LPS RRL Y   K G
Sbjct: 494 VVQLWADINAAAIEA------ISTRQPTGVGALTFTVESGIMFVRLPSGRRLAYVKPKLG 547

Query: 576 DCSYLNTAT--------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLT 627
           +  +  TA          +  +  TYGGKLTENIVQA++RD+L  GM    + GY IV+ 
Sbjct: 548 ENRFGGTAITHEGIATGRKWGQLETYGGKLTENIVQAVARDLLTFGMHQVDRAGYRIVMH 607

Query: 628 VHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           VHDEIV ET      +V  +C LM   P WA GLPL A+GY    Y K
Sbjct: 608 VHDEIVVET---ATATVDEICELMATAPDWAAGLPLAADGYACDFYMK 652


>gi|313896425|ref|ZP_07829976.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312974849|gb|EFR40313.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 650

 Score =  501 bits (1290), Expect = e-139,   Method: Composition-based stats.
 Identities = 203/714 (28%), Positives = 308/714 (43%), Gaps = 104/714 (14%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L ID+ETRS   + K GV+ YAE     I L  Y+ D   V++ D      +P ++L
Sbjct: 1   MESLSIDLETRSSVDIGKSGVYRYAEAEDFAILLFGYSVDGGAVQVIDIANGEQIPQEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKT---LGIDIP-----------------SKRWICTSV 98
             L DE+V+  A N+ FER+   +    LGI +                     W CT V
Sbjct: 61  DALTDESVIKWAFNANFERVCLSRYLSDLGIALDPFHDNHPLSTECARFLSPHSWRCTMV 120

Query: 99  LARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQL 158
            +   GLP SL      L   E   KM EGKALI  F       P            W L
Sbjct: 121 WSAYMGLPLSLAGVGRVLGLEEQ--KMNEGKALIRYFSTPPFHEPTGA--------KWDL 170

Query: 159 FGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
           F  Y +RDVE    + KRL   P+     + ++LDQ INDRG R+D+ LV    ++  + 
Sbjct: 171 FKSYNRRDVEVEMAIQKRLSKYPVPQSVWEEYVLDQEINDRGIRLDMPLVENAVQIDVRT 230

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKD 276
           ++KL + +  LT     +      ++ +L    G++   + + ++ ++L  +N+    K+
Sbjct: 231 KEKLTDRLKTLTSLE--NPNSVTQMKAWLKE-QGVETESLDKKSVTALL--ANVPDPLKE 285

Query: 277 LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERS 336
           ++  R   + S++ K   +   V SDGR RG  QFYGA+RTGR+SG   Q QNLP+   +
Sbjct: 286 VLELRQQLAKSSVKKYQAMQNTVCSDGRARGMFQFYGANRTGRFSGRHIQLQNLPQNHLA 345

Query: 337 EEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
           +    +++                  + S  +R+  I+  G+K +VAD + IEARVL+W+
Sbjct: 346 DLEYARSLVRQGSFAALELLYESVPDVLSQLIRTAFISKEGRKFIVADFSAIEARVLSWL 405

Query: 393 AGEDWKIKAFANGEDIYVTTYAKA--FNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKT 450
           A E W++  FAN  DIY  T  +    N      +   R  GK+ EL+ GY G     K 
Sbjct: 406 AKERWRMDVFANDGDIYCATAGRMFHCNVVKHGENGHLRQYGKLAELSSGYGGSVGALKA 465

Query: 451 MASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
                                                     A++  +       +  AW
Sbjct: 466 FG----------------------------------------ALESGMKEEELNPLVDAW 485

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           RA +  ++  W  +       ++E  +     +              + I LP  RRL Y
Sbjct: 486 RAANPNIVDFWWAVDRATKDCIKERSTKVTHGIR------FIYQGSMMFIELPCGRRLAY 539

Query: 571 SDVKGDCSYLNTA---------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNG 621
              +   +              + +  R  +YG KL EN+ QAISRDILC  M+      
Sbjct: 540 VKPRIGENQFGGESVTYMGLNLSKKWARIESYGPKLVENVTQAISRDILCYAMQTL--RT 597

Query: 622 YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            DIV  VHDE++ E       S+  +C  M + P WA GLPL+A+G+E + Y+K
Sbjct: 598 MDIVAHVHDELIIEC--DERVSLSAICEQMARTPPWADGLPLRADGFECQFYQK 649


>gi|331085755|ref|ZP_08334838.1| hypothetical protein HMPREF0987_01141 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406678|gb|EGG86183.1| hypothetical protein HMPREF0987_01141 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 646

 Score =  500 bits (1287), Expect = e-139,   Method: Composition-based stats.
 Identities = 204/697 (29%), Positives = 318/697 (45%), Gaps = 77/697 (11%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQ 59
             L IDIET S   L   GV+ Y+      I L AY+ DDE     D       P + ++
Sbjct: 3   RTLAIDIETYSDVDLISCGVYKYSSSPHFEILLIAYSVDDEETVCIDVANGEEPPKEFIE 62

Query: 60  YLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFS 119
            L D+TV   A N+ FER  F          + W CT+V A    LP SL+     L   
Sbjct: 63  MLFDDTVTKTAFNANFERTCFSNYYHHSFRPEAWRCTAVQATMLALPLSLEGVGAVLGL- 121

Query: 120 EHLTKMEEGKALIARFCKGSIDSPPY----DCTRANHVQAWQLFGEYCKRDVEATRELFK 175
               KM EGK LI  FC     +            +  + W+ F  YC RDV+  +++ +
Sbjct: 122 -DKQKMTEGKELIKYFCSPCKATKSNGGRTRNLPKDAPEKWRWFKTYCIRDVDVEKQIRQ 180

Query: 176 RL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIR 233
           RL   P+   E++++ LDQ INDRG  +D +LV          ++       +LT     
Sbjct: 181 RLAKFPIPKREQEIYCLDQRINDRGIMVDRNLVNHAVACDLLYKETATARAYELTGLE-- 238

Query: 234 SSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLN 293
           +      L+++L    G+++  +++ T+K +   +      ++++  RLA+S +++ K  
Sbjct: 239 NPNSVSQLKLWLKEK-GLEVDSLAKDTVKDLSMKAEGD--VQEVLKLRLATSKTSVKKYE 295

Query: 294 TLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET- 352
            +  +V ++ R+ G LQFYGA+RTGRW+G + Q  NLP+    +  L + + +  R E  
Sbjct: 296 AIDRSVCAENRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHLPDLELARALVSEGRYEEV 355

Query: 353 ---IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIY 409
                    + S+ +R+  +A  G + +++D + IEARVLAW+AGE+W+++ F     IY
Sbjct: 356 ELFYESTPNVLSELIRTAFVAKPGCRFIISDYSAIEARVLAWLAGEEWRLQVFETHGKIY 415

Query: 410 VTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVK 467
             + +  F+  I++++K    R  GK+ ELALGY G      +M                
Sbjct: 416 EASASAMFHVAIEEITKTSPLRQKGKISELALGYGGAVGALTSMG--------------- 460

Query: 468 STSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEG 527
                                    A+K  L       +   WR+ +  +   W  + E 
Sbjct: 461 -------------------------ALKMGLTEEELPGLVSTWRSANPHITAFWWAVDEA 495

Query: 528 FACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN------ 581
               V++       + + V R+        + + LPS R+L Y   +   +         
Sbjct: 496 AVTAVRDK------KPSKVGRVSFEYKSGILFVTLPSGRKLSYVKPRMMLNKFGREGLTY 549

Query: 582 ---TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD 638
                + + MR  TYG KL ENIVQA SRDIL E M    K G+DIV  VHDE+V E PD
Sbjct: 550 EGIGESKKWMRLETYGPKLVENIVQAASRDILAEAMLRLEKEGFDIVCHVHDEVVLEVPD 609

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               SV  +  +M  NP W +GLPLKA G+E+  Y+K
Sbjct: 610 GKS-SVEEVNEIMAVNPVWTEGLPLKAAGFESPFYKK 645


>gi|260579057|ref|ZP_05846956.1| prophage LambdaSa04, DNA polymerase [Corynebacterium jeikeium ATCC
           43734]
 gi|258602808|gb|EEW16086.1| prophage LambdaSa04, DNA polymerase [Corynebacterium jeikeium ATCC
           43734]
          Length = 653

 Score =  500 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 221/708 (31%), Positives = 315/708 (44%), Gaps = 89/708 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +LFIDIET SP  L   GV+ YA+     + L  Y+ D  PV++ D      +P  +L
Sbjct: 1   MRELFIDIETFSPVNLANSGVYPYADHDGFELLLFGYSIDGGPVEVVDLANGHQLPEKVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----------IPSKRWICTSVLARTNGLPSS 108
             L D  V+  A N+ FERI     L             +   +W CT V +   GLP S
Sbjct: 61  SALVDPLVVKWAFNATFERICLSSWLARQYPELMAGRRFLNPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKNACLALNFSEHLTKMEEGKALIARFCKGSI----DSPPYDCTRANHVQAWQLFGEYCK 164
           L      L+    + K   GK LI +FC        +        A+    W+ F  Y +
Sbjct: 121 LDQVATVLHLP--VRKDSAGKKLIRQFCTPGTPSVFNLGGMRNPPASDPDGWEQFISYNR 178

Query: 165 RDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           RDVE    +  RL   PL   E D + LDQ +ND G R+D  LV        Q R     
Sbjct: 179 RDVEVELAIHDRLADFPLPASEWDTYALDQNVNDTGIRLDRVLVDHAVACDRQHRATTLA 238

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
              +LT     +      L+ +L    G  L  +++  + + L  +      ++++L R 
Sbjct: 239 RAQELTGLE--NPNSPIQLKDWL-AAHGAPLQSLTKDEVAAALDTATGQ--VREVLLLRG 293

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
             + S++ K   +      DGR RG LQFYGA RTGR++G + Q QNLPR    +    +
Sbjct: 294 ELAKSSVKKYEAMQHVTGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPDLAEAR 353

Query: 343 TIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
           ++      E             S  +R+  I ++G + VVAD + IEARV+AW+AGE   
Sbjct: 354 SLVRTGDFEAVELLYDSVPDTLSQLIRTAFIPADGHRFVVADFSAIEARVIAWLAGETTT 413

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCG 456
           ++AF +G+D+Y  T ++ F  P+DK   + E R  GK+  LA GYQGG    K M     
Sbjct: 414 LEAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGALKAMG---- 469

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
                                               A++  L  +  + +  AWRA +  
Sbjct: 470 ------------------------------------ALRMGLAESELQPLVDAWRAANPS 493

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD 576
           V+QLW D+            +IS R+  +V  L        + I LPS RRL Y   K  
Sbjct: 494 VVQLWADINAAAIE------TISTRQPTSVGALTFTVESGIMFIRLPSGRRLAYVKPKLG 547

Query: 577 CSYLN---------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLT 627
            +            T   +  +  TYGGKLTENIVQA++RD+L   M    + G+ IV+ 
Sbjct: 548 ENRFGGTSITHEGITTGRKWGQLETYGGKLTENIVQAVARDLLTYAMHQVAEAGHRIVMH 607

Query: 628 VHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           VHDEIV ET      +V  +C LM+  P WA GLPL+A+GY    Y K
Sbjct: 608 VHDEIVVET---ATATVDEICKLMSTAPDWAAGLPLEADGYACDFYMK 652


>gi|298253796|ref|ZP_06977385.1| DNA polymerase I [Gardnerella vaginalis 5-1]
 gi|297532132|gb|EFH71105.1| DNA polymerase I [Gardnerella vaginalis 5-1]
          Length = 674

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 209/711 (29%), Positives = 316/711 (44%), Gaps = 96/711 (13%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L +D+ET S   L K GV+ YAE     I L  Y+ D   V++ D  +   +P  +L  L
Sbjct: 20  LSVDLETFSSVNLGKCGVYKYAESEDFEILLFGYSVDGSEVQVVDLAQGETIPEVVLSAL 79

Query: 62  RDETVMCVAHNSLFERILFKKTL----------------GIDIPSKRWICTSVLARTNGL 105
            DETV   A N+ FERI   + L                G+ +    W CT + + T GL
Sbjct: 80  TDETVTKWAFNAQFERICLSRYLRDKGINVNPGQTGKSEGLFLNPSSWHCTMIWSATLGL 139

Query: 106 PSSLKNACLALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGE 161
           P SL+N  + L       K+ EGK LI  F   C  +  +      +  H  + W+ F  
Sbjct: 140 PMSLENVGIVLGL--DKQKLTEGKNLIKYFCLPCNPTKVNGGRTRNKYFHDKEKWEQFKS 197

Query: 162 YCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKK 219
           Y KRDVE    + ++L   P+ D     + LDQ INDRG  ID   V    +L  + +  
Sbjct: 198 YNKRDVEVEMSIQEKLSRFPVPDFLWQEFYLDQEINDRGIGIDSLFVESAIKLDLEVKTH 257

Query: 220 LDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLIL 279
           L  ++ ++T     +      +R +L    G+++  + +  +   L      +   +++ 
Sbjct: 258 LMSELKRVTGLE--NPNSVLQMRSWL-KKHGLEMESLGKKEVAKELKTVG--KELAEVLR 312

Query: 280 NRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEI 339
            R   + S++ K   +  A   D R RG  +FYGA+RTGR++G + Q QNLP+    +  
Sbjct: 313 LRQQLAKSSVKKYTAMKNAACMDYRERGMFRFYGANRTGRFAGRLVQLQNLPQNHLPDLA 372

Query: 340 LTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
             +++      E       D     S  +R+  I   G K +VAD + IEARVLAW+AGE
Sbjct: 373 EARSLVKQGNVEALEMLYEDIPDTLSQLIRTAFIPRTGLKFIVADFSAIEARVLAWLAGE 432

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            W+++ FA G+DIY ++ ++ F+ P++K   +   R  GK+ ELALGY G     K M  
Sbjct: 433 KWRMRVFAEGKDIYCSSASQMFSVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMG- 491

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
                                                  A+   L     + +  AWR+ 
Sbjct: 492 ---------------------------------------ALDMGLTEDELQPLVDAWRSS 512

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           +  V  LW D+       V E  S+          +V       + I LPS R L Y   
Sbjct: 513 NPMVTTLWWDVDRAVKQCVHEHVSVRT------HNIVFTYKSGFLIIKLPSKRCLYYVKP 566

Query: 574 KGDCSYLNTA---------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDI 624
           + + +              T +  R  +YG K  ENI QAI+RDIL   M+   +  Y I
Sbjct: 567 RVEENKYGGESVTYEGVGSTKKWERLESYGPKFVENITQAIARDILIYAMQTLKE--YRI 624

Query: 625 VLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V  VHDE + ET  +   SV ++C LM + P WA+GL L+A+GYE + Y+K
Sbjct: 625 VAHVHDEAIIETDKS--VSVQSVCELMGRTPPWAEGLLLRADGYECEFYKK 673


>gi|304389855|ref|ZP_07371814.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|304327031|gb|EFL94270.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
          Length = 655

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 214/707 (30%), Positives = 313/707 (44%), Gaps = 85/707 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  LF DIE+ SP  L K GV+ YAE     + L  Y+ D  PVK+ D     +MP ++L
Sbjct: 1   MRTLFCDIESFSPAQLAKTGVYLYAEHPDFDLLLFGYSIDGGPVKVVDLAGGQSMPDEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID---------IPSKRWICTSVLARTNGLPSSL 109
             L D +V+  AHN+ FER+     L            +  ++W CT + +   GLP SL
Sbjct: 61  AALVDSSVVKWAHNAAFERVCLSAWLRAHHSELLGEGFLDPRQWRCTMIWSAYLGLPMSL 120

Query: 110 KNACLALNFSEHLTKMEEGKALIARFCKGS----IDSPPYDCTRANHVQAWQLFGEYCKR 165
                 L       K   GK LI +FC  +    ++        +     W  F +Y +R
Sbjct: 121 DAVAAVLKLDVQ--KDTVGKKLIKQFCTPATPSVLNGGKRRNPPSADPTGWARFIDYNRR 178

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    +  RL   P+ + E D + LDQ IND G  +D  LV     +    R      
Sbjct: 179 DVEVELAIHDRLAFFPMPEAEWDTYALDQCINDAGILLDHTLVDNAVAVDEHHRNASLAR 238

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
             KLT   + +      L+ +L    G +L  +++  + + L  +    + K+++  R  
Sbjct: 239 AQKLTG--LDNLNSPIQLKQWLVTR-GCELESLAKAEVDAALDTATG--VVKEVLELRGD 293

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
            + S++ K   +     +DGR RG +QFYGA RTGR++G + Q QNLPR    +    ++
Sbjct: 294 LAKSSVKKYQAMHNVAGADGRARGLIQFYGAGRTGRFAGRLVQVQNLPRNYLPDLDQARS 353

Query: 344 IQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
           +      +             S  +R+  I S G + +VAD + IEARV+AW+AGE   +
Sbjct: 354 LVQTGNLDALELLYESVPDTLSQLIRTAFIPSPGHRFIVADFSAIEARVIAWLAGETTTL 413

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
            AF  G+D+Y  T ++ F+ P++K   + E R  GK+  LA GY G     K M      
Sbjct: 414 AAFREGKDLYCETASRMFDVPVEKHGINGELRQKGKIAVLACGYGGSVGALKAMG----- 468

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
                                              A    L     + +  AWR  +  +
Sbjct: 469 -----------------------------------AFTMGLAEHELKPIVDAWRQANPHI 493

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC 577
           +QLW D+ +     +     I  R       L        + I LPS RRL Y   +   
Sbjct: 494 VQLWADVEQAAIAAISSRQPIRLR------NLRFSVESGILFIELPSGRRLAYVQPRLGE 547

Query: 578 SYL---------NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
           +            T   +  +  TYGGKL ENIVQAI+RD+L  GM    K G+ IV+ V
Sbjct: 548 NRWGGTSITYTGTTTARRWGQLETYGGKLVENIVQAIARDLLVVGMHAVAKAGHRIVMHV 607

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDEIV + P    F+V   C LM+  P+WA+GLPL A+GYE   YRK
Sbjct: 608 HDEIVIDEPTNLDFAVADACKLMSTLPAWAEGLPLDADGYECNYYRK 654


>gi|258646421|ref|ZP_05733890.1| prophage LambdaSa04, DNA polymerase [Dialister invisus DSM 15470]
 gi|260403824|gb|EEW97371.1| prophage LambdaSa04, DNA polymerase [Dialister invisus DSM 15470]
          Length = 656

 Score =  498 bits (1282), Expect = e-138,   Method: Composition-based stats.
 Identities = 194/700 (27%), Positives = 297/700 (42%), Gaps = 70/700 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K G++ Y E     + L AYA+D   V + D  +   +P  ++
Sbjct: 1   MKHLSIDIETFSDVDIKKSGLFKYCESPVFELLLFAYAYDFGDVHVVDLAQGEKIPDSVI 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L +  V+  A+N+ FE     +  G     ++W CT +     G P+ L     AL  
Sbjct: 61  SDLNNPEVIKHAYNASFEITGLNRY-GYATSPEQWRCTMLHGLYLGYPAGLAFLGAALGI 119

Query: 119 SEHLTKMEEGKALIARFC---KGSIDSPPYDCTRA-NHVQAWQLFGEYCKRDVEATRELF 174
            E   K+  GKALI  FC   K +  +         + +  W LF EY  +DV    E +
Sbjct: 120 PEDKRKLSTGKALIRYFCVPCKPTKRNGGRTRNLPKHDIDKWHLFKEYNAQDVVTEMEDY 179

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           +RL   P+    +D W++D  +N RG ++D+DLV     +  Q + +L E  +++T   +
Sbjct: 180 RRLSAYPVPGWVQDDWVIDYELNRRGIQLDMDLVRGALAIDDQHKTELVEKAIQITG--L 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  ++   + + L  +++ T+   L  +       +++  R A + S+I K 
Sbjct: 238 TNPNSRNQLLTWINDNSDLKLEKLTKETVAESLQIAEDQ--VAEVLHIRRALAKSSISKY 295

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE- 351
            ++  AV +DGR+RG LQFYGA+RTGRW+G + Q QNLP            +        
Sbjct: 296 ESMKNAVCADGRIRGVLQFYGANRTGRWAGRLVQVQNLPHDVPVAMDTAIRLVKNGNARG 355

Query: 352 ---TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                       S  +R+  +A  G  L V+D + IEARVL+W+A E W+   FA G DI
Sbjct: 356 VKLMYGHISTSLSHLIRAAFVAPEGSLLCVSDFSAIEARVLSWLADEKWRQDVFAKGGDI 415

Query: 409 YVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + +  F  P++K   +   R  GKV ELALGYQGG     TM +             
Sbjct: 416 YCASASSMFGVPVEKHGINGHLRQKGKVAELALGYQGGPPALITMGALKQ---------- 465

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                          L       +   WR  +  +   W D+  
Sbjct: 466 ------------------------------GLTEDELPDIVHRWRGANPRICGFWYDVDG 495

Query: 527 GFACVVQEGGSISA-RRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV--------KGDC 577
               V+ +   +     +       +      + I LPS R+L Y           K   
Sbjct: 496 AALSVMSDARPVGLPHGILISRECNLLYGYDYLTIRLPSGRKLYYPQPYINENQFGKPAL 555

Query: 578 SYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
            Y   A  +     TYGGKL ENI QAI+RD L   +    K GY  ++ +HDE+V E P
Sbjct: 556 HYRVQAGIKWSHTSTYGGKLVENITQAIARDCLALAINRLVKAGYKPLMHIHDEVVLEVP 615

Query: 638 DT--PYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                   +  +  +M     WA GL L A+G+ +  Y K
Sbjct: 616 KDKIHEDEIDRINQIMCAPIPWAPGLLLNADGFISPYYTK 655


>gi|297585291|ref|YP_003701071.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
 gi|297143748|gb|ADI00506.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
          Length = 655

 Score =  498 bits (1282), Expect = e-138,   Method: Composition-based stats.
 Identities = 216/697 (30%), Positives = 330/697 (47%), Gaps = 77/697 (11%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S   L + GV+AYAE     I L AYA+DDE V + D  +   +P+ +L+ L
Sbjct: 10  LSIDIETFSNVDLKESGVYAYAEGEGFTILLLAYAFDDEEVIVVDLVQDEPIPTTVLKAL 69

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            D ++M  A+N+ FER      L   +P+++W C+SV A T GLP  L      LN  + 
Sbjct: 70  IDPSIMKTAYNANFERTCLAAYLNQPMPTEQWHCSSVHALTLGLPGHLDGVANVLNLGDQ 129

Query: 122 LTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELFKRL 177
             K   GKALI  F   CK +  +         + ++ W  +  YC++DVE  R L KRL
Sbjct: 130 --KDNAGKALIRYFSVPCKPTASNGHRTRNLPEHDLEKWHAYKAYCRQDVEVERALRKRL 187

Query: 178 --IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSS 235
              P+ + E+ LW LDQ +ND G RID DLV +  +L A+E+  L E+  ++T     + 
Sbjct: 188 ASNPIPEKEQRLWELDQRMNDEGVRIDTDLVRQAIQLDAKEQALLLEEAKQITGLE--NP 245

Query: 236 RQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTL 295
                LR +L    GI+   +++  +  +L   ++    + +++ R   S +++ K   +
Sbjct: 246 NSVAQLRDWLTSR-GIETSGLAKKQVSDLLQT-DLPGDVRRVLILRQMMSKTSVKKYEAM 303

Query: 296 SEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIAD 355
             ++  DG +RG LQFYGA+RTGRW+G + Q  NLP+    +    + +      E I  
Sbjct: 304 DRSICKDGHIRGLLQFYGANRTGRWAGRIVQAHNLPKHRIGDLDEARQLVKTGNYELITT 363

Query: 356 PLGLASDCV----RSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
             G  +D +    R+  I   G + VV+D + IEARV+AW+AGE W++K F     IY  
Sbjct: 364 LYGSLADLLSQLTRTAFIPKKGYRFVVSDFSAIEARVIAWLAGERWRMKVFEGHGKIYEA 423

Query: 412 TYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
           + ++ F  PI++++K    R  GK+ ELALGY G       M                  
Sbjct: 424 SASQMFGVPIEEITKASPLRQKGKIAELALGYGGAKGALTQMG----------------- 466

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
                                  A++  L       + KAWR  +  ++ LW DL +   
Sbjct: 467 -----------------------ALEMGLSEDELPALVKAWRKANPNIVNLWYDLEKSAF 503

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---------KGDCSYL 580
             V+    ++A+       +        +   LPS R L Y            + + +Y 
Sbjct: 504 EAVKWQKVVTAK-----SGIQFYGGSGLLRARLPSGRSLSYVRPQIGIDERFGREEITYE 558

Query: 581 N--TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD 638
                + Q  R  TYGGK+ EN+VQAI+RD L E M      GY I   VHDE+V E P 
Sbjct: 559 GVMQGSKQWGRISTYGGKIAENMVQAIARDCLAEAMLRLDAAGYQIRFHVHDEVVIEVP- 617

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               +   +  +M++   WA GLP+ A+ +E   Y+K
Sbjct: 618 NEQDAKADIERIMSEPIDWAPGLPMNADSFETGYYKK 654


>gi|253581725|ref|ZP_04858949.1| DNA polymerase [Fusobacterium varium ATCC 27725]
 gi|251836074|gb|EES64611.1| DNA polymerase [Fusobacterium varium ATCC 27725]
          Length = 657

 Score =  498 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 201/702 (28%), Positives = 309/702 (44%), Gaps = 73/702 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K G++ YA  +   I L AY+ D   VK+ D  +   +P  ++
Sbjct: 1   MKHLSIDIETYSSVDIKKAGMYKYALSDDFQILLFAYSIDFGEVKIIDLAKGEILPEVII 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D+ ++  A+N+ FE        G     ++W  T       G  + L     A+  
Sbjct: 61  EALNDKNIIKHAYNAPFEWWCL-NQAGYKTSIEQWRDTMFHGLYCGYTAGLGATGAAIGL 119

Query: 119 SEHLTKMEEGKALIARFC---KGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
            +   K   GKALI  FC   K +  +        +H  + W+LF  YC +DV    E++
Sbjct: 120 PQDKKKDTTGKALIKLFCVPCKPTKKNGGRLRNLPHHEPEKWELFKNYCIQDVVTETEIY 179

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           KRL   P+   E++LW+LDQ IN  G +ID +LV     +      +L E+ +++T   +
Sbjct: 180 KRLSNFPVPQEEQELWVLDQKINAYGVKIDTELVKGALSINDIVTAELTEEAIQVTG--L 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L   TG D+ ++ +GT+  ++      +  + L   R   + ++I K 
Sbjct: 238 DNPNSAAQLGKWLKEKTGQDIENLQKGTVSELIGSLEDKEAVRVL-EIRQELAKTSIKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE- 351
             + EA+  DGR+RG LQFYGA+RTGRW+G + Q QNLPR         + I      + 
Sbjct: 297 VAMEEAICPDGRIRGLLQFYGANRTGRWAGRLVQVQNLPRNYLETLDYAREIVKSQDADF 356

Query: 352 ---TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                 +     S  +R+  + S G K VVAD + IEARV+AW+AGE W+ + FA    I
Sbjct: 357 LKLVYGNVSDTLSQLIRTAFVPSEGHKFVVADFSAIEARVIAWLAGEQWRQEVFATHGKI 416

Query: 409 YVTTYAKAFNTPIDKVSKEQRAIG-----KVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
           Y  + ++ F  PI+ + K           KV ELALGY G +     M            
Sbjct: 417 YEASASQMFGVPIELIKKGNPEYALRQKGKVAELALGYGGSSGALIAMG----------- 465

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                        A+   L       V + WR  ++ +  LW  
Sbjct: 466 -----------------------------ALDMGLEEKELPDVVRRWRNANKRITDLWYG 496

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYL--- 580
           +      +++ G +   + +     + +   +  + I LPS R+L Y       +     
Sbjct: 497 IENAVIKLMETGETQGLKGIIFSREIDLIYDQDFLTIKLPSGRKLYYPKPHLKENRFGSN 556

Query: 581 -------NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                  N  T +   + TYGGKL ENIVQAISRD L   +K     G   V+ +HDE V
Sbjct: 557 ALHYFGVNQTTKKWEVQETYGGKLVENIVQAISRDCLAVTLKRLETEGLQTVMHIHDEAV 616

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            +        +  +C LM +   WA GL LKA G+E+  Y K
Sbjct: 617 IDADPN--VDLNKVCELMGQPIEWAPGLLLKAAGFESGYYMK 656


>gi|257088833|ref|ZP_05583194.1| DNA polymerase [Enterococcus faecalis CH188]
 gi|256997645|gb|EEU84165.1| DNA polymerase [Enterococcus faecalis CH188]
 gi|315160597|gb|EFU04614.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0645]
 gi|315579443|gb|EFU91634.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0630]
          Length = 653

 Score =  498 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 218/704 (30%), Positives = 320/704 (45%), Gaps = 81/704 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S + L KVGV+ YA+     I L AY+ D +PV+  D T  S +P +++
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLT-ISEIPDEIV 59

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V+ +A N+ FER+   K LG+   +   +W CT V A   GLP+SL      L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKYLGVPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
           N  +   K   G  LI  F   CK +  +         H  + WQ F EYC +DV     
Sbjct: 120 NIEQQ--KDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMA 177

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           +  +L   P+ + E  L+ LDQ INDRG  ID +L     +++A   +    ++ +LT  
Sbjct: 178 IANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEMKELTGL 237

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
              +      L+ +L    G     + +  +   L+  N+ +   +++  RL+ S S+  
Sbjct: 238 E--NPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGNLPENVAEVLKLRLSLSNSSTK 294

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A  SD R+ G LQFYGA+RTGRW+G + Q QNLPR   SE    + +      
Sbjct: 295 KYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQLVKAKDV 354

Query: 351 E----TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           E       D        +R+ ++A  G + +V+D + IEARV+AW A +DW ++ F    
Sbjct: 355 EGIELMYEDVPDTLKQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVLEVFRTHG 414

Query: 407 DIYVTTYAKAFNT-------PIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
            IY  T A+ F+              K+ R  GKV  LALGYQGG    K M        
Sbjct: 415 KIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG------- 467

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
                                            A+++ +     + +   WR  ++ +  
Sbjct: 468 ---------------------------------ALENGIEEHELQDIVDRWRTANKRIKN 494

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD--- 576
            W +  +     +Q GG     R      L   +    + I LPS R+L Y+    +   
Sbjct: 495 FWHETQKAVIDCLQNGGIKKGPRG-----LKFYKKAGFLFIQLPSGRKLAYAKAHLEQGD 549

Query: 577 ----CSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
                 Y           ++TYGGKL ENIVQA +RD+L E M    K GY IV  VHDE
Sbjct: 550 YGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMVRLEKAGYPIVFHVHDE 609

Query: 632 IVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            V+E P+    S+  +  +M+  P WA+GLPL AEG+E K Y K
Sbjct: 610 AVAEVPEGE-KSIEEMNEIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|167746061|ref|ZP_02418188.1| hypothetical protein ANACAC_00756 [Anaerostipes caccae DSM 14662]
 gi|167654576|gb|EDR98705.1| hypothetical protein ANACAC_00756 [Anaerostipes caccae DSM 14662]
          Length = 663

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 191/716 (26%), Positives = 316/716 (44%), Gaps = 98/716 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           +  + IDIET S   L K GV+ Y   +   I L  Y+ D   V + D  +   +P +++
Sbjct: 4   IKTISIDIETYSDVDLQKCGVYKYVQSDSFEILLFGYSVDGGEVSVVDLKQGEKIPMEII 63

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL------------------GIDIPSKRWICTSVLA 100
             L DE +   A N+ FER+   + L                  G  +    W C+ V +
Sbjct: 64  MALTDENITKWAFNANFERVCLSEYLRRFYPKKFVSYSIPEDSVGNYLDPSSWKCSMVWS 123

Query: 101 RTNGLPSSLKNACLALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAW 156
              GLP  L  A   L   E   K+ EGK LI  F   CK +  +         + +  W
Sbjct: 124 AYMGLPLLLAGAGAVLGLEEQ--KLTEGKELIRYFCVPCKPTKVNGGRTRNLPQHDMIKW 181

Query: 157 QLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIA 214
           ++F +Y KRDVE    +  +L   P+ +   + + LDQ INDRG  +D+D+V        
Sbjct: 182 EMFKKYNKRDVEVEMSIQDKLRHFPVPNFVWEEYHLDQEINDRGITLDMDVVTNAIAFDE 241

Query: 215 QERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLA 274
           + +  L + + ++T     +      ++ +L    G+++  + +  + ++L+ +   +  
Sbjct: 242 KSKAVLADKMQEMTGLE--NPNSVQQMKQWLSC-NGLEMDSLGKKEVAAVLNTA--PEPL 296

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
           K ++  R   + S++ K   ++ AV SDGR RG   FYGA+R+GRW+G + Q QNLP+  
Sbjct: 297 KTVLTLRQQLAKSSVKKYQAMANAVCSDGRARGMFMFYGANRSGRWAGRLIQLQNLPQNH 356

Query: 335 RSEEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
            S+    +++      E       D     S  +R+  +   G + +V+D + IEARVL+
Sbjct: 357 MSDLEEARSLVKQGNYEAMNMLYDDVPDTLSQLIRTAFVPRKGMEFIVSDFSAIEARVLS 416

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVF 448
            +AGE W+   FA+G DIY  + ++ F  P++K   +   R  GK+ ELALGY G     
Sbjct: 417 HLAGEKWRTDVFASGGDIYCASASQMFKVPVEKHGVNGHLRQKGKIAELALGYGGSVGAL 476

Query: 449 KTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKK 508
           K+M                                         A+   L     + +  
Sbjct: 477 KSMG----------------------------------------ALDMGLEEDELKPLVD 496

Query: 509 AWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRL 568
            WR  +  +++LW D+       V++      R  +++  +        + I LPS R L
Sbjct: 497 MWREANPNIVKLWWDVDRAVKKAVKQ------REPSSIGSITFSYKSGMLFIGLPSGRCL 550

Query: 569 VYSDVKGDCSYLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK 619
            Y   K   +   +          T +  R  +YG K  ENIVQAISRDIL   ++    
Sbjct: 551 SYVKPKMGINQFGSESVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILMYAIRTL-- 608

Query: 620 NGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +   I   VHDE++ E   +   S+  +C  M + P W +G+ L+A+GYE + Y+K
Sbjct: 609 SHCFICGHVHDELIIECSKS--VSLDVICEQMGRTPPWIEGILLRADGYETEFYKK 662


>gi|325690425|gb|EGD32428.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK115]
          Length = 645

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 216/698 (30%), Positives = 330/698 (47%), Gaps = 77/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   L K GV+ Y +  Q  I L AY  D+E  ++ D  +   +P  +L
Sbjct: 1   MRTLSIDIETYSDVDLTKCGVYRYVDSPQFEILLFAYKIDEENTQIVDLAQGEELPKGIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             LRD+ V+  A N+ FER+   K L   + ++ W CT+V A + GLP SL+     LN 
Sbjct: 61  SALRDDAVVKTAFNANFERVCLSKYLKQKLSARSWSCTAVQAASLGLPLSLEGVGRVLNI 120

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
            E   KM+EG+ LI  F   C+ +I +   +    +H ++ W+LF  YCKRDVE  + + 
Sbjct: 121 EEQ--KMKEGQRLIRYFCLPCRPTIANGMRERNWPHHALEDWELFKRYCKRDVEVEQAIR 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           KRL   PL + E+ L+ LDQ INDRG  +D +LV +        ++++ +   +L+   +
Sbjct: 179 KRLSNYPLLESEQLLYQLDQAINDRGIAVDQELVSQAILGDLSYKEQVTQRAYELSG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L+ +L    G+ +  + +  +   L   +      +++  RL  S +++ K 
Sbjct: 237 DNPNSVSQLKGWL-ENQGVFMDSLGKKDVAKQLKEVDG--EILEMLKLRLLMSKTSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +   V SD R+ G LQFYGA+RTGRW+G + Q QNLP+ +  +  L +T+    + + 
Sbjct: 294 QAMERCVCSDDRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLDLARTLVKDGQLKA 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                 +   + S+ +R+  +  +G + +VAD A IEARVLAW++GE W+++ F  G DI
Sbjct: 354 LDLLYDNVPNVLSELIRTAFVPKSGHQFIVADFAAIEARVLAWLSGETWRLEVFEQGGDI 413

Query: 409 YVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + A  F  P++K   +   R  GK+ ELALGY G     K M               
Sbjct: 414 YCASAASMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMG-------------- 459

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   L     + +   WR  +  ++  W  + +
Sbjct: 460 --------------------------ALDMGLDEEELQPLVNQWRMANPHIVAFWWVIDK 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTA--- 583
                         R    V  L++        I LPS R+L Y   + + +        
Sbjct: 494 ASKE------VYETREPQKVGNLLLYYQAGMFFIALPSGRKLAYVKPRMELNAFGKPGLT 547

Query: 584 ------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                   +  R  TYG KL ENIVQ I+RD+L  GM    K   DIVL VHDE V E  
Sbjct: 548 YEGIGENKKWSRIDTYGPKLVENIVQGIARDLLAHGMMQLQKQELDIVLHVHDEAVVEVK 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +    SV  +C L    P WA+GLPL+A+GY  + Y+K
Sbjct: 608 EGEA-SVEEVCQLFATLPDWAEGLPLRADGYACQFYQK 644


>gi|315656936|ref|ZP_07909823.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii subsp. holmesii ATCC 35242]
 gi|315492891|gb|EFU82495.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii subsp. holmesii ATCC 35242]
          Length = 655

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 217/707 (30%), Positives = 312/707 (44%), Gaps = 85/707 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  LF DIET SP  L K GV+ Y E     + L +Y+ D  PV++ D     +MP ++L
Sbjct: 1   MRTLFCDIETFSPVQLAKAGVYPYCEHPDFDLLLFSYSVDGGPVEIVDLANGQSMPDEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL---------GIDIPSKRWICTSVLARTNGLPSSL 109
             L D  V+  AHN+ FER+     L            +  ++W CT V +   GLP SL
Sbjct: 61  AALVDPDVVKWAHNAAFERVCLSAWLHRHHSELLGDGFLDPRQWRCTMVWSAYLGLPMSL 120

Query: 110 KNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCT----RANHVQAWQLFGEYCKR 165
                 L       K   G+ LI +FC  +  S           +     W  F +Y +R
Sbjct: 121 DAIAAVLKLDVQ--KDSAGRKLIKQFCTPATPSVLNGGKHRNPPSADPTGWAHFIDYNRR 178

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE  + +  RL   P+ + E D + LDQ IND G  +D  LV     +    R      
Sbjct: 179 DVEVEQAIHDRLACFPMPESEWDTYALDQRINDAGILLDHTLVDNAVAVDEHHRNASLAR 238

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
             KLT   + +      L+ +L    G +L  +++  + S L  +      K+++  R  
Sbjct: 239 AQKLTG--LDNPNSPIQLKQWLATR-GCELESLAKAEVDSALDTATG--AVKEVLELRGD 293

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
            + S++ K   +     SDGR RG +QFYGA RTGR++G + Q QNLPR    +    +T
Sbjct: 294 LAKSSVKKYQAMQNVAGSDGRARGLIQFYGAGRTGRFAGRLVQVQNLPRNYLPDLDQART 353

Query: 344 IQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
           +      +             S  +R+  I S G + +VAD + IEARV+AW+AGE   +
Sbjct: 354 LVRTGNLDALELLYESVPDTLSQLIRTAFIPSTGHRFIVADFSAIEARVIAWLAGETSTL 413

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           +AF  G+D+Y  T ++ F  P++K   + E R  GK+  LA GY G     K M      
Sbjct: 414 EAFREGKDLYCETASRMFGVPVEKHGVNGELRQKGKIAVLACGYGGSVGALKAMG----- 468

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
                                              A+   L     + +  AWR  +  +
Sbjct: 469 -----------------------------------ALNMGLAEHELKPIVDAWRQANPHI 493

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC 577
           + LW D+ E     +     I  R       L          I LPS RRL Y   +   
Sbjct: 494 VGLWADVEEAAIAAISSRQPIRLR------NLRFSVESGIFFIELPSGRRLAYVQPRLGE 547

Query: 578 SYL---------NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
           +            T   +  +  TYGGKL ENIVQAI+RD+L  GM    K G+ IV+ V
Sbjct: 548 NRWGGTSVTYTGTTTARRWGQLETYGGKLVENIVQAIARDLLVTGMHAVAKAGHQIVMHV 607

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDEIV + P+   F+V   C+LM+  P+WA+GLPL A+GYE   YRK
Sbjct: 608 HDEIVIDEPENSGFTVTDACALMSTLPAWAEGLPLDADGYECAYYRK 654


>gi|304436359|ref|ZP_07396335.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304370628|gb|EFM24277.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 641

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 193/705 (27%), Positives = 303/705 (42%), Gaps = 95/705 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L +D+ETRS   + + GV+ Y  AE   I L  Y+ D   V++ D      +P ++L
Sbjct: 1   MKSLSVDLETRSSVDIGQSGVYRYTEAEDFAILLFGYSVDGGAVQVIDLVRGERIPQEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL-----------GIDIPSKRWICTSVLARTNGLPS 107
             L D++V+  A N+ FER+   + L              +  + W CT V +   GLP 
Sbjct: 61  DALADDSVIKWAFNANFERVCLSRYLSDLGMLHTTERAHFLSPRSWRCTMVWSAYMGLPL 120

Query: 108 SLKNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           SL      L   E   KM EGKALI  F       P          + W+LF  Y +RDV
Sbjct: 121 SLAVVARVLGLEEQ--KMTEGKALIRYFSTPPFHEP--------TGEKWELFKSYNRRDV 170

Query: 168 EATRELFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIV 225
           E    + +RL   P+     + ++LDQ INDRG  +D+  V    ++ A  ++K+ + + 
Sbjct: 171 EVEMAIQQRLFKYPVPQSVWEEYVLDQEINDRGICLDMPFVENAVKIDAHTKEKMTDRLK 230

Query: 226 KLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASS 285
            LT     +      ++ +L    G++   + + T+ ++L++ +   L K+++  R   +
Sbjct: 231 TLTGLE--NPNSVAQMKAWLKE-QGVETESLDKKTVAALLTNVSA--LLKEVLELRQQLA 285

Query: 286 GSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQ 345
            S++ K   +   V +D R RG  QFYGA+RTGR+SG   Q QNLP+   +     +++ 
Sbjct: 286 KSSVKKYQAMQNTVCADNRARGMFQFYGANRTGRFSGRHIQLQNLPQNHLANLEYARSLV 345

Query: 346 ALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
                            + S  +R+  I   G+K +VAD + IEARVL+W+A E W++  
Sbjct: 346 RQGNFAALELLYESVSDVLSQLIRTAFIPKEGRKFIVADFSAIEARVLSWLAKERWRMDV 405

Query: 402 FANGEDIYVTTYAKA--FNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
           FAN  DIY  T  +    N      +   R  GK  ELA GY G     K          
Sbjct: 406 FANDGDIYCATAGRMFHCNVVKHGENGHLRQKGKQAELACGYGGSVGALKAFG------- 458

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
                                            A++  +     + +  AWR  +  ++ 
Sbjct: 459 ---------------------------------ALESGMKEDELKPLVDAWRTANPNIVD 485

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSY 579
            W  +       ++E              +        + I LPS RRL Y   +   + 
Sbjct: 486 FWWAVDRAAKDCIKERSITGT------HGIKFIYQSGMMFIELPSGRRLAYVKPRIGENQ 539

Query: 580 LNTA---------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHD 630
                        + +  R  +YG KL ENI QAISRD+LC  M+        IV  VHD
Sbjct: 540 FGGESITYMGLDLSKKWARIESYGPKLVENITQAISRDLLCYAMQTLRSMD--IVAHVHD 597

Query: 631 EIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E++ E       S+ + C  M + P WA+GL L+A+G+E + Y+K
Sbjct: 598 ELIIEC--DERVSLSSACEQMARTPLWAEGLLLRADGFECQFYQK 640


>gi|227520155|ref|ZP_03950204.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0104]
 gi|227072400|gb|EEI10363.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0104]
          Length = 653

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 217/704 (30%), Positives = 317/704 (45%), Gaps = 81/704 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S + L KVGV+ YA+     I L AY+ D +PV+  D T  S +P +++
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLT-ISEIPDEIV 59

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V+ +A N+ FER+   K LG+   +   +W CT V A   GLP+SL      L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKHLGVPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
           N  +   K   G  LI  F   CK +  +         H  + WQ F EYC +DV     
Sbjct: 120 NIEQQ--KDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMA 177

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           +  +L   P+ + E  L+ LDQ INDRG  ID +L     +++A   +    ++  LT  
Sbjct: 178 IANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEMKALTGL 237

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
              +      L+ +L    G     + +  +   L+  N+ +   +++  RL+ S S+  
Sbjct: 238 E--NPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGNLPENVAEVLKLRLSLSNSSTK 294

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A  SD R+ G LQFYGA+RTGRW+G + Q QNLPR   SE    + +      
Sbjct: 295 KYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQLVKAKDV 354

Query: 351 E----TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           E       +        +R+ ++A  G + +V+D + IEARV+AW A +DW +  F    
Sbjct: 355 EGIELMYENVPDTLKQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVLDVFRTHG 414

Query: 407 DIYVTTYAKAFNT-------PIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
            IY  T A+ F+              K+ R  GKV  LALGYQGG    K M        
Sbjct: 415 KIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG------- 467

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
                                            A+++ +     + +   WR  ++ +  
Sbjct: 468 ---------------------------------ALENGIEEHELQDIVDRWRTANKRIKN 494

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK----- 574
            W +  +     +Q GG     R      L   +    + I LPS R+L Y+        
Sbjct: 495 FWHETQKAVIDCLQNGGIKKGPRG-----LKFYKKAGFLFIQLPSGRKLAYAKAHLKEGD 549

Query: 575 --GDCSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
                 Y           ++TYGGKL ENIVQA +RD+L E M    K GY IV  VHDE
Sbjct: 550 YGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMVRLEKAGYPIVFHVHDE 609

Query: 632 IVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            V+E P+    S+  +  +M+  P WA+GLPL AEG+E K Y K
Sbjct: 610 AVAEVPEGE-KSIEEMNKIMSIVPDWAEGLPLNAEGFETKYYMK 652


>gi|266623807|ref|ZP_06116742.1| prophage LambdaSa04, DNA polymerase [Clostridium hathewayi DSM
           13479]
 gi|288864379|gb|EFC96677.1| prophage LambdaSa04, DNA polymerase [Clostridium hathewayi DSM
           13479]
          Length = 656

 Score =  495 bits (1274), Expect = e-137,   Method: Composition-based stats.
 Identities = 198/702 (28%), Positives = 303/702 (43%), Gaps = 74/702 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIETRS   + K G + YA+     I L AY W+++PVK+ D      +P  L+
Sbjct: 1   MHHLSIDIETRSSIDIGKAGAYKYAQSPDFEILLFAYQWNNDPVKVIDLKNGEELPCWLM 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           Q L D  V+  A+N+ FE        G + P ++W CT       G  + L     A+  
Sbjct: 61  QALADPNVIKHAYNAAFEWYCL-NCAGYETPIEQWRCTMAHGLYCGYTAGLDATGKAIGL 119

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRELF 174
            +   K+  GKALI  F   CK +  +      +  H    W+LF EYC +DV   RE+ 
Sbjct: 120 PQDKQKLTTGKALIRYFCVPCKPTKTNGSRTWNQPWHDTDKWELFKEYCLQDVVTEREIL 179

Query: 175 KR--LIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           KR  L P+ + E  LW +D  +N  G R+D DL+     +     ++L ++ + LT   +
Sbjct: 180 KRLDLFPMPEEEEHLWQMDVLMNAYGVRVDTDLIEGALYIDQISTQRLTDEAISLTG--L 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
           ++      L  +L    G +  ++ + T+  +L   N     + ++  R     ++I K 
Sbjct: 238 QNPNSAAQLLQWLRD-NGTEADNLQKATVAELLGGIN-PNKVRRMLEIRQQLGKTSIKKY 295

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  A     R+RG  Q+YGA+RTGRW+G + Q QNLPR         + +      + 
Sbjct: 296 VAMDTARGEGDRVRGLTQYYGANRTGRWAGRLVQMQNLPRNYLKTLDYARNLVKAKNYDG 355

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                 +     S  +R+  I S G K VVAD + IEARV+AW+AGE W  + FA    I
Sbjct: 356 VRILYGNVPDTLSQLIRTAFIPSAGHKFVVADFSAIEARVIAWLAGEQWVNEVFATHGKI 415

Query: 409 YVTTYAKAFNTPIDKVSK-----EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
           Y  T ++ F  P+++++K       R  GKV  LALGYQGG      M            
Sbjct: 416 YEATASQMFGVPVERIAKGNPEYSLRQKGKVATLALGYQGGTSALIAMG----------- 464

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                        A++  L       + + WR  +  +  LW  
Sbjct: 465 -----------------------------ALQMGLTEEELPDIVQRWRQANPRIKGLWYA 495

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYL--- 580
           +      V++         +       +   +  + + LPS R+L Y       +     
Sbjct: 496 IENAALAVMETAQPQGINGLIFALEGDIIYGQSFLTVRLPSGRKLFYPKPFLKENRFEKM 555

Query: 581 -------NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                     T +     TYGGK+ ENIVQAI+RD L   ++     G  +V  VHDE++
Sbjct: 556 AVHYYTVGQQTRKWEVTSTYGGKMVENIVQAIARDCLAVTLERIASKGLQVVFHVHDEVI 615

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            + P     +V  +C LM +   WA GL LK  G+E+  Y K
Sbjct: 616 IDAPMET--TVEEICDLMAEPIPWAPGLVLKGAGFESSYYMK 655


>gi|300933484|ref|ZP_07148740.1| DNA-directed DNA polymerase [Corynebacterium resistens DSM 45100]
          Length = 653

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 223/708 (31%), Positives = 315/708 (44%), Gaps = 89/708 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +LFIDIET SP  L   GV+ YA+     + L  Y+ D  PV++ D      +P  +L
Sbjct: 1   MRELFIDIETFSPVNLANSGVYPYADHDGFELLLFGYSIDGGPVEVVDLANGHQLPEKVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID----------IPSKRWICTSVLARTNGLPSS 108
             L D  V+  A N+ FERI     L             +   +W CT V +   GLP S
Sbjct: 61  SALVDPLVVKWAFNATFERICLSSWLARQYPELMAGRRFLNPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKNACLALNFSEHLTKMEEGKALIARFCKGSI----DSPPYDCTRANHVQAWQLFGEYCK 164
           L      L+    + K   GK LI +FC        +        A+    W+ F  Y +
Sbjct: 121 LDQVATVLHLP--VRKDSAGKKLIRQFCTPGTPSVFNLGGMRNPPASDPDGWEQFISYNR 178

Query: 165 RDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
           RDVE    +  RL   PL   E D + LDQ +ND G R+D  LV        Q R     
Sbjct: 179 RDVEVELAIHDRLADFPLPASEWDTYALDQNVNDTGIRLDRVLVDHAVACDRQHRATTLA 238

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRL 282
              +LT     +      L+ +L    G  L  +++  + + L  +      ++++L R 
Sbjct: 239 RAQELTGLE--NPNSPIQLKDWL-AAHGAPLQSLTKDEVAAALDTATGQ--VREVLLLRG 293

Query: 283 ASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
             + S++ K   +      DGR RG LQFYGA RTGR++G + Q QNLPR    +    +
Sbjct: 294 ELAKSSVKKYEAMQHVTGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPDLAEAR 353

Query: 343 TIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWK 398
           ++      +             S  +R+  I ++G + VVAD + IEARV+AW+AGE   
Sbjct: 354 SLVRTGNYDAVELLYDSVPDTLSQLIRTAFIPADGHRFVVADFSAIEARVIAWLAGEATT 413

Query: 399 IKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCG 456
           ++AF +G+D+Y  T ++ F  P+DK   + E R  GK+  LA GYQGG    K M     
Sbjct: 414 LEAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGALKAMG---- 469

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
                                               A++  L  +  + +  AWRA +  
Sbjct: 470 ------------------------------------ALRMGLAESELQPLVDAWRAANPN 493

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-G 575
           V+QLW D+             IS R   +V  L        + I LPS RRL Y   K G
Sbjct: 494 VVQLWADINAAAIEA------ISTRLPTSVGALTFTVESGIMFIRLPSGRRLAYVKPKLG 547

Query: 576 DCSYLNTAT--------SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLT 627
           +  +  TA          +  +  TYGGKLTENIVQA++RD+L  GM    + G+ IV+ 
Sbjct: 548 ENRFGGTAITHEGITTGRKWGQLETYGGKLTENIVQAVARDLLTFGMHQVDRAGHRIVMH 607

Query: 628 VHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           VHDEIV ET      +V  +C LM   P WA GLPL A+GY    Y K
Sbjct: 608 VHDEIVVET---ATATVDEICKLMAITPDWAAGLPLAADGYACDFYMK 652


>gi|255525749|ref|ZP_05392680.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|296188034|ref|ZP_06856426.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|255510572|gb|EET86881.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|296047160|gb|EFG86602.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
          Length = 646

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 211/696 (30%), Positives = 317/696 (45%), Gaps = 76/696 (10%)

Query: 4   LFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
           L IDIET S   + K GV+AY  AE   I L AYA++D+ + + D      +P  +++ L
Sbjct: 2   LSIDIETYSSVDITKSGVYAYTEAEDFEILLFAYAYEDKEINIIDLAFGEKLPQGIIEDL 61

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEH 121
            +  ++  A N+ FER    K L   +P ++W C++V A   G   SL+ A  +LN  + 
Sbjct: 62  TNPKLIKTAFNANFERTCLAKYLNKPMPPEQWRCSAVHALALGFGGSLEGAAKSLNLQQQ 121

Query: 122 LTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
             KM+EGKALI  F               ++++ W++F  YCK+DVE  R + K+L   P
Sbjct: 122 --KMKEGKALIRYFSMPCKRGERSRNLPQHNIEKWKVFKTYCKQDVEVERAVRKKLEKYP 179

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
           ++  E +LW LDQ IND G +ID  LV    E     + K  E+   LT     +     
Sbjct: 180 VTKKEWELWALDQKINDSGVKIDKVLVHSAIECDKTCQSKKTEEAAALTGLE--NPNSQV 237

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
            L+ +L    G+    +S+  ++ +L      +  K ++  R   S +++ K   +  AV
Sbjct: 238 QLKGWL-ETKGVKAESLSKEKVRELLKEVEDEK-VKRVLKLRQELSKTSVKKYEAIKRAV 295

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET----IAD 355
             D R+RG L+FYGA+RTGRWSG + Q QNLPR         + +      E        
Sbjct: 296 CKDERVRGLLKFYGANRTGRWSGKLVQTQNLPRNTMDNLEAARMLLKSGNYEMLEVLFYS 355

Query: 356 PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAK 415
              + S  +R+  I +   + +V+D + IEARV+AW+AGE W I  F     +Y    ++
Sbjct: 356 VPEVLSQLIRTAFIPAFNSRFIVSDFSAIEARVIAWLAGEKWVIDTFKGSGKVYEMAASR 415

Query: 416 AFNTPIDKVSK-----EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTS 470
            F  PI+K+ K       R  GKV  LA GYQG       M +                 
Sbjct: 416 MFGVPIEKIVKGNMEYSLRQKGKVATLACGYQGSTGALIAMGAVK--------------- 460

Query: 471 TFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFAC 530
                                      L       +  AWR  +  +++LW+ + +    
Sbjct: 461 -------------------------MGLKEEELSGIVAAWRKSNSNIVKLWRKIEDAAIK 495

Query: 531 VVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC-----------SY 579
            V+E   +  +       L     +  + I LPS R L Y   + +              
Sbjct: 496 AVREKKVVKMQYG-----LEFFGSEEFLFIKLPSGRSLSYVRPRIEKDFRFNKLKLTYEG 550

Query: 580 LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDT 639
           +   T    R  TYGGKLTENIVQAI+RD L   M    + GY IV  VHDE++ + P+ 
Sbjct: 551 IEQGTKAWGRLNTYGGKLTENIVQAIARDCLAYAMLRLDRAGYKIVFHVHDEVILDVPNG 610

Query: 640 PYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            + S+  +  +M K   WAKGLPLKA+G+E   Y+K
Sbjct: 611 -FGSLKEVNEIMGKPIEWAKGLPLKADGFETDYYKK 645


>gi|281416455|ref|YP_003347375.1| DNA polymerase [Enterococcus phage phiFL4A]
 gi|270209631|gb|ACZ64170.1| DNA polymerase [Enterococcus phage phiFL4A]
          Length = 653

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 217/704 (30%), Positives = 320/704 (45%), Gaps = 81/704 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S + L KVGV+ YA+     I L AY+ D +PV+  D T  S +P +++
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLT-ISEIPDEIV 59

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V+ +A N+ FER+   K LG+   +   +W CT V A   GLP+SL      L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKYLGVPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
           N  +   K   G  LI  F   CK +  +         H  + WQ F EYC +DV     
Sbjct: 120 NIEQQ--KDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMA 177

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           +  +L   P+ + E  L+ LDQ INDRG  ID +L     +++A   +    ++ +LT  
Sbjct: 178 IANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEMKELTGL 237

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
              +      L+ +L    G     + +  +   L+  N+ +   +++  RL+ S S+  
Sbjct: 238 E--NPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGNLPENVAEVLKLRLSLSNSSTK 294

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A  SD R+ G LQFYGA+RTGRW+G + Q QNLPR   SE    + +      
Sbjct: 295 KYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQLVKAKDV 354

Query: 351 E----TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           E       D        +R+ ++A  G + +V+D + IEARV+AW A +DW ++ F    
Sbjct: 355 EGIELMYEDVPDTLKQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVLEVFRTHG 414

Query: 407 DIYVTTYAKAFNT-------PIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
            IY  T A+ F+              K+ R  GKV  LALGYQGG    K M        
Sbjct: 415 KIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG------- 467

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
                                            A+++ +     + +   WR  ++ +  
Sbjct: 468 ---------------------------------ALENGIEEHELQDIVDRWRTANKRIKN 494

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK----- 574
            W +  +     +Q GG     R      L   +    + I LPS R+L Y+        
Sbjct: 495 FWHETQKAVIDCLQNGGIKKGPRG-----LKFYKKAGFLFIQLPSGRKLAYAKAHLKEGD 549

Query: 575 --GDCSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
                 Y           ++TYGGKL ENIVQA +RD+L E M+   + GY IV  VHDE
Sbjct: 550 YGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMQRLEREGYPIVFHVHDE 609

Query: 632 IVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            V+E P+    S+  +  +M+  P WA+GLPL AEG+E K Y K
Sbjct: 610 AVAEVPEGE-KSIEEMNEIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|29374964|ref|NP_814117.1| DNA polymerase, putative [Enterococcus faecalis V583]
 gi|29342422|gb|AAO80188.1| DNA polymerase, putative [Enterococcus faecalis V583]
 gi|315574067|gb|EFU86258.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0309B]
 gi|315582012|gb|EFU94203.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0309A]
          Length = 653

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 218/704 (30%), Positives = 319/704 (45%), Gaps = 81/704 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S + L KVGV+ YA+     I L AY+ D +PV+  D T  S +P +++
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLT-ISEIPDEIV 59

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V+ +A N+ FER+   K LGI   +   +W CT V A   GLP+SL      L
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKYLGIPYYLDPAQWHCTMVHANELGLPASLGQCAKYL 119

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
           N  +   K   G  LI  F   CK +  +         H  + WQ F EYC +DV     
Sbjct: 120 NIEQQ--KDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMA 177

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           +  +L   P+ + E  L+ LDQ INDRG  ID +L     +++A   +    ++  LT  
Sbjct: 178 IANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLNEMKALTGL 237

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
              +      L+ +L    G     + +  +   L+  N+ +   +++  RL+ S S+  
Sbjct: 238 E--NPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGNLPENVAEVLKLRLSLSNSSTK 294

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A  SD R+ G LQFYGA+RTGRW+G + Q QNLPR   SE    + +      
Sbjct: 295 KYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLSEIDFARQLVKAKDV 354

Query: 351 E----TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           E       D        +R+ ++A  G + +V+D + IEARV+AW A +DW ++ F    
Sbjct: 355 EGIELMYEDVPDTLKQLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVLEVFRTHG 414

Query: 407 DIYVTTYAKAFNT-------PIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
            IY  T A+ F+              K+ R  GKV  LALGYQGG    K M        
Sbjct: 415 KIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG------- 467

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
                                            A+++ +     + +   WR  ++ +  
Sbjct: 468 ---------------------------------ALENGIEEHELQDIVDRWRTANKRIKN 494

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK----- 574
            W +  +     +Q GG     R      L   +    + I LPS R+L Y+        
Sbjct: 495 FWHETQKAVIDCLQNGGIKKGPRG-----LKFYKKAGFLFIQLPSGRKLAYAKAHLKEGD 549

Query: 575 --GDCSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
                 Y           ++TYGGKL ENIVQA +RD+L E M+   + GY IV  VHDE
Sbjct: 550 YGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMQRLEREGYPIVFHVHDE 609

Query: 632 IVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            V+E P+    S+  +  +M+  P WA+GLPL AEG+E K Y K
Sbjct: 610 AVAEVPEGE-KSIEEMNKIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|322382461|ref|ZP_08056356.1| hypothetical protein PL1_2400 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153574|gb|EFX45963.1| hypothetical protein PL1_2400 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 662

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 198/705 (28%), Positives = 312/705 (44%), Gaps = 82/705 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L ID+ET S   L   GV+ Y E     + L AYA+DD+PV++ D T    +P  ++
Sbjct: 9   MKILQIDLETYSSVDLKDCGVYRYVESPDFEVLLFAYAYDDDPVQVIDLTAFEDLPDQVV 68

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V+  A N+ FER   KK  GI     +W CT+V A   GLP  L+     L  
Sbjct: 69  HDLTDPNVLKTAFNAAFERTCIKKHFGIKCNPSQWRCTAVWALALGLPGYLEGVAEVLKL 128

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRA--NHVQAWQLFGEYCKRDVEATREL 173
                K   GK LI  F   CK +  +          + ++ W+ +  Y  +DV   RE+
Sbjct: 129 EAQ--KDTRGKNLIKYFSVPCKPTKANGGRTRNHPPHHDMEKWEQYKAYNIQDVVVEREV 186

Query: 174 FKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGI 231
            ++L   P+   E DLW LDQ INDRG ++D  L  +  +   Q +  L ++   +T   
Sbjct: 187 RRKLERFPVPQHEWDLWALDQRINDRGIQLDPTLFNQAIDCADQYKTGLLQEAKDITQLE 246

Query: 232 IRSSRQTYALRMYLFLITGIDLVDM-SEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
             +      L+ +L    G++  D   +  + ++L  +      + ++  R     +++ 
Sbjct: 247 --NPNSLTKLKEWLAE-QGLETPDGLGKEHMPTLLVQAPDE-DTRRVLQIRQELGKTSVD 302

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K N ++ ++ +DGR RG LQF GA+RTGRW+G + Q QNLP+ + +   + + +      
Sbjct: 303 KYNAMARSICADGRARGILQFCGANRTGRWAGRIIQVQNLPQNKLNALWMAREVLKSGDF 362

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +           + S  +R+  I S G + +V+D + IEAR++AW+A E W +  F +  
Sbjct: 363 DLLEMLYGALPSVLSQLIRTVFIPSPGCRFIVSDFSAIEARIIAWLADEHWVLNVFQDHG 422

Query: 407 DIYVTTYAKAFNTPID-----KVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQ 461
            IY    ++ F  P++       + E RA GKV  LA GYQGG      M          
Sbjct: 423 KIYEAAASQMFKVPMETIVKGHPNYELRAKGKVATLACGYQGGPPALIKMG--------- 473

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
                                          A+K  +       + K WR  +  +++LW
Sbjct: 474 -------------------------------ALKSGIPEEELPGIVKRWRKANPRIVKLW 502

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS--- 578
               E     V+E  ++          +  R     +   LPS R L Y + +       
Sbjct: 503 YAAEEAALTAVREKRTVPL-----AHGVKYRYKSGTLFADLPSGRSLAYVNPRIKPDPNF 557

Query: 579 --------YLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHD 630
                    ++    + M  RTYGG+L EN+VQAI+RD L E +       Y  V+ VHD
Sbjct: 558 GKDGLVFDGMDQIKKKWMSHRTYGGRLVENLVQAIARDCLAESLMRLDAAEYRTVMHVHD 617

Query: 631 EIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E+V + P     SV  +  +M++   WA GLPL A G+E + Y+K
Sbjct: 618 EVVLDVPIGT-GSVDHVTGIMSQPIDWAPGLPLSAAGFECEFYQK 661


>gi|304406771|ref|ZP_07388426.1| DNA-directed DNA polymerase [Paenibacillus curdlanolyticus YK9]
 gi|304344304|gb|EFM10143.1| DNA-directed DNA polymerase [Paenibacillus curdlanolyticus YK9]
          Length = 653

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 206/699 (29%), Positives = 316/699 (45%), Gaps = 71/699 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K G + YA+     I + AY+WD  PV++ D  +   +P +++
Sbjct: 1   MRTLNIDIETYSSIDIKKAGAYKYAQSPDFQILMFAYSWDGGPVQIVDLAQGEYLPQEIV 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           + L D  V+  A+N+ FE     +      P ++W CT V     G  + L     AL  
Sbjct: 61  EALADPAVVKHAYNAAFEWYCLNRFF--YSPIEQWRCTQVHGLYCGYTAGLGAVGEALGI 118

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
            +   K+  G +LI  F   CK +  +     T  +H  + W+LF EYC  DV A  E+ 
Sbjct: 119 PQDKRKLGTGGSLIRTFCIPCKPTRTNGMRTRTLPHHEPEKWKLFKEYCVGDVVAEMEIQ 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           +RL   P+ D E  LW LDQ IN RG   DL +V     +  Q   +L  + + LT   +
Sbjct: 179 RRLSAFPVPDQEWQLWHLDQRINARGLFCDLQMVEGALAVDEQVTSELRAEAISLTG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            + +    L  +L   TG ++ ++ +GT+  ++   +  + A+ ++  R   S ++  K 
Sbjct: 237 DNPKSVQQLSKWLAEETGEEVENLQKGTVSKLIDKLDEGK-ARRVLEIRQELSKTSTKKY 295

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             +  A  SD R+RG LQFYGA+RTGRW+G + Q QNLPR   S     + +    + E 
Sbjct: 296 AAMQTAAGSDQRVRGLLQFYGANRTGRWAGRLVQIQNLPRNYLSTLEYARQLVVERKVEM 355

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                 +     S  +R+  +   GK+L VAD + IEARV+AW+AGE W++  FA    I
Sbjct: 356 LKFVYGNVPDTLSQLIRTAFVVPAGKQLGVADFSAIEARVIAWLAGEQWRLDVFATHGKI 415

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ F  PI+++ K  + R  GKV ELALGYQGG      M               
Sbjct: 416 YEASASQMFGVPIEQIGKGSDLRQKGKVAELALGYQGGKGALIAMG-------------- 461

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   L       +   WR  ++ ++ LW  +  
Sbjct: 462 --------------------------ALDQGLTEAELPEIVTRWRNANRRIVDLWYSMEA 495

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS-------- 578
               V++ G  +  R +           +    I LPS R+L Y+      +        
Sbjct: 496 AAIEVMETGQPVGVRGLIFARESHHATKQDFFTITLPSGRKLFYAKPFLRENDFGKPALH 555

Query: 579 --YLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
              ++  + +     TYGGKL EN VQAI+RD L   +      GY IVL VHDE+ +E 
Sbjct: 556 YWGMDQTSKKWTVLNTYGGKLVENCVQAIARDCLAVTLMRLDHVGYPIVLHVHDEVGAEL 615

Query: 637 PDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             +    +  +  +M +   WA GLPLK +G+    Y K
Sbjct: 616 --SSADELDRMLEIMAQPIQWAPGLPLKGDGFVTNFYMK 652


>gi|76786923|ref|YP_329353.1| prophage LambdaSa04, DNA polymerase [Streptococcus agalactiae A909]
 gi|76561980|gb|ABA44564.1| prophage LambdaSa04, DNA polymerase [Streptococcus agalactiae A909]
          Length = 651

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 194/706 (27%), Positives = 303/706 (42%), Gaps = 89/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + +L ID+ET     L K GV++YAE     I L A + D+ PV ++D T +  +P  +L
Sbjct: 3   IKELSIDLETYCEVDLRKSGVYSYAEDDSFEILLLAVSVDNGPVTVYDLT-KENLPDQIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID---------IPSKRWICTSVLARTNGLPSSL 109
           Q L +++++  A N+ FERI     L            +    W C+ V +   GLP SL
Sbjct: 62  QALVNDSIIKWAFNASFERICLSNWLKKHHPKLLSEGFLSPNSWRCSMVWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFC---KGSIDSPPYDCTRANH-VQAWQLFGEYCKR 165
           +     L   E   K  EG  +I  FC   K +  +        +H    W  F  Y KR
Sbjct: 122 EGVGTVLKLKEQKLK--EGGDVIRYFCLPCKPTKINGGRKRNFPHHAPDKWAAFINYNKR 179

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    +  +L   P+ D   + +  DQ INDRG  ID+D V     +  + + K+ E+
Sbjct: 180 DVEVELAIKNKLRNHPVPDFLWEEYHQDQNINDRGIGIDVDFVKAAITIDEESKSKIQEE 239

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           + +LT     +      +  +L    G+    + +  +K +L   +       ++  R  
Sbjct: 240 LKELTGLE--NPNSVLQMIGWLREH-GVTTNSLDKKAVKELLKVVDAKT--TKVLKLRQQ 294

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           ++ S++ K   +   V  DGR RG  QFYGA+RTGRW+G + Q QNLP+    +    + 
Sbjct: 295 AAKSSVSKYQAMVNCVCLDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLPDLKEARD 354

Query: 344 IQALNRGETIA---DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           +      E            S  +R+  + S+GKK +V D + IEARVL+ +AGE W+  
Sbjct: 355 LFKTGDLEATDLLYGTQDTLSQLIRTAFVPSDGKKFIVCDFSAIEARVLSHLAGEKWRSM 414

Query: 401 AFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F  G+DIY  + ++ F  P++K   + + R  GK+ ELA GY G     K M       
Sbjct: 415 VFEQGKDIYCMSASQMFGVPVEKHGRNADLRQKGKIAELACGYGGAVGALKAMG------ 468

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                             A+   L     + +  +WR  +  ++
Sbjct: 469 ----------------------------------AIDMGLDEQELQPLVDSWRQANPNIV 494

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             W D+ +     ++               +  +  K  + I LPS R+L Y   K   +
Sbjct: 495 LFWWDVDKAVKTAIKYQKQTET------HGIQFKVRKGMLFITLPSGRKLAYVKPKMGEN 548

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                           +  R  +YG K  ENI+QAISRDIL   MK      + IV  VH
Sbjct: 549 QFGGESVTYEGTGTAKRWERLESYGPKFVENIIQAISRDILAYSMKQL--KDFRIVGHVH 606

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DEI+ E       ++  + +LM K P W   + L+A+GYE   Y+K
Sbjct: 607 DEIIIEC--DQSQNLEQIATLMGKAPYWMPDINLRADGYECLFYQK 650


>gi|170023450|ref|YP_001719955.1| DNA-directed DNA polymerase [Yersinia pseudotuberculosis YPIII]
 gi|169749984|gb|ACA67502.1| DNA-directed DNA polymerase [Yersinia pseudotuberculosis YPIII]
          Length = 693

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 258/696 (37%), Positives = 369/696 (53%), Gaps = 30/696 (4%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L++D+ET S  P+   G  AYA  A I L A+A DD PV + + TE   +P  L   LR
Sbjct: 4   ILWLDLETYSETPIR-NGTHAYAANAEIMLIAWAIDDGPVSVHEFTEPKNLPVPLCTALR 62

Query: 63  DETVMCVAHNSLFERILFKKTLG-IDIP------SKRWICTSVLARTNGLPSSLKNACLA 115
           D   +  AHNS F+R + +  L     P        RW  T V A  +GLP SL + C  
Sbjct: 63  DGETLVYAHNSQFDRTVLRTHLKSYKWPNVAARDVTRWRDTMVKALAHGLPGSLSDLCDI 122

Query: 116 LNFSEHLTKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELF 174
           L  ++   K + GKALI  FCK    +      T+  H + W+ F +Y   D+EA RE+ 
Sbjct: 123 LGVAQDKAKDKAGKALIQLFCKPRAKNSAIRRATKQTHPEEWKRFIDYAGLDIEAMREID 182

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           K+L        E  LW  DQ INDRG ++D  L       +  E+K+L      LTD  +
Sbjct: 183 KKLPVWNYQSNELALWHFDQRINDRGVQMDTVLAEAAVSAVEIEQKRLAVRTQDLTDNEV 242

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
           +++ Q   L  ++    G+ L DM   T++  +S  ++    ++L+  RL +S ++  K 
Sbjct: 243 QAATQRDVLLKHIVEAFGVTLPDMQASTIQRRVSDPDLPIELRELLAIRLQASTTSTSKY 302

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
            TL + VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E +   I+AL  G  
Sbjct: 303 KTLLKGVSKDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPVLGQETIDTGIEALKAGCA 362

Query: 353 ---IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG---- 405
                + + L S  +R CI+A  GKKLVV+DL+ IE R L W++GE+WK++AF +     
Sbjct: 363 DLLFDNVMELISSALRGCIVAPEGKKLVVSDLSNIEGRALVWLSGEEWKLQAFRDYDAGT 422

Query: 406 -EDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
             D+Y+  YA+AFN   D V K QR IGKVMEL LG+ GG   F T A   GLDL   ++
Sbjct: 423 GHDLYMLAYARAFNISPDNVDKIQRQIGKVMELGLGFGGGVAAFLTFALVYGLDLDGLAK 482

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDL 524
                       +A+S +     Q   + + +++   AC+ +K+ WR  H   +  W ++
Sbjct: 483 AALPNVPASIQREAQSWYKASVKQKRTYGLSEQVFI-ACDSLKRMWRNAHPKTVSFWYEI 541

Query: 525 TEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK---GDCSYL- 580
            +     +         R     +L +RR    + I LPS R + Y  ++   G  SY+ 
Sbjct: 542 EDTVRRAIAAPRQTFTCR-----KLKIRRDGSWLRIQLPSGRAVCYPGIRIDEGKISYMG 596

Query: 581 -NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDT 639
            N+ + +  R +TYGGKLTEN+ QA +RD++   M     +GY+I LTVHDE+++E PDT
Sbjct: 597 INSYSRKWQRLKTYGGKLTENVTQAAARDVMANNMPLIETSGYEITLTVHDEVLTEAPDT 656

Query: 640 PYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             F+   L  L+  NP WA  LPL A G+EA  YRK
Sbjct: 657 EQFTSDKLSELLATNPEWALDLPLSAGGFEAYHYRK 692


>gi|319757792|gb|ADV69734.1| phage polymerase [Streptococcus suis JS14]
          Length = 651

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 199/706 (28%), Positives = 308/706 (43%), Gaps = 89/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + +L IDIET     L K GV+ YAE     I L A + ++ PV ++D + +  +P D+L
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFEILLFAVSVNNGPVTVYDLS-KEKLPQDIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID---------IPSKRWICTSVLARTNGLPSSL 109
           + L D+ V+  A N+ FER+     L            +    W C+ + +   GLP SL
Sbjct: 62  EALVDDRVIKWAFNASFERVCLSNWLKKYHPDLLLDRFLSPVSWRCSMIWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFC---KGSIDSPPYDCTRANH-VQAWQLFGEYCKR 165
           +     L   +   KM EG  LI  FC   K +  +        +H    W  F +Y +R
Sbjct: 122 EGVGTVLKLKDQ--KMREGADLIRYFCVPCKPTKINGGRTRNLPHHAPDQWATFIDYNRR 179

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    + +RL   P+ D   D +L DQ INDRG  ID+D V    ++  + + ++ E+
Sbjct: 180 DVEVELAIKERLKNFPVPDFVWDEYLQDQIINDRGIGIDVDFVKAAIKIDTESKAQIQEE 239

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  LT     +      +  +L    G+    + +  +K +L   +       ++  R  
Sbjct: 240 LKALTSLE--NPNSVLQMIGWLREH-GVTTDSLDKKAVKELLKTVDDKT--SKVLKLRQQ 294

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           ++ S++ K   +   V  DGR RG  QFYGA+RTGRW+G + Q QNLP+    +    + 
Sbjct: 295 AAKSSVSKYQAMMNCVCKDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLPDLEEARK 354

Query: 344 IQALNRGET---IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           +      E    + D     S  +R+  + S GKK +V D + IEARVL+ +AGE W+ K
Sbjct: 355 LFKTGDLEATELLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGEKWRSK 414

Query: 401 AFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F  G+DIY  + ++ F  P++K   + + R  GK+ ELA GY G     K M       
Sbjct: 415 VFELGKDIYCMSASQMFGVPVEKHGQNSKLRQKGKIAELACGYGGSVGALKAMG------ 468

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                             A+   L     + +  +WR  +  ++
Sbjct: 469 ----------------------------------ALDMGLSEEELQPLVNSWRQANPNIV 494

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
            LW D+       V+E    S         +        + I LPS R+L Y   +   +
Sbjct: 495 LLWWDVDNAVKTAVKEQIPTST------HGIQFEVRSGILFITLPSGRKLAYIKPRIGEN 548

Query: 579 YLN---------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                           +  R  +YG K  ENIVQAISRDIL   +K   +  + IV  VH
Sbjct: 549 QFGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAYSLKQLKE--FKIVGHVH 606

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + SLM   P W   + L+A+GYE   Y+K
Sbjct: 607 DEVIIECPMEQ--KIDKIASLMGIAPDWMSDINLRADGYECLFYQK 650


>gi|153581904|emb|CAM34262.1| phage polymerase [Streptococcus pyogenes]
 gi|262113717|emb|CAR95384.1| hypothetical protein [Streptococcus phage phi-m46.1]
          Length = 651

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 204/706 (28%), Positives = 308/706 (43%), Gaps = 89/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + +L IDIET     L K GV+ YAE     + L A + D+ PV ++D   +  +P D+L
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFELLLFAVSVDNGPVTVYDF-NKEKLPQDIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID---------IPSKRWICTSVLARTNGLPSSL 109
           + L D+ V+  A N+ FERI     L            +    W C+ + +   GLP SL
Sbjct: 62  EALVDDRVIKWAFNASFERICLSNWLKKHHPELLLDGFLSPNSWRCSMIWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFC---KGSIDSPPYDCTRANH-VQAWQLFGEYCKR 165
           +     L   +   KM EG  LI  FC   K +  +        +H    W  F +Y +R
Sbjct: 122 EGVGTVLKLKDK--KMREGADLIRYFCVPCKPTKVNGGRIRNFPHHAPDKWSAFIDYNRR 179

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    + +RL   P+ D   D +  DQ INDRG  ID+D V    ++  + + K+ E+
Sbjct: 180 DVEVELAIKERLKNFPVPDFVWDEYHQDQIINDRGLGIDVDFVKAAIKIDRESKAKIQEE 239

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  LT     +      +  +L    G+    + +  +K +L   + T     ++  R  
Sbjct: 240 LKALTGLE--NPNSVLQMIGWLREH-GVTTDSLDKKAVKGLLKTVDETT--AQVLKLRQQ 294

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           ++ S++ K   +   V  DGR RG  QFYGA+RTGRW+G + Q QNLP+    +    + 
Sbjct: 295 AAKSSVSKYQAMMNCVCKDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLPDLEEARE 354

Query: 344 IQALNRGETIADP---LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           +      E            S  +R+  + S GKK +V D + IEARVL+ +AGE W+ K
Sbjct: 355 LFGTGDLEATELIYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGERWRSK 414

Query: 401 AFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F  G+DIY  + ++ F  P++K   + E R  GK+ ELA GY G     K M       
Sbjct: 415 VFEQGKDIYCMSASQMFGVPVEKHGQNSELRQKGKIAELACGYGGSVGALKAMG------ 468

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                             A+   L     + +  +WR  +  ++
Sbjct: 469 ----------------------------------ALDMGLTEEELQPLVNSWRLANPNIV 494

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKG--- 575
             W D+       V+E    S         +     +  + I LPS R+L Y   +    
Sbjct: 495 LYWWDVDNAVKTAVKELIPTST------HGIQFEVKRGILFITLPSGRKLAYIKPRIGDN 548

Query: 576 -----DCSYLNTATSQ-LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                  +Y  T T++   R  +YG K  ENIVQAISRDIL   MK      + IV  VH
Sbjct: 549 QFGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFSMKQL--KNFKIVGHVH 606

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + SLM   P W   + L+A+GYE   Y+K
Sbjct: 607 DEVIIECPIEQ--KLDEVASLMGIAPDWLSDINLRADGYECFFYQK 650


>gi|298346386|ref|YP_003719073.1| DNA-directed DNA polymerase [Mobiluncus curtisii ATCC 43063]
 gi|298236447|gb|ADI67579.1| DNA-directed DNA polymerase [Mobiluncus curtisii ATCC 43063]
          Length = 658

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 206/693 (29%), Positives = 312/693 (45%), Gaps = 74/693 (10%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQ 59
             L +D+ET S   L + GV+ Y +     I LC+Y+ DD  V   D      +P +++ 
Sbjct: 20  KSLALDLETFSAVNLSQCGVYRYCDDPSFRILLCSYSVDDSDVVTVDLASGEQLPPEVVA 79

Query: 60  YLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFS 119
            L D +V+  A+N+ FER      LG  +    W CT V A T GLP SLK+    L  +
Sbjct: 80  ALDDPSVIKWAYNAAFERTCLSAHLGHRLDPTGWRCTMVWAATLGLPLSLKDVGTVLGLA 139

Query: 120 EHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL-- 177
               K+ EGK LI  F   +          ++   AW LF +Y  RDVE    + ++L  
Sbjct: 140 HQ--KLAEGKDLIKYFSLPTKT--GIRHQPSDDSAAWALFKQYNARDVEVETTIRRKLSH 195

Query: 178 IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQ 237
            P+ D     + +DQ INDRG  ID  L         + RK+      +LT   + +   
Sbjct: 196 HPVPDEVWGQYEVDQRINDRGIHIDTRLATNAMACDKKYRKRTLARAQELTG--LDNPAS 253

Query: 238 TYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE 297
              L+ +L    G  +  M++  + S L  +  +   ++ +  R   S S++ K   +++
Sbjct: 254 PLQLQSWLAE-QGCKISSMAKEDVDSALDTATGS--VREALELRQDLSKSSVAKYRKMAD 310

Query: 298 AVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET----I 353
           A  +DGR  G LQFYGASRTGRW+G + Q QNLPR    +    +++      +      
Sbjct: 311 ATCADGRAHGLLQFYGASRTGRWAGRLVQVQNLPRNYLPDLAQARSLVHYGDFDVLEMLY 370

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTY 413
                  S  +R+  I S   + +VAD + IEARVLAW+AGE+  + AF NGED+Y  T 
Sbjct: 371 PSVPDTLSQLIRTAFIPSENHRFIVADYSAIEARVLAWLAGEETTLAAFTNGEDLYCATA 430

Query: 414 AKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
           +  F  P++K   + E R  GK+  LA GY G     K M                    
Sbjct: 431 SAMFGVPVEKHGANAELRQKGKIAVLACGYNGSVGALKAMG------------------- 471

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
                                A+K  L  +  + +  AWRA +  ++ +W D+ +     
Sbjct: 472 ---------------------ALKMGLTASELQPIVDAWRAANPNIVAMWHDVDQTAIQA 510

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTAT------- 584
                 I+ R    +  L     K  + I LPS RRL Y       +     +       
Sbjct: 511 ------ITTRSTVTLGNLSFTGTKGMLFITLPSGRRLAYVKPGLGVNRFGGTSITYWGQG 564

Query: 585 --SQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYF 642
              +  +  TYGGKL ENIVQA +RD+L E +      G+++V+ +HDE+V +       
Sbjct: 565 INRKWQQLETYGGKLVENIVQATARDLLAEAITRIENAGHEVVMHIHDEVVVDESKDSGT 624

Query: 643 SVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           +V  +C+LM + P+WA GLP+ A GY+   Y K
Sbjct: 625 TVADICTLMNQLPTWALGLPIDAAGYKCDFYMK 657


>gi|227875067|ref|ZP_03993212.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35243]
 gi|304390310|ref|ZP_07372263.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|306817354|ref|ZP_07451099.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35239]
 gi|227844345|gb|EEJ54509.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35243]
 gi|304326066|gb|EFL93311.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|304649795|gb|EFM47075.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35239]
          Length = 655

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 211/707 (29%), Positives = 314/707 (44%), Gaps = 85/707 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  LF DIE+ S   L K GV+ YAE     + L  Y+ D  P+++ D     ++P ++L
Sbjct: 1   MRTLFCDIESFSLAQLAKTGVYPYAEHPDFELLLFGYSIDGGPIEVVDLANGQSIPDEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIP---------SKRWICTSVLARTNGLPSSL 109
             L D +V+  AHN+ FER+     L    P          ++W CT + +   GLP SL
Sbjct: 61  AALVDPSVVKWAHNAAFERVCLSAWLRTHHPELLADGFLGPRQWRCTMIWSAYLGLPMSL 120

Query: 110 KNACLALNFSEHLTKMEEGKALIARFCKGS----IDSPPYDCTRANHVQAWQLFGEYCKR 165
                 L       K   GK LI +FC  +    ++        +     W  F +Y +R
Sbjct: 121 DAVATVLKLDVQ--KDTVGKKLIKQFCTPATPSVLNGGKRRNPPSADPTGWARFIDYNRR 178

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    +  RL   P+ + E D + LDQ IND G  +D  LV     +    R      
Sbjct: 179 DVEVELAIHDRLACFPMPESEWDTYTLDQRINDAGILLDHTLVDNAVGVDEHHRNATLAR 238

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
              LT     +      L+ +L    G  L  +++  + + L  +  T   K+++  R  
Sbjct: 239 AQTLTGLE--NPNSPIQLKQWLASR-GCVLDSLAKAEVDAALDTATGT--VKEVLGLRGD 293

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
            + S++ K   +     SDGR RG +QFYGA RTGR++G + Q QNLPR    +    +T
Sbjct: 294 LAKSSVKKYQAMQNVAGSDGRARGLIQFYGAGRTGRFAGRLVQVQNLPRNYLPDLDQART 353

Query: 344 IQALNRGETI----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKI 399
           +      E +           S  +R+  I S G + +VAD + IEARV+AW+AGE   +
Sbjct: 354 LVRTGNLEALELLHESVPDTLSQLIRTAFIPSPGHRFIVADFSAIEARVIAWLAGETTTL 413

Query: 400 KAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
           +AF  G+D+Y  T ++ F  P++K   + E R  GK+  LA G+ G     + M      
Sbjct: 414 QAFREGKDLYCETASRMFGVPVEKHGVNGELRQKGKLAVLACGFGGSTGALERMG----- 468

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
                                              A+   L     + +  AWRA +  +
Sbjct: 469 -----------------------------------ALTMGLAEHELKPIVDAWRAANPHI 493

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC 577
           + LW  +            +I++R+   +  L        + I LPS RRL Y   +   
Sbjct: 494 VALWAGV------EEAAIAAIASRQSIRLRNLRFSVEAGILFIELPSGRRLAYVKPRLGE 547

Query: 578 SYL---------NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
           +            T   +  +  TYGGKLTENIVQAI+RD+L  GM    K G+ IV+ V
Sbjct: 548 NRWGGTSITYTGTTTARRWGQLETYGGKLTENIVQAIARDLLVTGMHAVAKAGHQIVMHV 607

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDEIV + P+   F+    C LM+  P+WA+GLPL A+GYE   YRK
Sbjct: 608 HDEIVIDEPENSGFTATGACELMSTLPAWAEGLPLDADGYECAYYRK 654


>gi|307569599|emb|CAR82778.1| phage-related DNA polymerase family protein [Listeria monocytogenes
           L99]
          Length = 644

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 213/693 (30%), Positives = 319/693 (46%), Gaps = 72/693 (10%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQ 59
             L IDIET S + +   G +AY  +E   I L AYA+DDEPVK+ D T    +P  +L+
Sbjct: 4   KVLRIDIETYSGRDIKNCGAYAYTESEDFEILLFAYAYDDEPVKVIDLT-IDEIPDTVLE 62

Query: 60  YLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFS 119
            L +  V+  AHN+ FER    K     +P ++W CT V     GLP+SL     AL  +
Sbjct: 63  DLNNRRVLKTAHNANFERTCLAKYYNRKMPPEQWQCTMVHGTLLGLPASLDMMSKALRLA 122

Query: 120 EHLTKMEEGKALIARFC---KGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRELFK 175
           +   K  EGKALI  FC   K +  +         H  + W  F EYC++DV   R + K
Sbjct: 123 QE--KDNEGKALIRYFCMPCKPTKANGGRTRNYPEHASEKWAKFIEYCRQDVVVERSIAK 180

Query: 176 RL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIR 233
           ++   P  + E+  W LDQ I D+G RID+DLV        + +  L +    LT     
Sbjct: 181 KIAKFPFPEDEQRNWELDQRIADKGVRIDVDLVKHAIACQERYQASLSKKAKGLTGLE-- 238

Query: 234 SSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLN 293
           +      L+ +L    G  +  +++ ++  +L+  ++ +  ++++L R   S ++I K  
Sbjct: 239 NPNSVQQLKDWLAD-MGYPVSSLNKDSVSELLADEDLDEDVREMLLLRQEMSKTSIKKYE 297

Query: 294 TLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI 353
            +  A   DGR+RG LQF GA+RTGRW+G + Q QNLPR    +    +        E  
Sbjct: 298 KMQHARCHDGRVRGLLQFNGANRTGRWAGRLVQVQNLPRNYIKDIAEVRKDLKAGDYEAF 357

Query: 354 A----DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIY 409
                +   + S  +R+  IA +G    + D + IEARV+AW+AGE W++  F +   IY
Sbjct: 358 EMMYSNVPDVLSQLIRTAFIAEDGYTFDITDFSAIEARVIAWLAGEQWRLDVFNSHGKIY 417

Query: 410 VTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
             + ++ F+ PI++V K  R  GKV ELALGY GG      M                  
Sbjct: 418 EASASQMFHIPIEEVDKNLRQKGKVSELALGYNGGVNALIAMG----------------- 460

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
                                  A++  L     + +  AWR     +  LW+ + +   
Sbjct: 461 -----------------------ALEMGLKENELQGIVDAWRKASPAITSLWRGVEKHAK 497

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK-------GDCSYLNT 582
                   IS R+      L        + I LPS R L Y   K           Y   
Sbjct: 498 LA------ISTRKSQKYKGLTFYYEAGILFIKLPSGRNLAYFRAKLVPGKYGPQICYEGV 551

Query: 583 ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYF 642
                 ++ TYGGKL ENIVQAI+RD L   ++     G D V+ VHDE ++E  ++   
Sbjct: 552 TDKGWRKQYTYGGKLVENIVQAIARDCLAISLRRIEDTGIDTVMHVHDEAITEVQESES- 610

Query: 643 SVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           SV  L +++ +  SWA GLPL+ +G+ +  Y K
Sbjct: 611 SVDKLNAILAEPISWAPGLPLQGDGFSSDFYMK 643


>gi|260161774|emb|CAZ39318.1| phage polymerase [Streptococcus suis]
 gi|313575356|emb|CBR26885.1| hypothetical protein [Streptococcus phage phi-SsUD.1]
          Length = 651

 Score =  484 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 202/706 (28%), Positives = 311/706 (44%), Gaps = 89/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + +L IDIET     L K GV+ YAE     + L A + D+ PV ++D   +  +P D+L
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFELLLFAVSVDNGPVTVYDF-NKEKLPQDIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID---------IPSKRWICTSVLARTNGLPSSL 109
           + L D+ V+  A N+ FERI     L            +    W C+ + +   GLP SL
Sbjct: 62  EALVDDRVIKWAFNASFERICLSNWLKKHHPELLLDGFLSPNSWRCSMIWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFC---KGSIDSPPYDCTRANH-VQAWQLFGEYCKR 165
           +     L   +   KM EG  LI  FC   K +  +        +H    W  F +Y +R
Sbjct: 122 EGVGTVLKLKDK--KMREGADLIRYFCVPCKPTKVNGGRIRNFPHHAPNKWSTFIDYNRR 179

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    + +RL   P+ D   D +  DQ INDRG  ID+D V    ++ ++ + K+ E+
Sbjct: 180 DVEVELAIKERLKNFPVPDFVWDEYHQDQIINDRGIGIDIDFVKAAIKIDSESKAKIQEE 239

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  LT     +      +  +L    G+    + +  +K +L  ++ T     ++  R  
Sbjct: 240 LKALTRLE--NPNSVLQMIGWLREH-GVTTDSLDKKVVKELLKTADETT--AQVLKLRQQ 294

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           ++ S++ K   +   V  DGR RG  QF+GA+RTGRW+G + Q QNLP+    +    + 
Sbjct: 295 AAKSSVSKYQAMMNCVCKDGRARGMFQFFGANRTGRWAGRLVQLQNLPQNHLPDLEEARE 354

Query: 344 IQALNRGETIA---DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           +      E      D     S  +R+  + S GKK +V D + IEARVL+ +AGE W+ K
Sbjct: 355 LFGTGDLEATEFLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGERWRSK 414

Query: 401 AFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F  G+DIY  + ++ F  P++K   + E R  GK+ ELA GY G     K M       
Sbjct: 415 VFEQGKDIYCISASQMFGVPVEKYGQNSELRQKGKIAELACGYGGSVGALKAMG------ 468

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                             A+   L       +  +WR  +  ++
Sbjct: 469 ----------------------------------ALDMGLKDKELRPLVDSWRQANPNIV 494

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKG--- 575
             W D+       +++              +    +K  + I LPS R+L Y   K    
Sbjct: 495 LFWWDVDRAVKTAIKQHIQTET------HGIQFEVNKGMLSITLPSGRKLAYVKPKIGEN 548

Query: 576 -----DCSYLNTATSQ-LMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                  +Y  T T++   R  +YG K  ENIVQAISRDIL   MK   +  ++IV  VH
Sbjct: 549 QFGGESITYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFAMKQLQE--FNIVGHVH 606

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E       S+  +  LM   P W   + L+A+GYE   Y+K
Sbjct: 607 DEVIIECGIDQ--SLDEIAYLMGIAPEWMTDIKLRADGYECSFYQK 650


>gi|77412069|ref|ZP_00788395.1| DNA polymerase, putative [Streptococcus agalactiae CJB111]
 gi|77161874|gb|EAO72859.1| DNA polymerase, putative [Streptococcus agalactiae CJB111]
          Length = 651

 Score =  484 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 193/706 (27%), Positives = 302/706 (42%), Gaps = 89/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + +L ID+ET     L K GV++YAE     I L A + D+ PV ++D T +  +P  +L
Sbjct: 3   IKELSIDLETYCEVDLRKSGVYSYAEDDSFEILLLAVSVDNGPVTVYDLT-KENLPDQIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID---------IPSKRWICTSVLARTNGLPSSL 109
           Q L +++++  A N+ FERI     L            +    W C+ V +   GLP SL
Sbjct: 62  QALVNDSIIKWAFNASFERICLSNWLKKHHPKLLSEGFLSPNSWRCSIVWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFC---KGSIDSPPYDCTRANH-VQAWQLFGEYCKR 165
           +     L   E   K  EG  +I  FC   K +  +        +H    W  F  Y KR
Sbjct: 122 EGVGTVLKLKEQKLK--EGGDVIRYFCLPYKPTKINGGRKRNFPHHAPDKWAAFINYNKR 179

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    +  +L   P+ D   + +  DQ IND G  ID+D V     +  + + K+ E+
Sbjct: 180 DVEVELAIKNKLRNHPVPDFLWEEYHQDQNINDSGIGIDVDFVKAAITIDEESKSKIQEE 239

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           + +LT     +      +  +L    G+    + +  +K +L   +       ++  R  
Sbjct: 240 LKELTGLE--NPNSVLQMIGWLREH-GVTTNSLDKKAVKELLKVVDAKT--TKVLKLRQQ 294

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           ++ S++ K   +   V  DGR RG  QFYGA+RTGRW+G + Q QNLP+    +    + 
Sbjct: 295 AAKSSVSKYQAMVNCVCLDGRARGMFQFYGANRTGRWAGRLVQLQNLPQNHLPDLKEARD 354

Query: 344 IQALNRGETIA---DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           +      E            S  +R+  + S+GKK +V D + IEARVL+ +AGE W+  
Sbjct: 355 LFKTGDLEATDLLYGTQDTLSQLIRTAFVPSDGKKFIVCDFSAIEARVLSHLAGEKWRSM 414

Query: 401 AFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F  G+DIY  + ++ F  P++K   + + R  GK+ ELA GY G     K M       
Sbjct: 415 VFEQGKDIYCMSASQMFGVPVEKHGRNADLRQKGKIAELACGYGGAVGALKAMG------ 468

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                             A+   L     + +  +WR  +  ++
Sbjct: 469 ----------------------------------AIDMGLDEQELQPLVDSWRQANPNIV 494

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             W D+ +     ++               +  +  K  + I LPS R+L Y   K   +
Sbjct: 495 LFWWDVDKAVKTAIKYQKQTET------HGIQFKVRKGMLFITLPSGRKLAYVKPKMGEN 548

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                           +  R  +YG K  ENI+QAISRDIL   MK      + IV  VH
Sbjct: 549 QFGGESVTYEGTGTAKRWERLESYGPKFVENIIQAISRDILAYSMKQL--KDFRIVGHVH 606

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DEI+ E       ++  + +LM K P W   + L+A+GYE   Y+K
Sbjct: 607 DEIIIEC--DQSQNLEQIATLMGKAPYWMPDINLRADGYECLFYQK 650


>gi|297583086|ref|YP_003698866.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
 gi|297141543|gb|ADH98300.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
          Length = 644

 Score =  484 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 193/698 (27%), Positives = 308/698 (44%), Gaps = 78/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIE+ S   L K GV+ YAE     I L AY+ D  PV + D  +   +P  + 
Sbjct: 1   MKTLNIDIESYSRTDLAKSGVYRYAEAPDFDILLFAYSVDAGPVHVVDLAQGETIPDVVR 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
           Q L D+ V+  A N+ FER    + L   I    W C+ V +   GLP SL+ A +    
Sbjct: 61  QALTDDGVIKWAFNAQFERTCLSRYLNTPIHPTSWRCSMVWSAYLGLPLSLEGAAIVTG- 119

Query: 119 SEHLTKMEEGKALIARFCKGSI---DSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
                K++EGK LI  FCK       +   +    +H  + W  F  Y +RDVE  + + 
Sbjct: 120 -ADKKKLQEGKDLIRYFCKPCKPTQVNGGRERNFPHHDPEKWVAFKRYNQRDVETEQAIQ 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P+ + E   ++LDQ INDRG  +D   V          R+ L   +   T   +
Sbjct: 179 DKISRYPVPEQEWGHYVLDQIINDRGILLDPVFVEAAIACDTATREALMNRLR--TLTKL 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      ++ +L    G++   + +  +  +L  +       +++  R   + S++ K 
Sbjct: 237 ENPNSVMQMKDWLAE-QGVETGALDKAAVHELLKSAQGD--VAEVLTIRQKLAKSSVKKY 293

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             + +    D R RG +QFYGA+R+GR++G + Q QNLP+    +    + +   +  E 
Sbjct: 294 TAMKQVAGKDDRARGLIQFYGANRSGRYAGRLIQVQNLPQNHVPDLKEARDLVRASNLEA 353

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                     L S+ +R+  I     + +VAD + IEARV+AW+AGE W+ + FA    I
Sbjct: 354 LDMLYPSVPDLLSELIRTAFIPKEHHQFIVADFSAIEARVIAWLAGEAWRNEVFATHGKI 413

Query: 409 YVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + ++ FN P++++ K    R  GK+ ELALGY G     + M +   + +++     
Sbjct: 414 YEASASQMFNVPLEEIDKGSPLRQKGKISELALGYGGSVGALRAMGA-LDMGVEEEELKP 472

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
              +  +   +                                       ++Q W  + +
Sbjct: 473 LVQAWRQANPK---------------------------------------IVQFWWAVDQ 493

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN----- 581
                V++  + S         +        + + LPS R L Y       +        
Sbjct: 494 AAQKAVKQRTTTST------HGISFTYQSGLLLVGLPSGRHLSYVKPTIVLNDFGREGLC 547

Query: 582 ----TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                AT +  R  TYG KL ENIVQA+SRD+L   M+   + GY IV+ VHDE+V E  
Sbjct: 548 FEGIGATKKWERIDTYGPKLVENIVQAVSRDLLAHAMQRIEQEGYAIVMHVHDEVVVEAK 607

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
              + +V  +C+LMT  P W+ GL LKAEGY    Y+K
Sbjct: 608 --QHVTVSDICALMTDQPDWSSGLNLKAEGYACMFYQK 643


>gi|330862112|emb|CBX72276.1| putative DNA polymerase [Yersinia enterocolitica W22703]
          Length = 699

 Score =  484 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 260/703 (36%), Positives = 369/703 (52%), Gaps = 36/703 (5%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYL 61
            KL+ D ET    P+ K G  AYAE   + +  YA +D+PV  WD T  + MP DL  YL
Sbjct: 3   KKLWFDSETFCETPI-KNGTHAYAEHVEVMIITYALNDDPVSEWDITSGAKMPEDLKAYL 61

Query: 62  RDETVMCVAHNSLFERILFKKTLGIDIPS--KRWICTSVLARTNGLPSSLKNACLALNFS 119
           +D ++   A NS F+R + +  +   I    +RW  T V A  +GLP  L   C  L  +
Sbjct: 62  QDPSIEIYAQNSHFDRTMMRHDMPSVIAGGIERWRDTMVKALAHGLPGGLGVLCEILGIT 121

Query: 120 EHLTKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL- 177
           +   K +EGKALI  FCK    +   +  T   H + W+ F +Y   D+EA R + K+L 
Sbjct: 122 QDKAKDKEGKALIQLFCKPRAKNSTIHRATSKTHPEEWKRFLKYAGNDIEAMRAIDKKLP 181

Query: 178 -IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
                  E  LW  DQ INDRG ++D  L       +  E+K L +    LTD  ++++ 
Sbjct: 182 VWNYQGKELALWHFDQLINDRGVQMDTVLAEAAVTAVVDEQKLLAKRTQNLTDNEVQAAT 241

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  AL  ++    G+DL DM + TL+  ++   +  + ++L+  RL +S ++  K  TL 
Sbjct: 242 QRDALLRHIVESFGVDLPDMQKSTLERRIADPELPSVLRELLAIRLQASTTSTSKYKTLL 301

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---I 353
           + VS DGRLRGTLQF GASRTGRW+G +FQPQNLPR    +E +   I+AL  G      
Sbjct: 302 KGVSKDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPVLDQETIDTGIEALKAGCADLLF 361

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG-------- 405
            + + L S  +R CI+A  GKKLVV+DL+ IE RVLAW+AGE+WK++AF +         
Sbjct: 362 DNVMELISSALRGCIVAPKGKKLVVSDLSNIEGRVLAWLAGEEWKLEAFRDYDTIIGYDE 421

Query: 406 --------EDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
                    D+Y   YA+AFN   D V+K QR IGKVMEL LG+ GG   F T A   GL
Sbjct: 422 GGEALREGPDLYKLAYARAFNISPDDVTKLQRQIGKVMELGLGFGGGVAAFLTFALVYGL 481

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
           DL + +             +A+S +     Q   F + +++   AC+ +K+ WR  H   
Sbjct: 482 DLDELANAALPNVPTSIQREAQSWYQASVKQKRTFGLSEQVFI-ACDSLKRMWRNAHPET 540

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD- 576
           +  W ++       +               +L +RR    + I LPS R + Y  ++ + 
Sbjct: 541 VSFWSEIENTVRRAIINPKQT-----FVCRKLKIRRDGSWLRIQLPSGRSVCYPGIRIEG 595

Query: 577 --CSYL--NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEI 632
              SY+  NT + +  R +TYGGKL EN  QA +RD++   M      GY+I LTVHDE+
Sbjct: 596 DKISYMGVNTYSRKWQRLKTYGGKLAENATQAAARDVMANNMPLIEARGYEITLTVHDEV 655

Query: 633 VSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           ++E PDT  F+   L  L+  NP WA  LPL A G+EA  YRK
Sbjct: 656 LTEAPDTDAFTSDKLSELLATNPEWALDLPLSAGGFEAYHYRK 698


>gi|268610653|ref|ZP_06144380.1| hypothetical protein RflaF_14297 [Ruminococcus flavefaciens FD-1]
          Length = 658

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 217/714 (30%), Positives = 324/714 (45%), Gaps = 96/714 (13%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAV--ITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + ID+ETRS + + K GV+AYA+     ITL + + DD  V+L+D      +P D+L
Sbjct: 1   MKTIEIDLETRSDRDITKCGVYAYADSPYFAITLMSVSIDDGAVQLYDLANGDRVPEDIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL------------------GIDIPSKRWICTSVLA 100
             L DE+V+  A N  FER+   + L                  G  +    W CT +  
Sbjct: 61  TALVDESVVKRAFNVNFERVCLSRYLREEYPQIFRSYSIDADTVGDYLSPVGWQCTMIHC 120

Query: 101 RTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKG--SIDSPPYDCTRANHVQAWQL 158
           RT GL S+L +A  AL   +   KM EGKALI  FC    ++D  P   + A+  + W+ 
Sbjct: 121 RTLGLSSTLASAGAALKLEQQ--KMPEGKALIKYFCVPYDTVDGIPQFHSPADAPEKWET 178

Query: 159 FGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
           F  Y K+DVEA   + +RL   P+ D   + + LDQ INDRG R+D++LV     L AQ 
Sbjct: 179 FKAYNKQDVEAELAIDRRLSRFPVPDFIWEQFYLDQEINDRGIRVDMELVEAALTLDAQA 238

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKD 276
           +  L  ++ +LT     +    Y L  +L    G     + +  +K +L         K 
Sbjct: 239 KATLSSEMRRLTGIE--NPNSVYQLLEWLGE-QGYKSDCLDKAAVKELLKTVKDP--VKS 293

Query: 277 LILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERS 336
           ++  RL  S S++ K   +  A  SD R RG   FYGASRTGRW+G + Q QNLP+    
Sbjct: 294 VLELRLMLSKSSVKKYQAMQTAACSDSRARGMFSFYGASRTGRWAGRIIQLQNLPQNHIP 353

Query: 337 EEILTQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
           +    +        +       D     S  +R+  +   G K ++AD + IEARV+AW+
Sbjct: 354 DLTEARNTVKYGYYDEVEMFYGDVPDTLSQLIRTAFVPRPGYKFIIADFSAIEARVIAWL 413

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTP--IDKVSKEQRAIGKVMELALGYQGGAKVFKT 450
           AGE W++ AFANG DIY  + +K F  P     V+ E R  GKV ELA GY G     K 
Sbjct: 414 AGEKWRMDAFANGADIYCASASKMFGVPVVKHGVNGELRQKGKVAELACGYGGSVGAMKA 473

Query: 451 MASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
           M                                              L  +  + +   W
Sbjct: 474 MG----------------------------------------GDALNLSDSELKQIVTDW 493

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
           R     +++ W  + +     +++  +           L      + + I LPS R+L Y
Sbjct: 494 RDASPNIVKFWWTVDDAVKKAIKQKITTET------HGLQFSYQSKMLFITLPSGRKLCY 547

Query: 571 SDVKG--------DCSYLN-TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNG 621
           +  +           +Y+   A+ +  R  +YG K  ENIVQA++RD+L   M+      
Sbjct: 548 AHPQIGENQFGGESVTYMGVGASKKWERIESYGPKFVENIVQAVARDLLMFSMQTM--RC 605

Query: 622 YDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             IV  +HDE++ E       S+  +C  M + P+WA+GL L+A+GYE + YRK
Sbjct: 606 CFIVGHIHDEMIIEA--DRRMSLDEVCRQMERTPAWAEGLLLRADGYECEFYRK 657


>gi|288799805|ref|ZP_06405264.1| hypothetical protein HMPREF0669_00204 [Prevotella sp. oral taxon
           299 str. F0039]
 gi|288333053|gb|EFC71532.1| hypothetical protein HMPREF0669_00204 [Prevotella sp. oral taxon
           299 str. F0039]
          Length = 726

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 203/698 (29%), Positives = 315/698 (45%), Gaps = 75/698 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           +  L IDIET S   +   GV  Y +     I L AY+ D   V+L D  +   +P+ +L
Sbjct: 80  IKILSIDIETYSDNEI-TNGVHNYVDTPNFEILLFAYSCDGGSVQLVDLAQGEEIPAKIL 138

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  ++  A N+ FER+   K LG+ +   +W CT + A   GLP+SL++    L  
Sbjct: 139 DALTDSNIIKTAFNASFERVCIGKHLGLTLDPSQWHCTQIRALMLGLPASLQSCGEVLKL 198

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
                K+ EG  LI  F   CK +  +         H    W  F  YC RDVE  + + 
Sbjct: 199 KHK--KLREGAELIKYFSIPCKPTKSNGGRTRNLPEHAPDKWAQFKRYCIRDVEVEKAIQ 256

Query: 175 KR-----LIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           ++     L P++  ER L++ DQT+ND+G  ID +L      +  + + +L  ++ ++T+
Sbjct: 257 RKVCNNTLNPVTPFERALYIFDQTMNDKGVCIDSELANNAIRMNDEAQDELFAEMQEITN 316

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAI 289
               +      L+ +L    G  +  +++   K + + ++     K ++  R  SS +++
Sbjct: 317 LE--NPNSPVQLKQWLSSKLGRPIQSLAKEDAKELATGASED--VKRVLYLRSMSSKTSV 372

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNR 349
            K   ++ A  SD +L   LQFYGA +TGRW+G + Q  NLPR    +  L + +   N 
Sbjct: 373 KKYEAMTLAKCSDNKLHDLLQFYGA-KTGRWAGRIVQVHNLPRNSSKDLALARELVKKND 431

Query: 350 GE----TIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
            E    T  +   + S  +R+  IA     L V D + IEARV+AW+AGE+W++K F   
Sbjct: 432 FELLELTFGNVCDILSQLIRTAFIAKENYTLCVCDFSAIEARVIAWLAGEEWRLKVFRGS 491

Query: 406 EDIYVTTYAKAFNTPIDKVSKE--QRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
             IY  + A+ F      ++ +   R  GK+ ELALGY+GGA   K M +          
Sbjct: 492 GRIYEASAARMFGVDEKTITHDSPLRQKGKIAELALGYEGGANALKIMGADK-------- 543

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                             L       +   WR     +++LW+D
Sbjct: 544 --------------------------------MGLSDPEIAQIVSGWRNSSPNIVKLWRD 571

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK---GDCSYL 580
           +       +     I  ++      L+ R+    + I LPS R L Y   K       Y+
Sbjct: 572 VERAAKEAILSDRIIKLKQG----GLIFRKTSNILQIKLPSGRLLSYPLAKIVDNKICYM 627

Query: 581 --NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD 638
             N  T Q +   TYGGKL ENIVQAI+RD L E +    K GY+I   VHDEI++E P 
Sbjct: 628 SQNQTTRQWVDTETYGGKLVENIVQAIARDCLGETILRVDKKGYNICFHVHDEIIAEVPT 687

Query: 639 TP-YFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                ++  + ++     ++A  LPLK EGY    Y K
Sbjct: 688 DESAKALQDIKNIFATPITFAPDLPLKGEGYITPYYLK 725


>gi|168179450|ref|ZP_02614114.1| DNA polymerase [Clostridium botulinum NCTC 2916]
 gi|182669649|gb|EDT81625.1| DNA polymerase [Clostridium botulinum NCTC 2916]
          Length = 653

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 207/700 (29%), Positives = 307/700 (43%), Gaps = 73/700 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDL- 57
           M  L ID+ET     +  VG + Y E     I L AYA+DDEPVK+ D      +P  L 
Sbjct: 1   MRTLAIDVETYCELDIKSVGAYKYCEHPSFEIMLLAYAYDDEPVKIIDIMNGEKIPEVLE 60

Query: 58  LQYLRD-ETVMCVAHNSLFERILFKKTL-GIDIPSKRWICTSVLARTNGLPSSLKNACLA 115
                    V+  A N+ FER   K    G+      W CT V A T GLPSSL     A
Sbjct: 61  FDIYEHYSKVLKTAFNANFERNAIKAHFKGLKCHPGDWECTMVKALTLGLPSSLDMVGKA 120

Query: 116 LNFSEHLTKMEEGKALIARFCKGSI----DSPPYDCTRANHVQAWQLFGEYCKRDVEATR 171
           L F E   KM+EGKALI  FCK       +         + ++ W+ F EYCKRDVE  R
Sbjct: 121 LKFEEDKQKMKEGKALIQYFCKPCKPTKTNGKRTRNLPEHDMEKWETFKEYCKRDVEVER 180

Query: 172 ELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           E+   L     +  E++LW LDQ INDRG R+DL LV    +     +++L E+ + LT 
Sbjct: 181 EIRNLLNRYKTTIKEKELWQLDQHINDRGVRVDLVLVENAIKCDESYQERLKEEAINLTG 240

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAI 289
             + +      L+ ++    G ++  +++ ++  ++  S      K ++  R   + ++I
Sbjct: 241 --LNNPNSPTQLKKWISERVGHEVTSLTKDSIPILIEESKDKN-VKKILELRQLMAKTSI 297

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNR 349
            K  T+  A   D R+RG LQFYGA+RTGRW+G + Q QNLP+    +    + +     
Sbjct: 298 KKYQTMLNARCDDERVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLEEARNLLRNGD 357

Query: 350 GET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
            ET            S  +R+  I ++G + +VAD + IEARV+A++A E W++  F  G
Sbjct: 358 FETIEFLFDSIPDTLSQLIRTAFIPTDGNRFIVADFSAIEARVIAYLANEQWRLDVFKEG 417

Query: 406 EDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQN 465
            DIY  + +K F  P++K                   G     +                
Sbjct: 418 GDIYCASASKMFKVPVEKH------------------GINGHLRAKGKI----------- 448

Query: 466 VKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLT 525
                      +    +         F     +       +   WR     + Q W ++ 
Sbjct: 449 ----------AELALGYGGAGGAIRAFDKTGSIPDEDLPKLVSDWRKASPHITQFWWNVD 498

Query: 526 EGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSY------ 579
           +     + E  +++         +        + I LPS R+L Y   K +         
Sbjct: 499 KAAKKAITEKTTVALH-----HGIKFIYDPGVLFIQLPSGRKLSYLRPKIEEGKFGSDVI 553

Query: 580 ----LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSE 635
               +   + Q  R  TYG KL ENIVQA +RD L E M    K G+ +V+ VHDE+V +
Sbjct: 554 TYEGMEQTSKQWKRIETYGPKLVENIVQAFARDCLAETMARVEKKGFKVVMHVHDELVLD 613

Query: 636 TPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                  SV  +CS+  ++  WA GLPLKA+GYE   Y K
Sbjct: 614 VSK-EIGSVEEICSIFAESIEWAPGLPLKADGYECNYYMK 652


>gi|160937655|ref|ZP_02085015.1| hypothetical protein CLOBOL_02545 [Clostridium bolteae ATCC
           BAA-613]
 gi|158439300|gb|EDP17052.1| hypothetical protein CLOBOL_02545 [Clostridium bolteae ATCC
           BAA-613]
          Length = 661

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 211/707 (29%), Positives = 330/707 (46%), Gaps = 82/707 (11%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPS----D 56
            + +DIET S   + + GV+AYA      I L  Y +D + VK+ D T+  A P     D
Sbjct: 2   TMNVDIETYSSIDIREAGVYAYASAPDFEILLIGYRYDGQDVKVIDLTDPLADPERDFPD 61

Query: 57  LLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLAL 116
             + L    V+  A+N+ FER      LG  +P ++W CT+V A T GLP +L     AL
Sbjct: 62  FWEGLYSPDVIKTAYNANFERTCLASWLGRPMPPEQWRCTAVHAATLGLPGTLGGVGEAL 121

Query: 117 NFSEHLTKMEEGKALIARFCKGSI----DSPPYDCTRANHVQAWQLFGEYCKRDVEATRE 172
              E   K + GK+LI  FCK       +         +    WQLF EY ++DV A   
Sbjct: 122 GLPEDKQKDKIGKSLIQYFCKPCKPTKTNGMRSRNLPEHAPDKWQLFIEYNRQDVVAEAT 181

Query: 173 LFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L   P++  E++LW LDQ IND G R+D+DL  K+ +     +++L ++  KLT  
Sbjct: 182 IREKLQIYPVARQEQELWNLDQHINDHGVRLDMDLADKIIQYDGIYQERLKQEARKLTG- 240

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKD------LILNRLAS 284
            + +      L+M+ F+  G+D+  +++ ++  I +     +   D      ++  R   
Sbjct: 241 -LNNPNSLPQLKMWFFMTYGLDVPSITKDSIPVIEAQLKELKTTHDVLPGLRMLQIRKEL 299

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
             +++ K   +  AV  DG LRG LQFYGA+RTGRW+G + Q  NLP+ +  +  L + +
Sbjct: 300 GKTSVKKYQAMRHAVCPDGYLRGILQFYGANRTGRWAGRIVQVHNLPQNKIPDLDLARDL 359

Query: 345 QALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                 +T          + S  +R+  I S G + VV+D + IEARV+AW+A E W++ 
Sbjct: 360 VKQEDFDTLELLFEGIPFVFSQLIRTAFIPSEGYRFVVSDFSAIEARVIAWLADEKWRLN 419

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + A+ F+ PI+ + K    R  GKV ELALGY GG    K M       
Sbjct: 420 VFRTHGKIYEASAAQMFHVPIENIKKGSRLRQQGKVAELALGYGGGFGAMKAMDKAG--- 476

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                                  +      ++   WR     + 
Sbjct: 477 --------------------------------------TIPDDEIPMIIANWRKASPNIC 498

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
           +LW++        ++E  +I  +       L      R + I LPS R+L Y D + +  
Sbjct: 499 KLWRNAEAAARAAIEERRTIKLK-----HGLSFSYINRILFIGLPSGRKLAYYDTRIEDD 553

Query: 579 YLN----------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
                          T +  R +T+GGKL ENIVQA +RD L   M+  +  GY IV+ V
Sbjct: 554 EKGKSVITYAGVDQETKKWGRLKTWGGKLVENIVQATARDCLAVTMERVSGAGYQIVMHV 613

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDEI+ + P+T   ++  + ++M +   WA+ LPL+ +GYE   Y+K
Sbjct: 614 HDEIIVDVPETDIDALEKITAIMAQPVPWAQELPLRGDGYETPFYKK 660


>gi|237738628|ref|ZP_04569109.1| DNA polymerase [Fusobacterium sp. 2_1_31]
 gi|229424111|gb|EEO39158.1| DNA polymerase [Fusobacterium sp. 2_1_31]
          Length = 656

 Score =  479 bits (1234), Expect = e-133,   Method: Composition-based stats.
 Identities = 209/702 (29%), Positives = 318/702 (45%), Gaps = 74/702 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K G + YA  +   I L AY+ D + VK+ D  +  A+P ++L
Sbjct: 1   MRTLNIDIETFSSVDIGKSGAYKYAMSDDFQILLFAYSVDGQDVKIIDLAQGEAIPGEVL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L+DET +  A+N++FE        GI+ P ++W CT V     G  + L     A+  
Sbjct: 61  DLLKDETCIKYAYNAVFEWWCL-NMAGIETPLEQWHCTMVHGLYCGYTAGLAAIGNAMGL 119

Query: 119 SEHLTKMEEGKALIARFCKG---SIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRELF 174
            +   K+  G ALI  FC     +  +        +H  + W+LF EYC +DV    E+ 
Sbjct: 120 PQDKKKLTTGSALIRYFCIPCNPTKSNGNRTRNLPHHAPEKWELFKEYCIQDVVTEMEIG 179

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           +RL   P+ + E  LW+LD  +N  G R+D +LV     + A  R  L E+   +    +
Sbjct: 180 RRLSAFPVPEREWKLWVLDTFMNAYGVRVDSELVNGALYIDALSRANLLEEARDI--TKL 237

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +   T  L  +L    G ++ ++ + T+  ++   +  + AK ++  R   S +++ K 
Sbjct: 238 DNPNSTSQLLNWL-EEAGEEVENLQKATVGKMIDTLDDGK-AKRVLEIRQELSKTSVKKY 295

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
             + EA+  D R+RG LQFYGA+RTGR++G + Q QNLPR       + + +     GE 
Sbjct: 296 KAMDEAMCKDERVRGLLQFYGANRTGRYAGRLVQVQNLPRNYIETLDVARDVIKKGDGEL 355

Query: 353 ----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
                 +     S  +R+  I S G   VV+D + IEARV+AW+AGE+W+++ F     I
Sbjct: 356 LEMLYGNIPDTLSQLIRTAFIPSEGNHFVVSDFSAIEARVIAWLAGEEWRMEVFKTHGKI 415

Query: 409 YVTTYAKAFNTPIDKVSK-----EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
           Y  + ++ F  PI+ ++K       RA GKV ELALGYQG       M +          
Sbjct: 416 YEASASQMFGVPINTIAKGEENYHLRAKGKVAELALGYQGSVGALTAMGAA--------- 466

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                             L     + +   WR   + +++LW  
Sbjct: 467 -------------------------------DMGLTDEEMKDIVDRWRKSSKRIVELWYA 495

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS----- 578
           L      V++ G     + V           +    I LPS R+L Y       +     
Sbjct: 496 LENAAVEVLETGEPQIVKCVKLAKEYDFIYGQDFFTIELPSGRKLFYPKPFLKENQFGQM 555

Query: 579 -----YLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                 +N  T +     TYGGKLTENIVQAI+RD L E +      G+ IV  VHDEI+
Sbjct: 556 QMHYMGINQTTKKWEVIPTYGGKLTENIVQAIARDCLAETLLRVKAKGWPIVFHVHDEII 615

Query: 634 SETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
            + P +    +  +   MT+  SWAKGL L A G+    Y K
Sbjct: 616 LDVPKS--VELEEVIKTMTEEISWAKGLILNAAGFTGSYYMK 655


>gi|50914501|ref|YP_060473.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
 gi|40218547|gb|AAR83201.1| phage polymerase [Streptococcus pyogenes]
 gi|50261592|gb|AAT72360.1| DNA polymerase [Streptococcus pyogenes]
 gi|50903575|gb|AAT87290.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
          Length = 651

 Score =  479 bits (1232), Expect = e-133,   Method: Composition-based stats.
 Identities = 196/706 (27%), Positives = 304/706 (43%), Gaps = 89/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           + +L IDIET     L K GV+ YAE     + L A + D+ PV ++D   +  +P D+L
Sbjct: 3   IKELSIDIETYCEIDLRKSGVYRYAEDDSFELLLIAVSVDNGPVTVYDF-NKEKLPQDIL 61

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID---------IPSKRWICTSVLARTNGLPSSL 109
           + L ++ V+  A N+ FERI     L            +    W C+ + +   GLP SL
Sbjct: 62  EALVEDRVIKWAFNASFERICLSNWLKKHHPEFLSDGFLSPVSWRCSMIWSAYLGLPLSL 121

Query: 110 KNACLALNFSEHLTKMEEGKALIARFC---KGSIDSPPYDCTRANH-VQAWQLFGEYCKR 165
           +     L   +   KM EG  LI  FC   K +  +        +H    W  F +Y +R
Sbjct: 122 EGVGTVLKLKDQ--KMREGADLIRYFCLPCKPTKVNGGRIRNFPHHAPNKWSTFIDYNRR 179

Query: 166 DVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDED 223
           DVE    + +R+   P+     + +  DQ INDRG  ID+D V    ++  + + K+  +
Sbjct: 180 DVEVELAIKERVKNFPVPSFVWNEYHQDQIINDRGIGIDVDFVKAALKIDGESKAKIQAE 239

Query: 224 IVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
           +  LT            +  +L    G+    + +  +K +L   + T     ++  R  
Sbjct: 240 LKTLTGLEK--PNSVLQMISWLREH-GVATDSLDKKAVKELLKTVDETT--AQVLKLRQQ 294

Query: 284 SSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           ++ S++ K   +   V  DGR RG  QF+GA+RTGRW+G + Q QNLP+    +    + 
Sbjct: 295 AAKSSVSKYQAMMNCVCKDGRARGMFQFFGANRTGRWAGRLVQLQNLPQNHLPDLKEARE 354

Query: 344 IQALNRGET---IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
           +      E+   + D     S  +R+  + S GKK +V D + IEARVL+ +AGE W+ K
Sbjct: 355 LFRTGDLESTELLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGERWRSK 414

Query: 401 AFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F  G+DIY  + ++ F  P++K   + E R  GK+ ELA GY G     K M       
Sbjct: 415 VFEQGKDIYCMSASQMFGVPVEKHGQNSELRQKGKIAELACGYGGSVGALKAMG------ 468

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                             A+   L     + +  +WR  +  ++
Sbjct: 469 ----------------------------------ALDMGLSEEELQPLVNSWRQANPNIV 494

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             W D+       V+E    S +       +        + I LPS R+L Y   +   +
Sbjct: 495 LYWWDVDNAVKTAVKELLPTSTQ------NIQFEVKSGILFITLPSGRKLAYIKPRIGEN 548

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                           +  R  +YG K  ENIVQAISRDIL   MK      + IV  VH
Sbjct: 549 QFGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFSMKQLND--FKIVGHVH 606

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + SLM   P W   + L+A+GYE   Y+K
Sbjct: 607 DEVIIECPIEQ--KLDEVASLMGIAPYWLSDINLRADGYECFFYQK 650


>gi|225405823|ref|ZP_03761012.1| hypothetical protein CLOSTASPAR_05044 [Clostridium asparagiforme
           DSM 15981]
 gi|225042637|gb|EEG52883.1| hypothetical protein CLOSTASPAR_05044 [Clostridium asparagiforme
           DSM 15981]
          Length = 668

 Score =  478 bits (1229), Expect = e-132,   Method: Composition-based stats.
 Identities = 198/706 (28%), Positives = 298/706 (42%), Gaps = 76/706 (10%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQ- 59
            L IDIETRS   + K G + YA+     I L AY WDD PV++ D T   + P ++ + 
Sbjct: 5   HLSIDIETRSSVDISKAGAYRYAQSPDFEILLFAYQWDDGPVEVIDLTADESFPPEIWEE 64

Query: 60  YLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFS 119
            LRD  V+  A+N+ FE     +  G   P  +W CT       G  + L     A+   
Sbjct: 65  ALRDPDVIKHAYNAAFEWYCLNRA-GYATPLDQWRCTMAHGLYCGYTAGLDATGKAIGLP 123

Query: 120 EHLTKMEEGKALIARFC---KGSIDSPPYDCTRA-NHVQAWQLFGEYCKRDVEATRELFK 175
           +   K+  GKALI  FC   K +  +      +  +    W LF EYC++DV    E+ +
Sbjct: 124 QDKQKLAVGKALIRYFCVPCKPTKSNGGRTWNQPRHDPDKWTLFKEYCRQDVVTEHEILR 183

Query: 176 RL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIR 233
           RL   P+ + E  LW LD  +N  G R+D  L+     +     +KL  + V+LT     
Sbjct: 184 RLNFFPMPEDEERLWQLDVAMNAYGVRVDTKLIAGALYVDEVSTEKLTAEAVELTGLDNP 243

Query: 234 SSRQTYALRMYLFLITGIDLVDM----SEGTLKSILSH-SNITQLAKDLILNRLASSGSA 288
           +S       +        D  D+     + T++  L    N+ +    ++  R     ++
Sbjct: 244 NSGAQLVPWINAHNKEHPDDPDLLADLRKETVEEALKDRDNLPEDVARMLEIRQQLGKTS 303

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
           + K   +  A     R+RG  Q+YGA+RTGRW+G + Q QNLPR         + +    
Sbjct: 304 VKKYVAMDVARGEGDRVRGLTQYYGANRTGRWAGRLVQLQNLPRNYLKTLDYARELVKAK 363

Query: 349 RGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFAN 404
             +       +     S  +R+  I S G K VVAD + IEAR +AW+AGE W  + FA 
Sbjct: 364 NYDGLRILYGNVPDTLSQLIRTAFIPSEGHKFVVADFSAIEARAIAWLAGEQWVNEVFAT 423

Query: 405 GEDIYVTTYAKAFNTPIDKVSK-----EQRAIGKVMELALGYQGGAKVFKTMASHCGLDL 459
              IY  T A+ F  P+++++K       R  GKV  LALGYQG       M        
Sbjct: 424 HGKIYEATAAQMFGVPVERITKGNPEYSLRQKGKVATLALGYQGSTAALIAMG------- 476

Query: 460 QQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQ 519
                                            A+K  L       +   WR  ++ +  
Sbjct: 477 ---------------------------------ALKMGLTEDELPDIVTRWRNANKRICG 503

Query: 520 LWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS- 578
           LW  +      V+Q         +       +   +  + + LPS R+L Y       + 
Sbjct: 504 LWYAVENTALRVMQTAQPQGLNGLIFALEGDLIYGQSFLTVRLPSGRKLYYPKPFLQENR 563

Query: 579 ---------YLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
                     +   T +   + TYGGK+TENIVQAI+RD L   ++   + G   V  VH
Sbjct: 564 FGKQAIHYYAVGQQTRKWEIDSTYGGKMTENIVQAIARDCLAVTLRRIAQKGLQTVFHVH 623

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ + P     +V  +C LM +   WA GL LK  G+E+  Y K
Sbjct: 624 DEVIIDAPMET--TVDEICDLMAEPIPWAPGLILKGAGFESSYYMK 667


>gi|227497454|ref|ZP_03927686.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
 gi|226833079|gb|EEH65462.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
          Length = 649

 Score =  473 bits (1217), Expect = e-131,   Method: Composition-based stats.
 Identities = 204/704 (28%), Positives = 303/704 (43%), Gaps = 85/704 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L +D+ET SP  L   GV+ YAE     I L  Y+ D  P K+ D      +P  +L
Sbjct: 1   MRSLSLDLETFSPTNLATAGVYRYAEDEAFRILLFGYSIDGAPAKVIDLARGEPIPPGIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIP---------SKRWICTSVLARTNGLPSSL 109
           Q L D TV   A N+ FER+     L    P          + W CT V A + GLP SL
Sbjct: 61  QALTDPTVTKSAFNASFERVCMSAYLRRHHPDLLAEGFLGPRGWRCTMVWAASLGLPMSL 120

Query: 110 KNACLALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
             A  AL       K   G+ LI RF     D        ++    WQ +  Y +RDV+ 
Sbjct: 121 DGAAKALRLPIE--KDPAGQKLIRRFSIPGKD--GIRVLPSDDPVGWQQYISYNRRDVDV 176

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
             +L  RL   P+ + E + + LDQ IND G RID  L     E+ ++ R        +L
Sbjct: 177 EVQLASRLARNPMLEAEWETYWLDQRINDTGVRIDTQLAAHAVEVDSRHRDTCLARAQQL 236

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L+ +L    G +L  +++  +++ L          +++  R   S S
Sbjct: 237 TGLE--NPNSPIQLKDWL-AAHGCELESLTKTEVEAALETVTGD--VAEVLRLRQDLSRS 291

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K   +     SD R RG +Q+ GA RTGR++G + Q QNLPR    +    +++   
Sbjct: 292 SVKKYQAMLTVAGSDDRARGLIQYMGAGRTGRFAGRLIQVQNLPRNHMPDLASARSLLNA 351

Query: 348 NRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA 403
              +      +      S  +R+  I S   + +VAD + IEARVLAW+AGE+  ++AF 
Sbjct: 352 GNSDALELLYSPLPDTLSQLIRTAFIPSKDHRFIVADFSAIEARVLAWLAGEEGTLQAFR 411

Query: 404 NGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQ 461
            G+D+Y  T ++ F  P++K   + E R  GK+  LA GY G     K M +   + L +
Sbjct: 412 EGKDLYCQTASRMFGVPVEKHGANSELRQKGKIAVLACGYGGSVGALKAMGA-LRMGLDE 470

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
                   +  +                                            +Q W
Sbjct: 471 SELKPLVDAWRDANPMV---------------------------------------VQFW 491

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLN 581
            D+ +          ++  R    V R+ +      + I LPS R L Y   +   +   
Sbjct: 492 HDIEQAAI------TTVETRTPTQVGRIHLSYRSGCLFIALPSRRELCYPRPRLGENRFG 545

Query: 582 ----------TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
                       T +     TYGGKLTEN+VQA +RD+L   M +    G+ IV+ +HDE
Sbjct: 546 MTSILFDGVDGTTRKWGPIETYGGKLTENLVQATARDLLTHAMHHVDAAGHRIVMHIHDE 605

Query: 632 IVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           IV + P     SV  + +LMT+ P+WA GLPL A+GYE   Y K
Sbjct: 606 IVVDEPTDGA-SVEDIVTLMTRLPTWADGLPLDADGYECGFYMK 648


>gi|66395454|ref|YP_239831.1| ORF004 [Staphylococcus phage 2638A]
 gi|62635881|gb|AAX90992.1| ORF004 [Staphylococcus phage 2638A]
          Length = 653

 Score =  471 bits (1213), Expect = e-130,   Method: Composition-based stats.
 Identities = 205/707 (28%), Positives = 303/707 (42%), Gaps = 87/707 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D  PV   D T+    P    
Sbjct: 1   MKYMNIDIETYSSNDISKCGAYKYVEAEDFEILIIAYSIDGGPVSAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER+   +    ++P + W CT V     GLP+SL    
Sbjct: 61  YETFKIALFDPEVRKYAFNANFERVCLAQHFNKEMPPEEWTCTMVNVTRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             LN      K + GK LI  F   CK +  +         +  + WQ F +YC RDVE 
Sbjct: 121 EVLNL--QNQKDKAGKNLIRYFSVPCKPTKVNGGRTRNLPQHDPKKWQQFIDYCVRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W LDQ INDRG ++   L+L   EL    + +L +   K+
Sbjct: 179 EMSIATKIKDFPVTKEEQKYWSLDQHINDRGIKLSKSLMLGANELDKISKAELLKQATKI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L ++     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPSQLLKWLNEEQGLDIPNLQKKTVQEYLKYATGK--AKQMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + +  D R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCGDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELNIARDFI 353

Query: 348 NRGETIAD-------PLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G  L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLDIHPQDLLSQLVRTTFTAEEGYALAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPID--KVSKEQRAIGKVMELALGYQGGAKVFKTMAS-HCGL 457
            F     IY  + A+ F  P+D  K     R  GKV ELALGYQGG    K M +   G+
Sbjct: 414 VFNTHGKIYEASAAQMFGVPVDSIKKGDPLRQKGKVSELALGYQGGPGALKAMGALDMGI 473

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
           D  +    V                                          +WR  +  +
Sbjct: 474 DESELQGLVD-----------------------------------------SWRKANPNI 492

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC 577
           +  WK   +          ++  R+      L     K  + I LPS R L Y   +   
Sbjct: 493 VAFWKGCQDAAIE------TVRTRQTHLTHGLRFYMKKGFLMIELPSGRSLAYPKARVGE 546

Query: 578 SYLNTA---------TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTV 628
           +   +            +  + +TYGGKL ENIVQA +RD+L   M      G+ IV  V
Sbjct: 547 NSWGSPVVEFMGLDLNRKWTKLKTYGGKLVENIVQATARDLLAISMYRIEHAGFSIVGHV 606

Query: 629 HDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           HDE++ E PD     +  + ++M+K   WA+GL L ++G+ +  Y K
Sbjct: 607 HDEVIVEIPDGSGG-LKAIENIMSKPVKWAEGLKLNSDGFTSPFYMK 652


>gi|227872576|ref|ZP_03990912.1| DNA-directed DNA polymerase [Oribacterium sinus F0268]
 gi|227841577|gb|EEJ51871.1| DNA-directed DNA polymerase [Oribacterium sinus F0268]
          Length = 643

 Score =  471 bits (1212), Expect = e-130,   Method: Composition-based stats.
 Identities = 209/698 (29%), Positives = 306/698 (43%), Gaps = 79/698 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K G + YA  EQ  I L AY++D E V++ D      +P  +L
Sbjct: 1   MRHLSIDIETFSDIDIQKAGAYRYAQSEQFRIMLFAYSFDGEEVQVVDLENGEEIPHFIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L+D  V+  A+N+ FE        GI  P  +W CT V A    LP+ L N   AL  
Sbjct: 61  TALQDMEVIKHAYNAAFEWYCL-NCAGIKTPLDQWQCTMVHAMYLSLPAGLANTGEALGI 119

Query: 119 SEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL- 177
           +E   K   GK LI  FC       PY          W+ F EY ++DV +  E+  RL 
Sbjct: 120 AEDKKKSAVGKQLIRYFCV-----KPYKP----DAVKWKAFKEYNRQDVVSEMEIENRLS 170

Query: 178 -IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
             P+ + E + W  D  +N  G ++D +LV    ++  Q  ++L  + V+LT     +  
Sbjct: 171 GFPVPELEWERWRQDIAMNAYGVKVDTELVNGAIKIQEQCEEELLNEAVRLTQLE--NPN 228

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
               L  +     G  L +  + T++S L   ++    + ++  R     +++ K   ++
Sbjct: 229 SPTQLLNW-VNAQGYPLENTQKATIESALKE-DLPLKVRRVLEIRQQLGKTSVKKYEAMT 286

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---- 352
             +    R+RG  QFYGAS+TGR+SG + Q QNLPR        T+        ET    
Sbjct: 287 NTIGEGDRVRGISQFYGASKTGRFSGRLVQMQNLPRNYLEPLAETRECVKRQDYETLKLL 346

Query: 353 IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTT 412
                   S  +R+  I S G + VVAD + IEARV+AW+A E W  + FA    IY  T
Sbjct: 347 FDSIPDTLSQLIRTAFIPSTGNQFVVADFSAIEARVIAWLAKETWVQEVFATHGKIYEAT 406

Query: 413 YAKAFNTPIDKVSKEQRAIG-----KVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVK 467
            ++ F+ PI+K++K           KV  LALGYQGG     +M                
Sbjct: 407 ASQMFHVPIEKIAKGNPEYALRQKGKVATLALGYQGGTNALISMG--------------- 451

Query: 468 STSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEG 527
                                    A+K  L       +   WRA +Q ++ LW  +   
Sbjct: 452 -------------------------ALKMGLSEEELPEIVTRWRAANQRIVALWSAVGSY 486

Query: 528 FACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYL------- 580
               V++G +     +       ++   R + I LPS R+L Y       +         
Sbjct: 487 ALRTVRDGRARQVNGLIFRMEQDLKHGLRFLTIELPSKRKLFYCKPYIGLNQFGGESLYF 546

Query: 581 ---NTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
              N  T +     T+GGKL ENIVQ I+RD LCE +   T  GY IV  VHDE++ +  
Sbjct: 547 YTQNQTTKKWEESSTFGGKLVENIVQGIARDCLCETLDRITSKGYRIVFHVHDEVIVDAG 606

Query: 638 DTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                +V  LC +M +   WAKGL LK  G+  + Y+K
Sbjct: 607 MD--LTVEELCGIMAEPIPWAKGLILKGAGFSGQFYQK 642


>gi|41179402|ref|NP_958711.1| Bbp42 [Bordetella phage BPP-1]
 gi|45569535|ref|NP_996604.1| DNA polymerase [Bordetella phage BMP-1]
 gi|45580786|ref|NP_996652.1| DNA polymerase [Bordetella phage BIP-1]
 gi|40950141|gb|AAR97707.1| Bbp42 [Bordetella phage BPP-1]
          Length = 688

 Score =  469 bits (1208), Expect = e-130,   Method: Composition-based stats.
 Identities = 272/693 (39%), Positives = 361/693 (52%), Gaps = 24/693 (3%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           MS LF+D+ET    P+   G  AYAE+A + L AYA D+ PV +WD      MP DL   
Sbjct: 1   MSTLFLDLETYCEVPIQ-NGTHAYAEKAEVLLFAYALDNGPVYVWDAASGEKMPDDLRWA 59

Query: 61  LRDETVMCVAHNSLFERILFKKTL-GIDIPSKRWICTSVLARTNGLPSSLKNACLALNFS 119
           L DE V   AHNS F+R + +  +    +   RW  T V A  + LP +L + C  L   
Sbjct: 60  LIDENVALCAHNSHFDRTVLRHAMPDYPLALPRWRDTMVKALAHSLPGALGDLCDILKVP 119

Query: 120 EHLTKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL- 177
               K + GK LI  FCK     S     TR  H   W  F EY   D+EA R + ++L 
Sbjct: 120 TDKAKDKAGKQLIMLFCKPRPATSKLRRATRETHPAEWAKFVEYAGLDIEAMRVIDQKLP 179

Query: 178 -IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSR 236
                  E  LW LDQTINDRG  +D DL       + + +K L      +T G ++++ 
Sbjct: 180 AWNYQGTELALWHLDQTINDRGVMVDTDLAHAAIRAVERTQKVLAARTSDITLGAVQAAT 239

Query: 237 QTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLS 296
           Q  A+  ++    G+DL DM + TL+  ++  ++    ++L+  RL +S ++  K  TL+
Sbjct: 240 QRDAMLRHVLAAYGLDLPDMQQSTLERRIADPDLPAELRELLGIRLQASTTSTSKYKTLA 299

Query: 297 EAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---I 353
           + VSSDGRLRGTLQF GASRTGRW+G +FQPQNLPR    ++ + + I AL         
Sbjct: 300 KGVSSDGRLRGTLQFNGASRTGRWAGRLFQPQNLPRPVLKQDAIERGIAALKADCADLLF 359

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG-----EDI 408
           A+ + L S  +R CI+A  GKKLVVADL+ IE R++AW+AGEDWK+ AF         D+
Sbjct: 360 ANVMELTSSAIRGCIVAPEGKKLVVADLSNIEGRMIAWLAGEDWKLAAFREFDDGAGPDL 419

Query: 409 YVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKS 468
           Y   YAKAF    D V K+QR IGKVMEL LGY+GG   F T A+  G+DL   +     
Sbjct: 420 YKLAYAKAFAVSPDSVDKDQRQIGKVMELMLGYEGGVGAFLTGAATYGIDLDAMADAAWP 479

Query: 469 TSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGF 528
           +   +   +AE    W  +Q              C+ +K+ WR  H  V   WK+L E  
Sbjct: 480 SIPADIIAEAEQFLAWRTEQRLGDFGLKPKTFVVCDALKRLWRRAHPAVSSFWKELEEAA 539

Query: 529 ACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK----GDCSYL--NT 582
              V   G+    R     R         + I LPS R L Y   +    G  SY+  N 
Sbjct: 540 RLAVLRPGTTYDCRTLKARR-----DGAWLRIRLPSGRFLCYPSPQLDDAGKLSYMGVNQ 594

Query: 583 ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYF 642
            + +  R +TYGGKL EN+ QA SRD+L   M      GY IVL+VHDE ++E  D   F
Sbjct: 595 YSRKWSRLKTYGGKLAENVTQAASRDVLAANMPAIEAAGYQIVLSVHDENITEADDRDEF 654

Query: 643 SVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           S   L  LM  NP WA GLPL A G+EA RYRK
Sbjct: 655 SAAHLAGLMATNPPWAAGLPLAAAGFEAYRYRK 687


>gi|21910979|ref|NP_665247.1| DNA polymerase A domain-containing protein [Streptococcus pyogenes
           MGAS315]
 gi|28876473|ref|NP_795675.1| putative DNA polymerase A domain [Streptococcus pyogenes phage
           315.6]
 gi|28895334|ref|NP_801684.1| DNA polymerase [Streptococcus pyogenes SSI-1]
 gi|50913380|ref|YP_059352.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
 gi|21905187|gb|AAM80050.1| putative DNA polymerase A domain - phage-associated [Streptococcus
           pyogenes MGAS315]
 gi|28810580|dbj|BAC63517.1| putative DNA polymerase [Streptococcus pyogenes SSI-1]
 gi|50902454|gb|AAT86169.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
          Length = 640

 Score =  469 bits (1206), Expect = e-130,   Method: Composition-based stats.
 Identities = 213/697 (30%), Positives = 315/697 (45%), Gaps = 80/697 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T + ++P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLPSSL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
             ++   K   GK LI  F   CK S  +         H  + WQ+F +YC +DV     
Sbjct: 119 KLAQE--KDTSGKNLIRYFSLPCKPSKTNGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMA 176

Query: 173 LFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L   P+ D E D +  DQ INDRG  +D +LV         + + L  ++  LT  
Sbjct: 177 IAEKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTG- 235

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
            + +      L  +L    G     +++  ++  L  +      K ++  +L ++ S++ 
Sbjct: 236 -LDNPNSRTQLLPWLKEH-GYSASGLTKADVEKELKTAEG--ELKRVLELKLQTAMSSLK 291

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A  SDGR+ G LQFYGASRTGRW+G V Q QNL R    +    +        
Sbjct: 292 KYEAMERARCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDI 351

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +                VR+ ++A +G    V+D + IEARV+AW AGE W++  F+   
Sbjct: 352 DAVEILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHG 411

Query: 407 DIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
            IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M               
Sbjct: 412 KIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG-------------- 457

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   +     + +   WR  ++ ++Q WKD+  
Sbjct: 458 --------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKDVQR 491

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD-------CSY 579
                ++    +         +L  R  K  + I LPS R L Y+  K +         Y
Sbjct: 492 AAIKAIKSRAPVRL------GKLRFRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIVY 545

Query: 580 LNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD 638
                      + TYGGKL ENIVQA +RDIL E +      G+ +V  VHDE + E   
Sbjct: 546 EGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGHGVVFHVHDEAIIE--- 602

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               ++  +  LM + P WA+GLPL +EGY  K Y K
Sbjct: 603 GSGLTIEEVNDLMAQAPEWAEGLPLNSEGYITKYYMK 639


>gi|157311150|ref|YP_001469195.1| polymerase [Streptococcus phage P9]
 gi|119104299|gb|ABL61044.1| polymerase [Streptococcus phage P9]
          Length = 640

 Score =  469 bits (1206), Expect = e-130,   Method: Composition-based stats.
 Identities = 214/697 (30%), Positives = 317/697 (45%), Gaps = 80/697 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T + ++P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLPSSL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
             ++   K   GK LI  F   CK S  +         H  + WQ+F +YC +DV     
Sbjct: 119 KLAQE--KDTSGKNLIRYFSLPCKPSKTNGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMA 176

Query: 173 LFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L   P+ D E D +  DQ INDRG  +D +LV         + + L  ++  +T  
Sbjct: 177 IAEKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKAITG- 235

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
            + +      L  +L    G     +++  ++  L  +      K ++  +L ++ S++ 
Sbjct: 236 -LANPNSRAQLLPWLKEH-GYSANGLTKADVEQELKTAEG--ELKRVLELKLQTAMSSLK 291

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R    +    +        
Sbjct: 292 KYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDI 351

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +                VR+ ++A +G    V+D + IEARV+AW AGE W++  F+   
Sbjct: 352 DAVEILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHG 411

Query: 407 DIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
            IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M               
Sbjct: 412 KIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG-------------- 457

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   +     + +   WR  ++ ++Q WKD+  
Sbjct: 458 --------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKDVQR 491

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD-------CSY 579
                ++    I       + +L  R  K  + I LPS R L Y+  K +         Y
Sbjct: 492 AAIKAIKSRAPI------KLGKLRFRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIIY 545

Query: 580 LNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD 638
                      + TYGGKL ENIVQA +RDIL E +      GY +V  VHDE + E   
Sbjct: 546 EGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYGVVFHVHDEAIIE--- 602

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               ++  +  LM + P WA+GLPL +EGY  K Y K
Sbjct: 603 GSGLTIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|238018841|ref|ZP_04599267.1| hypothetical protein VEIDISOL_00701 [Veillonella dispar ATCC 17748]
 gi|237864607|gb|EEP65897.1| hypothetical protein VEIDISOL_00701 [Veillonella dispar ATCC 17748]
          Length = 644

 Score =  468 bits (1204), Expect = e-129,   Method: Composition-based stats.
 Identities = 214/696 (30%), Positives = 318/696 (45%), Gaps = 77/696 (11%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60
           +L ID+ET S  P+ K G   Y +     I L AY++DDEPV++ D T +  +P  ++  
Sbjct: 2   ELSIDVETYSDCPI-KYGAQRYVDDTTFEILLFAYSFDDEPVEVIDMT-KDPLPERVVDA 59

Query: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
           L ++ +   A N+ FE +  KK    D     W CTSVLA    LP+SL N   AL   E
Sbjct: 60  LYNKEITKTAFNAAFEMLCLKKYFP-DADYTNWECTSVLALYCSLPASLDNVSKALRLGE 118

Query: 121 HLTKMEEGKALIARFC---KGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL 177
              K   GK LI  F    K +  +P       +  + W  + EY ++DV   R + KRL
Sbjct: 119 --AKDARGKRLIQFFSVPRKPTKTNPKTRNMPEDAPEKWAEYIEYNRQDVVVERAIRKRL 176

Query: 178 I--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSS 235
           +       E + WLLDQ IN RG ++D++LV        +  ++  E         + + 
Sbjct: 177 LSLKPPAIEHEYWLLDQDINWRGVKVDMELVDAALACNDEIVEEATES--SKILTGLENP 234

Query: 236 RQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTL 295
             T  L+ +L    G DL  M +  + ++L+  +I    + ++ NR     S+I K   +
Sbjct: 235 NSTMQLKEWLTARLGYDLETMRKDDVSNLLAQ-DIPSDVRKVLQNRQVLGNSSIKKYLAM 293

Query: 296 SEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET--- 352
             AV SDGR+ G LQFYGA R+GRW+G V Q QNLPR    +    + +      E    
Sbjct: 294 KNAVCSDGRIHGMLQFYGAMRSGRWAGRVVQLQNLPRNYLEDLDTARDVLKSRDVEMLDL 353

Query: 353 -IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVT 411
              +P  +    +R+ ++A +G + +VAD + IEARV+AW+A E W+   FA G DIY  
Sbjct: 354 LYGNPGDVIKQLIRTALVAEDGHRFIVADFSAIEARVIAWLAHEKWRQDVFAQGGDIYCA 413

Query: 412 TYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKST 469
           + +  F+ P++K   +   R  GKV ELALGY GG    K M S                
Sbjct: 414 SASSMFHVPVEKHGVNGHLRQKGKVAELALGYGGGVGAMKAMDSKG-------------- 459

Query: 470 STFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFA 529
                                      ++       + +AWR     + + WKD      
Sbjct: 460 ---------------------------EIPEKELPGIIEAWRQASPRITKFWKDADSAAK 492

Query: 530 CVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK----------GDCSY 579
            VV+ G  +   +      +   + K  + I LPS RRL Y+  +           +   
Sbjct: 493 QVVRTGEPVRIIQG----NIKFFKSKGFLFIELPSGRRLAYARPRLGLNQFGSESIEYDG 548

Query: 580 LNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDT 639
           ++   +   R  TYGGKL ENIVQA++RD L   M   +K GY IV  +HDE+V E P  
Sbjct: 549 MDQVKNTWGRVETYGGKLVENIVQAVARDCLAASMLRLSKAGYKIVAHIHDEVVIEAPIG 608

Query: 640 PYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
              S+  +  +M +   W +GL L A G+E   Y K
Sbjct: 609 -VGSLEEVIDIMCEPEPWNEGLILNAAGFENPYYMK 643


>gi|258455585|ref|ZP_05703542.1| DNA-directed DNA polymerase [Staphylococcus aureus A5937]
 gi|257862273|gb|EEV85044.1| DNA-directed DNA polymerase [Staphylococcus aureus A5937]
          Length = 653

 Score =  468 bits (1203), Expect = e-129,   Method: Composition-based stats.
 Identities = 203/706 (28%), Positives = 309/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K GV+ Y  AE   I + AY+ D  P+   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|94989082|ref|YP_597183.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS9429]
 gi|94542590|gb|ABF32639.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS9429]
          Length = 640

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 213/697 (30%), Positives = 317/697 (45%), Gaps = 80/697 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T + ++P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLP+SL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPAQWQCTMVLAQELGLPASLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRE 172
             ++   K   GK LI  F   CK +  +         +    WQ+F  YC +DV     
Sbjct: 119 KLAQE--KDAAGKNLIKYFSVPCKPTKANGGRTRNLPEHDPGKWQMFINYCMQDVVVEMA 176

Query: 173 LFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L   P+ D E D ++ DQ INDRG  +D +LV         + + L  ++  LT  
Sbjct: 177 IAEKLESVPVHDREWDYYVCDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTG- 235

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
            + +      L  +L    G     +++  ++  L  +      K ++  +L ++ S++ 
Sbjct: 236 -LDNPNSRAQLLPWLKEH-GYSANGLTKADVEQELKKAEG--ELKRVLELKLQTAMSSLK 291

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R    +    +        
Sbjct: 292 KYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDI 351

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +                VR+ ++A +G    V+D + IEARV+AW AGE W++  F+   
Sbjct: 352 DAVEILYDSLNDTLKQLVRTALVAKDGYTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHG 411

Query: 407 DIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
            IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M               
Sbjct: 412 KIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG-------------- 457

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   +     + V   WR  ++ ++Q WKD+  
Sbjct: 458 --------------------------ALNMGVKEEELQGVVDDWRRANKKIVQFWKDVQR 491

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD-------CSY 579
                ++    I       + ++  R  K  + I LPS R L Y+  K +         Y
Sbjct: 492 AAIKAIKSRAPI------KLGKIRFRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIIY 545

Query: 580 LNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD 638
                      + TYGGKL ENIVQA +RDIL E +      GYD+V  VHDE + E   
Sbjct: 546 EGQGDRAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYDVVFHVHDEAIIE--- 602

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                +  +  LM++ P WA+GLPL +EGY  K Y K
Sbjct: 603 GSGLIIEEVNDLMSQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|283469578|emb|CAQ48789.1| DNA polymerase [Staphylococcus aureus subsp. aureus ST398]
 gi|283470753|emb|CAQ49964.1| DNA polymerase [Staphylococcus aureus subsp. aureus ST398]
          Length = 653

 Score =  467 bits (1201), Expect = e-129,   Method: Composition-based stats.
 Identities = 203/706 (28%), Positives = 308/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D  P+   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMAIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  S     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKESTGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|282919245|ref|ZP_06326980.1| DNA polymerase bacteriophage-type [Staphylococcus aureus subsp.
           aureus C427]
 gi|282317055|gb|EFB47429.1| DNA polymerase bacteriophage-type [Staphylococcus aureus subsp.
           aureus C427]
          Length = 653

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 203/706 (28%), Positives = 309/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K GV+ Y  AE   I + AY+ D  P+   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKVATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|71911263|ref|YP_282813.1| phage-encoded DNA polymerase [Streptococcus pyogenes MGAS5005]
 gi|94992973|ref|YP_601072.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS2096]
 gi|71854045|gb|AAZ52068.1| phage-encoded DNA polymerase [Streptococcus pyogenes MGAS5005]
 gi|94546481|gb|ABF36528.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS2096]
          Length = 640

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 212/697 (30%), Positives = 316/697 (45%), Gaps = 80/697 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T + ++P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLP+SL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPAQWQCTMVLAQELGLPASLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRE 172
             ++   K   GK LI  F   CK +  +         +    WQ+F  YC +DV     
Sbjct: 119 KLAQE--KDAAGKNLIKYFSVPCKPTKANGGRTRNLPEHDPGKWQMFINYCMQDVVVEMA 176

Query: 173 LFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L   P+ D E D ++ DQ INDRG  +D +LV         + + L  ++  LT  
Sbjct: 177 IAEKLESVPVHDREWDYYVCDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTG- 235

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
            + +      L  +L    G     +++  ++  L  +      K ++  +L ++ S++ 
Sbjct: 236 -LDNPNSRAQLLPWLKEH-GYSANGLTKADVEQELKKAEG--ELKRVLELKLQTAMSSLK 291

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R    +    +        
Sbjct: 292 KYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDI 351

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +                VR+ ++A +G    V+D + IEARV+AW AGE W++  F+   
Sbjct: 352 DAVEILYDSLNDTLKQLVRTALVAKDGYTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHG 411

Query: 407 DIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
            IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M               
Sbjct: 412 KIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG-------------- 457

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   +     + +   WR  ++ ++Q WKD+  
Sbjct: 458 --------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKDVQR 491

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD-------CSY 579
                ++    I       + ++  R  K  + I LPS R L Y+  K +         Y
Sbjct: 492 AAIKAIKSRAPI------KLGKIRFRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIIY 545

Query: 580 LNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD 638
                      + TYGGKL ENIVQA +RDIL E +      GYD+V  VHDE + E   
Sbjct: 546 EGQGDRAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYDVVFHVHDEAIIE--- 602

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
                +  +  LM + P WA+GLPL +EGY  K Y K
Sbjct: 603 GSGLIIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|139473888|ref|YP_001128604.1| putative phage DNA polymerase [Streptococcus pyogenes str.
           Manfredo]
 gi|209559298|ref|YP_002285770.1| DNA polymerase [Streptococcus phage NZ131.2]
 gi|134272135|emb|CAM30380.1| putative phage DNA polymerase [Streptococcus pyogenes str.
           Manfredo]
 gi|209540499|gb|ACI61075.1| DNA polymerase [Streptococcus phage NZ131.2]
          Length = 640

 Score =  466 bits (1198), Expect = e-129,   Method: Composition-based stats.
 Identities = 214/697 (30%), Positives = 317/697 (45%), Gaps = 80/697 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T + ++P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLPSSL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
             ++   K   GK LI  F   CK S  +         H  + WQ+F +YC +DV     
Sbjct: 119 KLAQE--KDTSGKNLIRYFSLPCKPSKANGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMA 176

Query: 173 LFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L   P+ D E D +  DQ INDRG  +D +LV         + + L  ++  LT  
Sbjct: 177 IAEKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTG- 235

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
            + +      L  +L    G  +  +++  ++  L  +      K ++  +L ++ S++ 
Sbjct: 236 -LDNPNSRAQLLPWLKEH-GYSVNGLTKADVEQELKTAEG--ELKRVLELKLQTAMSSLK 291

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R    +    +        
Sbjct: 292 KYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDI 351

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +                VR+ ++A +     V+D + IEARV+AW AGE W++  F+   
Sbjct: 352 DAVEILYDSLNDTLKQLVRTALVAKDCCTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHG 411

Query: 407 DIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
            IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M               
Sbjct: 412 KIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG-------------- 457

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   +     + +   WR  ++ ++Q WKD+  
Sbjct: 458 --------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKDVQR 491

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD-------CSY 579
                ++    I       + +L  R  K  + I LPS R L Y+  K +         Y
Sbjct: 492 AAIKAIKSRAPI------KLGKLRFRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIVY 545

Query: 580 LNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD 638
                      + TYGGKL ENIVQA +RDIL E +      GY +V  VHDE + E   
Sbjct: 546 EGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYGVVFHVHDEAIIE--- 602

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               ++  +  LM + P WA+GLPL +EGY  K Y K
Sbjct: 603 GSGLTIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|262049890|ref|ZP_06022752.1| putative DNA polymerase [Staphylococcus aureus D30]
 gi|259162039|gb|EEW46619.1| putative DNA polymerase [Staphylococcus aureus D30]
          Length = 653

 Score =  466 bits (1198), Expect = e-129,   Method: Composition-based stats.
 Identities = 203/706 (28%), Positives = 309/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K GV+ Y  AE   I + AY+ D  P+   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKADNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKVATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVIEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|225871341|ref|YP_002747288.1| phage DNA polymerase [Streptococcus equi subsp. equi 4047]
 gi|225700745|emb|CAW95387.1| putative phage DNA polymerase [Streptococcus equi subsp. equi 4047]
          Length = 640

 Score =  466 bits (1198), Expect = e-129,   Method: Composition-based stats.
 Identities = 214/697 (30%), Positives = 315/697 (45%), Gaps = 80/697 (11%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET S   + K GV+ YA  E   I L AY+ D   V+  D T + ++P D+ 
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLT-RQSLPEDIK 58

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID--IPSKRWICTSVLARTNGLPSSLKNACLAL 116
             L D+ V   A N+ FER+   + LG+   +   +W CT VLA+  GLPSSL+   L L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
                  K   GK LI  F   CK S  +         H  + WQ+F +YC +DV     
Sbjct: 119 KL--VQEKDTSGKNLIRYFSLPCKPSKANGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMA 176

Query: 173 LFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDG 230
           + ++L   P+ D E D +  DQ INDRG  +D +LV         + + L  ++  LT  
Sbjct: 177 IAEKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTG- 235

Query: 231 IIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAIL 290
            + +      L  +L    G  +  +++  ++  L  +      K ++  +L ++ S++ 
Sbjct: 236 -LDNPNSRAQLLPWLKEH-GYSVNGLTKADVEQELKTAEG--ELKRVLELKLQTAMSSLK 291

Query: 291 KLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRG 350
           K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R    +    +        
Sbjct: 292 KYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDAREYVKKRDI 351

Query: 351 ET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGE 406
           +                VR+ ++A +     V+D + IEARV+AW AGE W++  F+   
Sbjct: 352 DAVEILYDSLNDTLKQLVRTALVAKDCCTFYVSDFSAIEARVIAWFAGEQWRLDVFSTHG 411

Query: 407 DIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
            IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M               
Sbjct: 412 KIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG-------------- 457

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   +     + +   WR  ++ ++Q WKD+  
Sbjct: 458 --------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWKDVQR 491

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD-------CSY 579
                ++    I       + +L  R  K  + I LPS R L Y+  K +         Y
Sbjct: 492 AAIKAIKSRAPI------KLGKLRFRYRKGFLFITLPSGRNLAYARAKVEPGDYGDKIVY 545

Query: 580 LNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPD 638
                      + TYGGKL ENIVQA +RDIL E +      GY +V  VHDE + E   
Sbjct: 546 EGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYGVVFHVHDEAIIE--- 602

Query: 639 TPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
               ++  +  LM + P WA+GLPL +EGY  K Y K
Sbjct: 603 GSGLTIEEVNDLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|66395659|ref|YP_240050.1| ORF003 [Staphylococcus phage 47]
 gi|282911107|ref|ZP_06318909.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|297207805|ref|ZP_06924239.1| bacteriophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|62636083|gb|AAX91194.1| ORF003 [Staphylococcus phage 47]
 gi|282324802|gb|EFB55112.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|296887521|gb|EFH26420.1| bacteriophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|312438063|gb|ADQ77134.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH60]
 gi|329724432|gb|EGG60942.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 653

 Score =  465 bits (1197), Expect = e-129,   Method: Composition-based stats.
 Identities = 201/706 (28%), Positives = 306/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMAIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +      G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|282926447|ref|ZP_06334079.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A10102]
 gi|282591776|gb|EFB96847.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A10102]
          Length = 653

 Score =  464 bits (1193), Expect = e-128,   Method: Composition-based stats.
 Identities = 200/706 (28%), Positives = 306/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WA+GL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVEWAEGLNLNSDGFTSPFYMK 652


>gi|148267473|ref|YP_001246416.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150393526|ref|YP_001316201.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH1]
 gi|147740542|gb|ABQ48840.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149945978|gb|ABR51914.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH1]
          Length = 653

 Score =  464 bits (1193), Expect = e-128,   Method: Composition-based stats.
 Identities = 201/706 (28%), Positives = 306/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|258448861|ref|ZP_05696971.1| DNA polymerase [Staphylococcus aureus A6224]
 gi|257857898|gb|EEV80789.1| DNA polymerase [Staphylococcus aureus A6224]
          Length = 653

 Score =  463 bits (1192), Expect = e-128,   Method: Composition-based stats.
 Identities = 200/706 (28%), Positives = 306/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT + +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMINSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|329730633|gb|EGG67018.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 653

 Score =  463 bits (1192), Expect = e-128,   Method: Composition-based stats.
 Identities = 201/706 (28%), Positives = 307/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIAHKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|21283154|ref|NP_646242.1| DNA polymerase [Staphylococcus aureus subsp. aureus MW2]
 gi|300911890|ref|ZP_07129333.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|21204594|dbj|BAB95290.1| DNA polymerase [Staphylococcus aureus subsp. aureus MW2]
 gi|300886136|gb|EFK81338.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|315197712|gb|EFU28046.1| DNA polymerase [Staphylococcus aureus subsp. aureus CGS01]
          Length = 653

 Score =  463 bits (1191), Expect = e-128,   Method: Composition-based stats.
 Identities = 200/706 (28%), Positives = 306/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   +     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGVRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|257428253|ref|ZP_05604651.1| DNA polymerase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|258419942|ref|ZP_05682901.1| DNA polymerase [Staphylococcus aureus A9719]
 gi|282905878|ref|ZP_06313733.1| DNA polymerase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282928293|ref|ZP_06335897.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9765]
 gi|257275094|gb|EEV06581.1| DNA polymerase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257844067|gb|EEV68457.1| DNA polymerase [Staphylococcus aureus A9719]
 gi|282331170|gb|EFB60684.1| DNA polymerase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282591964|gb|EFB96997.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9765]
          Length = 653

 Score =  463 bits (1191), Expect = e-128,   Method: Composition-based stats.
 Identities = 201/706 (28%), Positives = 306/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|284024530|ref|ZP_06378928.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           132]
          Length = 653

 Score =  463 bits (1190), Expect = e-128,   Method: Composition-based stats.
 Identities = 202/706 (28%), Positives = 308/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K GV+ Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDTEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKYFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKVATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|262053228|ref|ZP_06025380.1| putative DNA polymerase [Staphylococcus aureus 930918-3]
 gi|259158878|gb|EEW43970.1| putative DNA polymerase [Staphylococcus aureus 930918-3]
          Length = 653

 Score =  463 bits (1190), Expect = e-128,   Method: Composition-based stats.
 Identities = 201/706 (28%), Positives = 306/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYIKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|215401125|ref|YP_002332380.1| putative DNA polymerase [Staphylococcus phage phiSauS-IPLA35]
 gi|215260476|gb|ACJ64606.1| gp17 [Staphylococcus phage phiSauS-IPLA35]
          Length = 650

 Score =  462 bits (1189), Expect = e-128,   Method: Composition-based stats.
 Identities = 200/701 (28%), Positives = 305/701 (43%), Gaps = 85/701 (12%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP-----SDLL 58
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P         
Sbjct: 3   IDIETYSNNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPDVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE    + 
Sbjct: 123 --QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +T    
Sbjct: 181 NKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITGLE- 239

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +++ K 
Sbjct: 240 -NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEATGK--AKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +     
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKDQRF 355

Query: 353 IA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                     P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F   
Sbjct: 356 DDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTH 415

Query: 406 EDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
             IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M            
Sbjct: 416 GKIYEASASQMFNVPVESITKGDSLRQKGKVSELALGYQGGAGALKAMG----------- 464

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                        A++  +     + +  +WR  +  ++  WK 
Sbjct: 465 -----------------------------ALEMGIEENELQGLVDSWRNANPNIVNFWKA 495

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT- 582
             E          ++ +R+  +   L     K  + I LPS R L Y       +   + 
Sbjct: 496 CQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGENSWGSQ 549

Query: 583 --------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                      +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIV 609

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 610 EIPKDSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|49485814|ref|YP_043035.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|49244257|emb|CAG42684.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MSSA476]
          Length = 653

 Score =  462 bits (1188), Expect = e-127,   Method: Composition-based stats.
 Identities = 200/706 (28%), Positives = 307/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIANKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKAEQGLDIPNLQKKTVQDYLKRATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + +D R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCNDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPKDSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|156603970|ref|YP_001429916.1| hypothetical protein SPTP3102_gp21 [Staphylococcus phage tp310-2]
 gi|154818056|gb|ABS87483.1| hypothetical protein [Staphylococcus phage tp310-2]
          Length = 650

 Score =  461 bits (1187), Expect = e-127,   Method: Composition-based stats.
 Identities = 201/701 (28%), Positives = 304/701 (43%), Gaps = 85/701 (12%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP-----SDLL 58
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P         
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE    + 
Sbjct: 123 --QSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMAIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +T    
Sbjct: 181 NKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITGLE- 239

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +++ K 
Sbjct: 240 -NPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +     
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRF 355

Query: 353 IA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                     P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F   
Sbjct: 356 DDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTH 415

Query: 406 EDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
             IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M            
Sbjct: 416 GKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG----------- 464

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                      E  +++       + +  +WR  +  ++  WK 
Sbjct: 465 -------------------------ALEMGIEEN----ELQGLVDSWRNANPNIVNFWKA 495

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT- 582
             E          ++ +R+  +   L     K  + I LPS R L Y       +   + 
Sbjct: 496 CQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGENSWGSQ 549

Query: 583 --------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                      +  + +TYGGKL ENIVQA +RD+L   +      GY IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGYKIVGHVHDEVIV 609

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 610 EIPRGSNG-LKEIETIMNKPVEWAKGLNLNSDGFTSPFYMK 649


>gi|297590990|ref|ZP_06949628.1| prophage LambdaSa04 DNA-directed DNA polymerase [Staphylococcus
           aureus subsp. aureus MN8]
 gi|297575876|gb|EFH94592.1| prophage LambdaSa04 DNA-directed DNA polymerase [Staphylococcus
           aureus subsp. aureus MN8]
          Length = 653

 Score =  461 bits (1187), Expect = e-127,   Method: Composition-based stats.
 Identities = 201/706 (28%), Positives = 307/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE+  I + AY+ D   +   D T+    P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEEFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLNNDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|257432437|ref|ZP_05608800.1| DNA polymerase [Staphylococcus aureus subsp. aureus E1410]
 gi|257283316|gb|EEV13448.1| DNA polymerase [Staphylococcus aureus subsp. aureus E1410]
          Length = 653

 Score =  461 bits (1187), Expect = e-127,   Method: Composition-based stats.
 Identities = 201/706 (28%), Positives = 306/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKNDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|66395591|ref|YP_239981.1| ORF003 [Staphylococcus phage 3A]
 gi|62635937|gb|AAX91048.1| ORF003 [Staphylococcus phage 3A]
          Length = 650

 Score =  461 bits (1186), Expect = e-127,   Method: Composition-based stats.
 Identities = 202/701 (28%), Positives = 306/701 (43%), Gaps = 85/701 (12%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP-----SDLL 58
           IDIET S   + K GV+ Y  AE   I + AY+ D  P+   D T+    P         
Sbjct: 3   IDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHADYETFK 62

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE    + 
Sbjct: 123 --QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +T    
Sbjct: 181 NKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITGLE- 239

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +++ K 
Sbjct: 240 -NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKVATGK--AKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +     
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRF 355

Query: 353 IA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                     P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F   
Sbjct: 356 DDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTH 415

Query: 406 EDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
             IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M            
Sbjct: 416 GKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG----------- 464

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                      E  +++       + +  +WR  +  ++  WK 
Sbjct: 465 -------------------------ALEMGIEEN----ELQGLVDSWRNANPNIVNFWKA 495

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT- 582
             E          ++ +R+  +   L     K  + I LPS R L Y       +   + 
Sbjct: 496 CQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGENSWGSQ 549

Query: 583 --------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                      +  + +TYGGKL ENIVQA +RD+L   +      G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVHDEVIV 609

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 610 EIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|315128370|gb|EFT84381.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           CGS03]
          Length = 653

 Score =  461 bits (1186), Expect = e-127,   Method: Composition-based stats.
 Identities = 200/706 (28%), Positives = 307/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDDEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   +  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTSEEGNELAVSDFSAIEARVIAWYAKERWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|49483719|ref|YP_040943.1| DNA polymerase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49241848|emb|CAG40540.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA252]
          Length = 653

 Score =  461 bits (1185), Expect = e-127,   Method: Composition-based stats.
 Identities = 201/706 (28%), Positives = 307/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE+  I + AY+ D   +   D T+    P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEEFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKNDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|29028629|ref|NP_803318.1| DNA polymerase A domain [Staphylococcus phage phi 12]
 gi|88195276|ref|YP_500079.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|258428683|ref|ZP_05688217.1| phage encoded DNA polymerase I [Staphylococcus aureus A9299]
 gi|18920553|gb|AAL82293.1| DNA polymerase A domain [Staphylococcus phage phi 12]
 gi|87202834|gb|ABD30644.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|257849738|gb|EEV73702.1| phage encoded DNA polymerase I [Staphylococcus aureus A9299]
          Length = 650

 Score =  460 bits (1184), Expect = e-127,   Method: Composition-based stats.
 Identities = 200/701 (28%), Positives = 304/701 (43%), Gaps = 85/701 (12%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP-----SDLL 58
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P         
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE    + 
Sbjct: 123 --QSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMAIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +T    
Sbjct: 181 NKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITGLE- 239

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +++ K 
Sbjct: 240 -NPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +     
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRF 355

Query: 353 IA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                     P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F   
Sbjct: 356 DDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTH 415

Query: 406 EDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
             IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M            
Sbjct: 416 GKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG----------- 464

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                      E  +++       + +  +WR  +  ++  WK 
Sbjct: 465 -------------------------ALEMGIEEN----ELQGLVDSWRNANPNIVNFWKA 495

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT- 582
             E          ++ +R+  +   L     K  + I LPS R L Y       +   + 
Sbjct: 496 CQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGENSWGSQ 549

Query: 583 --------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                      +  + +TYGGKL ENIVQA +RD+L   +      G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVHDEVIV 609

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 610 EIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|258445211|ref|ZP_05693406.1| DNA-directed DNA polymerase [Staphylococcus aureus A6300]
 gi|257855972|gb|EEV78892.1| DNA-directed DNA polymerase [Staphylococcus aureus A6300]
          Length = 653

 Score =  459 bits (1182), Expect = e-127,   Method: Composition-based stats.
 Identities = 199/706 (28%), Positives = 307/706 (43%), Gaps = 85/706 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMTIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   +  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTSEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +R++L   +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARELLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE++ E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|87161801|ref|YP_494120.1| phage related DNA polymerase family A [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|161509702|ref|YP_001575361.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|294848501|ref|ZP_06789247.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9754]
 gi|87127775|gb|ABD22289.1| phage related DNA polymerase, family A [Staphylococcus aureus
           subsp. aureus USA300_FPR3757]
 gi|160368511|gb|ABX29482.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|294824527|gb|EFG40950.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9754]
 gi|302333141|gb|ADL23334.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus JKD6159]
 gi|320140648|gb|EFW32502.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320142780|gb|EFW34583.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA177]
          Length = 650

 Score =  459 bits (1181), Expect = e-127,   Method: Composition-based stats.
 Identities = 199/701 (28%), Positives = 304/701 (43%), Gaps = 85/701 (12%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP-----SDLL 58
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P         
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE    + 
Sbjct: 123 --QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +T    
Sbjct: 181 HKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITGLE- 239

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +++ K 
Sbjct: 240 -NPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +     
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRF 355

Query: 353 IA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                     P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F   
Sbjct: 356 DDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTH 415

Query: 406 EDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
             IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M            
Sbjct: 416 GKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG----------- 464

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                      E  +++       + +  +WR  +  ++  WK 
Sbjct: 465 -------------------------ALEMGIEEN----ELQGLVDSWRNANPNIVNFWKA 495

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT- 582
             E          ++ +R+  +   +     K  + I LPS R L Y       +   + 
Sbjct: 496 CQEAAIN------TVKSRKTHHTHGVRFYMKKGFLMIELPSGRALAYPKASVGENSWGSQ 549

Query: 583 --------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                      +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIV 609

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 610 EIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|295407651|ref|ZP_06817440.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8819]
 gi|297246752|ref|ZP_06930567.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8796]
 gi|294967465|gb|EFG43505.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8819]
 gi|297176378|gb|EFH35651.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8796]
          Length = 650

 Score =  459 bits (1181), Expect = e-127,   Method: Composition-based stats.
 Identities = 200/701 (28%), Positives = 304/701 (43%), Gaps = 85/701 (12%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP-----SDLL 58
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P         
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE    + 
Sbjct: 123 --QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +T    
Sbjct: 181 HKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITGLE- 239

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +++ K 
Sbjct: 240 -NPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +     
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRF 355

Query: 353 IA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                     P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F   
Sbjct: 356 DDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTH 415

Query: 406 EDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
             IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M            
Sbjct: 416 GKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG----------- 464

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                      E  +++       + +  +WR  +  ++  WK 
Sbjct: 465 -------------------------ALEMGIEEN----ELQGLVDSWRNANPNIVNFWKA 495

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT- 582
             E          ++ +R+  +   L     K  + I LPS R L Y       +   + 
Sbjct: 496 CQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGENSWGSQ 549

Query: 583 --------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                      +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIV 609

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 610 EIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|268610175|ref|ZP_06143902.1| family A DNA-dependent DNA polymerase [Ruminococcus flavefaciens
           FD-1]
          Length = 654

 Score =  459 bits (1180), Expect = e-127,   Method: Composition-based stats.
 Identities = 207/710 (29%), Positives = 319/710 (44%), Gaps = 92/710 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M +L IDIET S + + + GV+ YAE     + L +Y+ D  PV   D      +P ++L
Sbjct: 1   MKQLTIDIETASDEDISECGVYRYAESEYFDLLLVSYSIDGGPVATVDIDSGDTLPDEIL 60

Query: 59  QYLRDETVMCVAHNSLFERILFKKTL--------------GIDIPSKRWICTSVLARTNG 104
             L D++V+  A N  FER+     L              G  I  + W C  + +R  G
Sbjct: 61  SALTDKSVIKKAFNVNFERVCLSVYLRRNYPEIAGFEDAVGNYIAPESWHCDMIHSRYLG 120

Query: 105 LPSSLKNACLALNFSEHLTKMEEGKALIARFCK--GSIDSPPYDCTRANHVQAWQLFGEY 162
           + SSL +            K++EGK LI  FC              +++  + W+ F EY
Sbjct: 121 MMSSLDDMGKL--LRLKEKKLDEGKDLIKYFCTLHQDKQGNLLFYDKSDAPKKWKEFIEY 178

Query: 163 CKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKL 220
            +RDVE   ++ + L  +P+ D   + + +DQ INDRG  +D     K  EL +  +K+L
Sbjct: 179 NRRDVEVELKIQRLLSEMPVPDFIWEEFYIDQRINDRGILVDTKFAEKAVELDSNVKKEL 238

Query: 221 DEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILN 280
              + +LT   + +      ++ +L    GI+   + + ++  +L+ +      K++++ 
Sbjct: 239 FPKLKELTR--LDNPNSPAQMKDWLM-RQGIEADSLDKKSMPLLLASAPDD--VKEVLML 293

Query: 281 RLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEIL 340
               S S++ K +T+  A   DGR RG   FYGA+RTGR++G + Q QNLP+        
Sbjct: 294 YQQLSKSSVSKYHTMLGASCKDGRARGMFNFYGANRTGRFAGRIIQLQNLPQNHLDNLAE 353

Query: 341 TQTIQALNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
           T+ +      +       D   + S  +R+  I   GKK VVAD + IEARV++W+AGE 
Sbjct: 354 TKWLIKSGDLDAVKERFEDIPDVLSQLIRTAFIPPEGKKFVVADFSAIEARVISWLAGET 413

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDKV--SKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           W+++AFANGEDIY    AK F  P++K   +   R  GK+ ELA GY G     K M   
Sbjct: 414 WRMEAFANGEDIYCACAAKMFGVPVEKNGVNGHLRQKGKIAELACGYGGSIGAIKAMG-- 471

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
                                                   +  L       + + WR   
Sbjct: 472 --------------------------------------GTELNLTDDELYSLVEDWRKTS 493

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
             +++LW D+      V+ +  S++  R      L        + I LPS RRL Y   K
Sbjct: 494 PNIVKLWSDVQSVAVKVITDQSSMTFGR------LKFSYEIGILFIELPSGRRLAYVRPK 547

Query: 575 GD--------CSYLN-TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIV 625
            +         +Y       + +R  TYG KL ENI Q I+RD+L   M         IV
Sbjct: 548 VEKDDNGKTIITYEGVGDNKKWLRLETYGAKLVENITQGIARDLLLHSMAAMKDMD--IV 605

Query: 626 LTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
             VHDE++ E       +V  +C LM + P WA+GL L+A+GYE + Y K
Sbjct: 606 GHVHDEVIVECDPDT--TVVQVCHLMEQTPDWAEGLLLRADGYECEFYMK 653


>gi|312897720|ref|ZP_07757136.1| DNA-directed DNA polymerase [Megasphaera micronuciformis F0359]
 gi|310621104|gb|EFQ04648.1| DNA-directed DNA polymerase [Megasphaera micronuciformis F0359]
          Length = 654

 Score =  459 bits (1180), Expect = e-127,   Method: Composition-based stats.
 Identities = 198/699 (28%), Positives = 301/699 (43%), Gaps = 70/699 (10%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  L IDIET SP  +   GV+ Y+E     I L +YA+    V + D      +P D++
Sbjct: 1   MRHLNIDIETYSPNDIS-FGVYKYSESEEFEILLFSYAYAFGEVHVVDLASGETIPDDVV 59

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L+ + V+  A+N+ FE     +  G     ++W CT +     G P  L     AL  
Sbjct: 60  LDLKRDEVIKHAYNAQFEITCLNRA-GYQTFVEQWRCTMIHGAYLGYPMGLAKLGKALGL 118

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCTRA-NHVQAWQLFGEYCKRDVEATRELF 174
           ++   K + G ALI  F   CK +  +         +    W  +  Y K+DV    E +
Sbjct: 119 TQDKMKDKAGAALIRYFSVPCKPTKKNGGRTRNLPKHDPDKWAAYIAYNKQDVVTEMECY 178

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           +RL   P+ +     W +D  +N  G  ID  LV     +  + +K L E+  +LT   +
Sbjct: 179 RRLSAFPVPEEVEKQWQVDIRMNATGVGIDRQLVDGALTIDEENKKALLEEAYELTG--L 236

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L   T ++L  +++ ++ + ++ ++   LAK ++  R   + S++ K 
Sbjct: 237 SNPNSRNQLLDWLNSNTNLELEKLTKDSVAAAMTDADD--LAKKVLTIRKKLAKSSVSKY 294

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA----LN 348
             ++ A   DGRLRGTLQFYGA+RTGRW+G + Q QNLPR   +     +++      + 
Sbjct: 295 EMMASATGQDGRLRGTLQFYGANRTGRWAGRLLQVQNLPRNYITNLDTARSLVKASNRVG 354

Query: 349 RGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
            G    D     S  +R+ IIA  G  L VAD + IEARV+AW++GE W+ K FA G DI
Sbjct: 355 LGLLFGDVSDTLSQLIRTAIIAKEGYTLCVADFSAIEARVIAWLSGETWRQKVFAEGGDI 414

Query: 409 YVTTYAKAFNTP--IDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNV 466
           Y  + +  F  P     V+   R  GKV ELALGYQGG    K M               
Sbjct: 415 YCASASSMFGVPVVKHGVNGHLRQKGKVAELALGYQGGVNALKAMG-------------- 460

Query: 467 KSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTE 526
                                     A+   L       +   WR     +++ W  + +
Sbjct: 461 --------------------------ALDMGLTEEELPNIVGLWRQASPNIVKFWYTVEK 494

Query: 527 GFACVVQEGGSISARRVANVPRLVMRRHK-RDVHIVLPSSRRLVYSDVKGDCSYLN---- 581
                V  G  ++          V   +  R + I LPS R+L Y D     +  +    
Sbjct: 495 AAVYTVTTGNPMTLDHGITFRLEVDPFYGYRYMTIELPSGRKLFYPDPHIKLNNFDKEAV 554

Query: 582 ----TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETP 637
                  +  + E TYGGKL ENI QA++RD L   +   + NG   ++ +HDE V E P
Sbjct: 555 HFKTQLNNAWVTESTYGGKLVENITQAVARDCLALTLMRLSGNGLPAIMHIHDEAVIEVP 614

Query: 638 DTPYFSVGTLCS-LMTKNPSWAKGLPLKAEGYEAKRYRK 675
                    +          WA+GL L A G+    Y K
Sbjct: 615 KDEADEYLDIVEKTFALPIPWAEGLALTAAGFTNDYYMK 653


>gi|323440323|gb|EGA98037.1| phage related DNA polymerase family A [Staphylococcus aureus O11]
          Length = 650

 Score =  458 bits (1178), Expect = e-126,   Method: Composition-based stats.
 Identities = 199/701 (28%), Positives = 304/701 (43%), Gaps = 85/701 (12%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP-----SDLL 58
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P         
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPVHADYETFK 62

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK +  +         +  + WQ F +YC RDVE    + 
Sbjct: 123 --QSQKDKAGKNLIRYFSMPCKPTKVNGGRTRNLPEHDPEKWQQFIDYCIRDVEVEMTIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P+++ E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +T    
Sbjct: 181 NKIKDFPVTEIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHITGLE- 239

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +++ K 
Sbjct: 240 -NPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYLKEATGK--AKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +     
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRF 355

Query: 353 IA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                     P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F   
Sbjct: 356 DDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTH 415

Query: 406 EDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
             IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M            
Sbjct: 416 GKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG----------- 464

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                      E  +++       + +  +WR  +  ++  WK 
Sbjct: 465 -------------------------ALEMGIEEN----ELQGLVDSWRNANPNIVNFWKA 495

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT- 582
             E          ++ +R+  +   L     K  + I LPS R L Y       +   + 
Sbjct: 496 CQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGENSWGSQ 549

Query: 583 --------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                      +  + +TYGGKL ENIVQA +RD+L   +     + + IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASVFKIVGHVHDEVIV 609

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 610 EIPRGSNG-LKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|209363571|ref|YP_002267989.1| DNA polymerase [Staphylococcus phage phi2958PVL]
 gi|208973072|dbj|BAG74388.1| DNA polymerase [Staphylococcus phage phi2958PVL]
          Length = 650

 Score =  458 bits (1177), Expect = e-126,   Method: Composition-based stats.
 Identities = 200/701 (28%), Positives = 304/701 (43%), Gaps = 85/701 (12%)

Query: 6   IDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP-----SDLL 58
           IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P         
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNF 118
             L D  V   A N+ FER    K     +P + WICT V +   GLP+SL      L  
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEATRELF 174
                K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE    + 
Sbjct: 123 --QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIA 180

Query: 175 KRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
            ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L      +T    
Sbjct: 181 HKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHITGLE- 239

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +++ K 
Sbjct: 240 -NPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKTSVKKY 296

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
           N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +     
Sbjct: 297 NKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRF 355

Query: 353 IA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANG 405
                     P  L S  VR+   A  G +L V+D + IEARV+AW A E W++  F   
Sbjct: 356 DDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTH 415

Query: 406 EDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
             IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M            
Sbjct: 416 GKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG----------- 464

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                      E  +++       + +  +WR  +  ++  WK 
Sbjct: 465 -------------------------ALEMGIEEN----ELQGLVDSWRNANPNIVNFWKA 495

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT- 582
             E          ++ +R+  +   L     K  + I LPS R L Y       +   + 
Sbjct: 496 CQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKASVGENSWGSQ 549

Query: 583 --------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                      +  + +TYGGKL ENIVQA +RD+L   +     +G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIV 609

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E P      +  + ++M K   WAKGL L ++G+ +  Y K
Sbjct: 610 EIPRGSNG-LKEIETIMNKPADWAKGLNLNSDGFTSPFYMK 649


>gi|282533171|gb|ADA82280.1| putative DNA polymerase [Escherichia phage K1G]
          Length = 726

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 249/729 (34%), Positives = 345/729 (47%), Gaps = 57/729 (7%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           MS LF+D ET S   L KVG +AYAE     + +C YA+DDEPV++WD T  S MP DL 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEPVQVWDCTNGSDMPGDLH 60

Query: 59  QYLR-----DETVMCVAHN-SLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           + LR     +  +  V HN S+F+R++ K   G DIP    I T + A  + LP SL   
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATR 171
           C  L  S    K + GKALI RF K +  +      T   H   W LF +Y   D+ A R
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRRYTAETHPDEWALFIKYAVSDITAMR 180

Query: 172 ELFKRLIPL--SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           E+F +L     S+ E  +  LDQ INDRG+++D+ L     E + + + +L E+  +   
Sbjct: 181 EVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRKYG 240

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAI 289
           G +        LR          + +  + TL  +L+  ++   A+ +I  RL ++ +A 
Sbjct: 241 GSLTGKDFLPILRELAPAHR---IHNAQKSTLNDLLADDDLPDDARTIIEMRLGAASTAS 297

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNR 349
            K N L    SSD R RG +Q+ GA RT R++G  FQPQNL R    ++ L + I AL +
Sbjct: 298 TKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISALLK 357

Query: 350 GETI--ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGED 407
           G      D   L +  VRSCII   G K VVAD + +E R LAW+AGE+  +  F  G D
Sbjct: 358 GRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAGLD 417

Query: 408 IYVTTYAKAFNTPIDKVSKE---QRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           IY  T  K F    D + KE    R IGK  EL LGY GG   F   A + GLDL   ++
Sbjct: 418 IYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDMAK 477

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDK------------LIGTACELVKKAWRA 512
            +  T     W      + W + Q  +   +               +   C+ +K+ WR 
Sbjct: 478 TMDGTFPDYIWAATARGYEWARIQEAKRPPRPGENDDRPSYILDKKVWRTCDAIKRMWRE 537

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVP--------RLVMRRHKRDVHIVLPS 564
            H   +  W+D+ +     ++  G         V             +     + + LPS
Sbjct: 538 SHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMTLPS 597

Query: 565 SRRLVYS------------------DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAIS 606
            R + Y                   +V+      N  T Q   + TY GKL EN  QA+ 
Sbjct: 598 GRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQALC 657

Query: 607 RDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAE 666
           RD+L   + N   NGY IVL VHDEI+ ETPD P ++V  L  LM + P WA+G PL AE
Sbjct: 658 RDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPLVAE 717

Query: 667 GYEAKRYRK 675
           G E KRY K
Sbjct: 718 GAEMKRYAK 726


>gi|282534222|gb|ADA82330.1| putative DNA polymerase [Escherichia phage K1H]
          Length = 726

 Score =  457 bits (1175), Expect = e-126,   Method: Composition-based stats.
 Identities = 249/729 (34%), Positives = 345/729 (47%), Gaps = 57/729 (7%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           MS LF+D ET S   L KVG +AYAE     + +C YA+DDEPV++WD T  S MP DL 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEPVQVWDCTNGSDMPGDLH 60

Query: 59  QYLR-----DETVMCVAHN-SLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           + LR     +  +  V HN S+F+R++ K   G DIP    I T + A  + LP SL   
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATR 171
           C  L  S    K + GKALI RF K +  +      T   H   W LF +Y   D+ A R
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRRYTAETHPDEWALFIKYAVSDITAMR 180

Query: 172 ELFKRLIPL--SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           E+F +L     S+ E  +  LDQ INDRG+++D+ L     E + + + +L E+  +   
Sbjct: 181 EVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRKYG 240

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAI 289
           G +        LR          + +  + TL  +L+  ++   A+ +I  RL ++ +A 
Sbjct: 241 GSLTGKDFLPILRELAPAHR---IHNAQKSTLNDLLADDDLPDDARTIIEMRLGAASTAS 297

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNR 349
            K N L    SSD R RG +Q+ GA RT R++G  FQPQNL R    ++ L + I AL +
Sbjct: 298 TKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISALLK 357

Query: 350 GETI--ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGED 407
           G      D   L +  VRSCII   G K VVAD + +E R LAW+AGE+  +  F  G D
Sbjct: 358 GRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAGLD 417

Query: 408 IYVTTYAKAFNTPIDKVSKE---QRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           IY  T  K F    D + KE    R IGK  EL LGY GG   F   A + GLDL   ++
Sbjct: 418 IYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDMTK 477

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDK------------LIGTACELVKKAWRA 512
            +  T     W      + W + Q  +   +               +   C+ +K+ WR 
Sbjct: 478 TMDGTFPDHIWAATARGYEWARIQEAKRPPRPGENDDRPSYILDKKVWRTCDAIKRMWRE 537

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVP--------RLVMRRHKRDVHIVLPS 564
            H   +  W+D+ +     ++  G         V             +     + + LPS
Sbjct: 538 SHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMTLPS 597

Query: 565 SRRLVYS------------------DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAIS 606
            R + Y                   +V+      N  T Q   + TY GKL EN  QA+ 
Sbjct: 598 GRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQALC 657

Query: 607 RDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAE 666
           RD+L   + N   NGY IVL VHDEI+ ETPD P ++V  L  LM + P WA+G PL AE
Sbjct: 658 RDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPLVAE 717

Query: 667 GYEAKRYRK 675
           G E KRY K
Sbjct: 718 GAEMKRYAK 726


>gi|15837285|ref|NP_297973.1| phage-related DNA polymerase [Xylella fastidiosa 9a5c]
 gi|9105565|gb|AAF83493.1|AE003912_5 phage-related DNA polymerase [Xylella fastidiosa 9a5c]
          Length = 726

 Score =  456 bits (1174), Expect = e-126,   Method: Composition-based stats.
 Identities = 262/725 (36%), Positives = 354/725 (48%), Gaps = 61/725 (8%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L+ D+ET SP P+   GV AYAE A + L AYA  + PV++WD T  + +P DL   L 
Sbjct: 10  ILWGDLETYSPVPMAH-GVHAYAEHAELLLFAYALGEGPVQVWDCTATATLPDDLSAALH 68

Query: 63  DETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
           D  V+   HNS F+R +  +  GIDIP +RW  +   A  + LP +L   C  L      
Sbjct: 69  DPAVLLYFHNSHFDRTVL-RHCGIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEH 127

Query: 123 TKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K ++GK L+A FCK           TR  H   W  F EY +RDV A R++ KRL    
Sbjct: 128 AKDKDGKRLVALFCKPRPAHCTLRRATRDTHPTDWAQFVEYAQRDVAAMRDVVKRLPSHN 187

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
            +  E  LW LDQTINDRG  ID DLV      + + ++ L +    LT G ++++ Q  
Sbjct: 188 YAGAELALWFLDQTINDRGVLIDTDLVQAAIRAVERAKQTLAQRTEALTGGAVQAATQRD 247

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  +L    G+ L DM + T+   +    + +  ++L+  R  +S ++  K   L    
Sbjct: 248 ALLQHLNTAHGVALPDMQQHTVARCVDDPALPETVRELLSIRRQASSTSTAKYQALLHCT 307

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE---TIADP 356
           S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+E++   I A+  G       D 
Sbjct: 308 SPDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEVIAVGIDAMKAGCVDLVFDDV 367

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-------- 408
           + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF   +          
Sbjct: 368 MALTSSALRSCLIAPKNKKLVVADLSNIEGRVLAWLAGETPKLHAFREFDTCQGVDGTWH 427

Query: 409 --------------------------------YVTTYAKAFNTPIDKVSKEQRAIGKVME 436
                                           Y   YA +F      VSKEQR IGKV E
Sbjct: 428 TGAAITHGALRGAPIALQRNADHAPIRRGDDIYKRAYAHSFGIAPQAVSKEQRQIGKVQE 487

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           LALGY GG   F   A+   +DL+  +                    W +  +       
Sbjct: 488 LALGYGGGVGAFAAFAAMYHIDLEAMAAQAALPPLLLQQAT--ELLEWTKANHRPTFDLS 545

Query: 497 KLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKR 556
                AC++ K+AWR  H  +   W+ L       +    +           + ++  + 
Sbjct: 546 DRAWLACDVFKRAWRNAHPAIAAFWQALQFAVTDAIHHPETAHT-----CCGITVQYRRA 600

Query: 557 DVHIVLPSSRRLVYSDVK----GDCSYLNTA--TSQLMRERTYGGKLTENIVQAISRDIL 610
            + + LPS R L Y+  +    G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L
Sbjct: 601 WLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRLTTYGGKLVENITQAVSRDVL 660

Query: 611 CEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEA 670
              M      GY IVLTVHDEI++E  D P F+   L +LM   P WA+GLPL AEG++ 
Sbjct: 661 AACMPAIEAAGYSIVLTVHDEIITEADDHPCFNAAHLAALMATPPPWAEGLPLAAEGFDT 720

Query: 671 KRYRK 675
            RYRK
Sbjct: 721 YRYRK 725


>gi|15839115|ref|NP_299803.1| phage-related DNA polymerase [Xylella fastidiosa 9a5c]
 gi|9107731|gb|AAF85323.1|AE004059_13 phage-related DNA polymerase [Xylella fastidiosa 9a5c]
          Length = 726

 Score =  454 bits (1169), Expect = e-125,   Method: Composition-based stats.
 Identities = 262/725 (36%), Positives = 357/725 (49%), Gaps = 61/725 (8%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L+ D+ET SP P+   GV AYAE A + L AYA  + PV++WD T  + +P DL   L 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEHAELLLFAYALGEGPVQVWDCTATATLPDDLSAALH 68

Query: 63  DETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
           D  V+   HNS F+R +  +  GIDIP +RW  +   A  + LP +L   C  L      
Sbjct: 69  DPGVLLYFHNSHFDRTVL-RHCGIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEH 127

Query: 123 TKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K ++GK L+A FCK           TR  H   W  F EY +RDV A R++ KRL    
Sbjct: 128 AKDKDGKRLVALFCKPRPAHCTLRRATRDTHPTDWAQFVEYAQRDVAAMRDVVKRLPSHN 187

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
            +  E  LW LDQTINDRG  ID DLV      + + ++ L +    LT G ++++ Q  
Sbjct: 188 YAGAELALWFLDQTINDRGVLIDTDLVQAAIRAVERAKQTLAQRTEALTGGAVQAATQRD 247

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  +L    G+ L DM + T+   +    + +  ++L+  R  +S ++  K   L    
Sbjct: 248 ALLQHLNTAHGVALPDMQQHTVARCVDDPALPETVRELLSIRRQASSTSTAKYQALLHCT 307

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGE---TIADP 356
           S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+E++   I A+          D 
Sbjct: 308 SPDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEVIAVGIDAMKADCVDLVFDDV 367

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-------- 408
           + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF   +          
Sbjct: 368 MALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFREFDTCQGVDGCWH 427

Query: 409 --------------------------------YVTTYAKAFNTPIDKVSKEQRAIGKVME 436
                                           Y   YA +F      VSKEQR IGKV E
Sbjct: 428 TGAAITHGALRAAPLALQRNADHAPIRRGDDIYKRAYAHSFGIAPQAVSKEQRQIGKVQE 487

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           LALGY GG   F   A+   +DL+  +    +       ++A     W +  +       
Sbjct: 488 LALGYGGGVGAFAAFAALYHIDLEAMAAQ--AVFPPLLLQEATELLEWTKANHRPTFDLS 545

Query: 497 KLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKR 556
                AC++ K+AWR  H  +   W+ L       +    +           + ++  + 
Sbjct: 546 DRAWLACDVFKRAWRNAHPAIAAFWQALQFAVTDAIHHPETTHT-----CCGITVQYRRA 600

Query: 557 DVHIVLPSSRRLVYSDVK----GDCSYLNTA--TSQLMRERTYGGKLTENIVQAISRDIL 610
            + + LPS R L Y+  +    G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L
Sbjct: 601 WLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRLTTYGGKLVENITQAVSRDVL 660

Query: 611 CEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEA 670
              M      GY IVLTVHDEI++E  D P F+   L +LM   P WA+GLPL AEG++ 
Sbjct: 661 AACMPAIEAAGYSIVLTVHDEIITEADDHPCFNAAHLAALMATPPPWAEGLPLAAEGFDT 720

Query: 671 KRYRK 675
            RYRK
Sbjct: 721 YRYRK 725


>gi|282535272|gb|ADA82478.1| putative DNA polymerase [Escherichia phage K1ind3]
 gi|282547373|gb|ADA82429.1| putative DNA polymerase [Escherichia phage K1ind2]
          Length = 726

 Score =  454 bits (1169), Expect = e-125,   Method: Composition-based stats.
 Identities = 248/729 (34%), Positives = 345/729 (47%), Gaps = 57/729 (7%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           MS LF+D ET S   L KVG +AYAE     + +C YA+DDE V++WD T+ S MP DL 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEHVQVWDCTDGSDMPGDLH 60

Query: 59  QYLR-----DETVMCVAHN-SLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNA 112
           + LR     +  +  V HN S+F+R++ K   G DIP    I T + A  + LP SL   
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 CLALNFSEHLTKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATR 171
           C  L  S    K + GKALI RF K +  +      T   H   W LF +Y   D+ A R
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRRYTAETHPDEWALFIKYAVSDITAMR 180

Query: 172 ELFKRLIPL--SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           E+F +L     S+ E  +  LDQ INDRG+++D+ L     E + + + +L E+  +   
Sbjct: 181 EVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRKYG 240

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAI 289
           G +        LR          + +  + TL  +L+  ++   A+ +I  RL ++ +A 
Sbjct: 241 GSLTGKDFLPILRELAPAHR---IHNAQKSTLNDLLADDDLPDDARTIIEMRLGAASTAS 297

Query: 290 LKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNR 349
            K N L    SSD R RG +Q+ GA RT R++G  FQPQNL R    ++ L + I AL +
Sbjct: 298 TKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISALLK 357

Query: 350 GETI--ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGED 407
           G      D   L +  VRSCII   G K VVAD + +E R LAW+AGE+  +  F  G D
Sbjct: 358 GRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAGLD 417

Query: 408 IYVTTYAKAFNTPIDKVSKE---QRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQ 464
           IY  T  K F    D + KE    R IGK  EL LGY GG   F   A + GLDL   ++
Sbjct: 418 IYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDMAK 477

Query: 465 NVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDK------------LIGTACELVKKAWRA 512
            +  T     W      + W + Q  +   +               +   C+ +K+ WR 
Sbjct: 478 TMDGTFPDHIWAATARGYEWARIQEAKRPPRPGEKDDRPSYILDKKVWRTCDAIKRMWRE 537

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVP--------RLVMRRHKRDVHIVLPS 564
            H   +  W+D+ +     ++  G         V             +     + + LPS
Sbjct: 538 SHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMTLPS 597

Query: 565 SRRLVYS------------------DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAIS 606
            R + Y                   +V+      N  T Q   + TY GKL EN  QA+ 
Sbjct: 598 GRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQALC 657

Query: 607 RDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAE 666
           RD+L   + N   NGY IVL VHDEI+ ETPD P ++V  L  LM + P WA+G PL AE
Sbjct: 658 RDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPLVAE 717

Query: 667 GYEAKRYRK 675
           G E KRY K
Sbjct: 718 GAEMKRYAK 726


>gi|332160957|ref|YP_004297534.1| putative DNA polymerase from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325665187|gb|ADZ41831.1| Putative DNA polymerase from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 669

 Score =  454 bits (1167), Expect = e-125,   Method: Composition-based stats.
 Identities = 248/672 (36%), Positives = 353/672 (52%), Gaps = 35/672 (5%)

Query: 33  CAYAWDDEPVKLWDRTEQSAMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPS-- 90
             YA +D+PV  WD T  + MP DL  YL+D ++   A NS F+R + +  +   I    
Sbjct: 3   ITYALNDDPVSEWDITSGAKMPEDLKAYLQDPSIEIYAQNSHFDRTMMRHDMPSVIAGGI 62

Query: 91  KRWICTSVLARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDS-PPYDCTR 149
           +RW  T V A  +GLP  L   C  L  ++   K +EGKALI  FCK    +   +  T 
Sbjct: 63  ERWRDTMVKALAHGLPGGLGVLCEILGITQDKAKDKEGKALIQLFCKPRAKNSTIHRATS 122

Query: 150 ANHVQAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVL 207
             H + W+ F +Y   D+EA R + K+L        E  LW  DQ INDRG ++D  L  
Sbjct: 123 KTHPEEWKRFLKYAGNDIEAMRAIDKKLPVWNYQGKELALWHFDQLINDRGVQMDTVLAE 182

Query: 208 KLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSH 267
                +  E+K L +    LTD  ++++ Q  AL  ++    G+DL DM + TL+  ++ 
Sbjct: 183 AAVTAVVDEQKLLAKRTQNLTDNEVQAATQRDALLRHIVESFGVDLPDMQKSTLERRIAD 242

Query: 268 SNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQP 327
             +  + ++L+  RL +S ++  K  TL + VS DGRLRGTLQF GASRTGRW+G +FQP
Sbjct: 243 PELPSVLRELLAIRLQASTTSTSKYKTLLKGVSKDGRLRGTLQFCGASRTGRWAGRLFQP 302

Query: 328 QNLPRQERSEEILTQTIQALNRGET---IADPLGLASDCVRSCIIASNGKKLVVADLAGI 384
           QNLPR    +E +   I+AL  G       + + L S  +R CI+A  GKKLVV+DL+ I
Sbjct: 303 QNLPRPVLDQETIDTGIEALKAGCADLLFDNVMELISSALRGCIVAPKGKKLVVSDLSNI 362

Query: 385 EARVLAWIAGEDWKIKAFANG----------------EDIYVTTYAKAFNTPIDKVSKEQ 428
           E RVLAW+AGE+WK++AF +                  D+Y   YA+AFN   D V+K Q
Sbjct: 363 EGRVLAWLAGEEWKLEAFRDYDTIIGYDEGGEALREGPDLYKLAYARAFNISPDDVTKLQ 422

Query: 429 RAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQ 488
           R IGKVMEL LG+ GG   F T A   GLDL + +             +A+S +     Q
Sbjct: 423 RQIGKVMELGLGFGGGVAAFLTFALVYGLDLDELANAALPNVPTSIQREAQSWYQASVKQ 482

Query: 489 YPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPR 548
              F + +++   AC+ +K+ WR  H   +  W ++       +               +
Sbjct: 483 KRTFGLSEQVFI-ACDSLKRMWRNAHPETVSFWSEIENTVRRAIINPKQT-----FVCRK 536

Query: 549 LVMRRHKRDVHIVLPSSRRLVYSDVKGD---CSYL--NTATSQLMRERTYGGKLTENIVQ 603
           L +RR    + I LPS R + Y  ++ +    SY+  NT + +  R +TYGGKL EN  Q
Sbjct: 537 LKIRRDGSWLRIQLPSGRSVCYPGIRIEGDKISYMGVNTYSRKWQRLKTYGGKLAENATQ 596

Query: 604 AISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPL 663
           A +RD++   M      GY+I LTVHDE+++E PDT  F+   L  L+  NP WA  LPL
Sbjct: 597 AAARDVMANNMPLIEARGYEITLTVHDEVLTEAPDTDAFTSDKLSELLATNPEWALDLPL 656

Query: 664 KAEGYEAKRYRK 675
            A G+EA  YRK
Sbjct: 657 SAGGFEAYHYRK 668


>gi|318064432|gb|ADV36447.1| DNA polymerase I [Edwardsiella phage eiAU]
 gi|318064540|gb|ADV36499.1| DNA polymerase I [Edwardsiella phage eiDWF]
 gi|318064644|gb|ADV36551.1| DNA polymerase I [Edwardsiella phage eiMSLS]
          Length = 735

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 254/734 (34%), Positives = 346/734 (47%), Gaps = 65/734 (8%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWD--RTEQSA------- 52
           LF+D ET S   L KVG +AYAE     I L +YA+DD P K+WD       +       
Sbjct: 5   LFLDFETFSEADLKKVGAYAYAEHDSTEILLASYAFDDGPAKVWDATCASGESDIDLDNN 64

Query: 53  -MPSDLLQYLRDET---VMCVAHN-SLFERILFKKTLGIDIPSKRWICTSVLARTNGLPS 107
             P DLL+ LR      V  V HN  +F+R++ ++ LG+DIP +    T V A  + LP 
Sbjct: 65  SAPDDLLRGLRRAKRGRVKLVMHNGLMFDRLIIRECLGLDIPPEHIHDTMVQAFRHALPG 124

Query: 108 SLKNACLALNFSEHLTKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRD 166
           SL   C  LN    L K + GKALI RFCK +  +       R  H   W+ F  Y + D
Sbjct: 125 SLDKLCEVLNVDADLAKDKAGKALIKRFCKPTPKNYKIRRYDRNTHPDEWKQFKHYARND 184

Query: 167 VEATRELFKRLIPL--SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDI 224
           + A RE++ ++      D E ++  LDQ INDRG+ +D DL       +A  R +L E  
Sbjct: 185 ITAMREIYYKMPSWGEIDKENEILALDQRINDRGFYVDTDLAKAATAAVAAARAELQEAA 244

Query: 225 VKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLAS 284
                G +  +     LR          + +  + TL  +L  +++   A+ +I  RL +
Sbjct: 245 QATYGGGLTGADFLPLLRDLAPAHH---IPNAQKSTLGDLLDDADLPDEARQVIEMRLGA 301

Query: 285 SGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTI 344
           + +A  K   L   +S+DGR RG LQ+ GA RT RW+G  FQPQNL R    E+ L + I
Sbjct: 302 ASTASTKYAPLLNGMSADGRRRGCLQYGGAKRTLRWAGKGFQPQNLARGYFKEKPLARGI 361

Query: 345 QALNRG--ETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
           +AL RG  E   D + LA+  VR CII + GKKLVVAD + +E R LAW+AGED  +  F
Sbjct: 362 EALKRGTAEYAFDVMKLAASTVRGCIIPAPGKKLVVADYSNVEGRGLAWLAGEDSALDTF 421

Query: 403 ANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
             G DIY  T  K F    D V   +R IGK  EL LGY GG   F T + + GLDL++ 
Sbjct: 422 RAGLDIYKVTAGKMFGISPDDVDGYRRQIGKACELGLGYGGGVAAFLTFSKNLGLDLEEM 481

Query: 463 S---QNVKSTSTFEDWEQAESHHLWM---------QDQYPEFAVKDKLIGTACELVKKAW 510
           +           +    +A                +       V  K     C+ +K+ W
Sbjct: 482 AVTMAGTFPDYHWRAALRAYEFMKLQEVKRKPLPGKKDDRTTVVLSKKAWLTCDCIKRMW 541

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGS-----------ISARRVANVPRLVMRRHKRDVH 559
           R  H   +Q W DL E     +   G+                          +    + 
Sbjct: 542 RESHPRTVQFWYDLEEACLMAIDNPGASYWAGAKVRQDGKRAIRIERTLTRSGKPGNWLK 601

Query: 560 IVLPSSRRLVYS------------------DVKGDCSYLNTATSQLMRERTYGGKLTENI 601
           I LPS R L Y                     +      N  T Q   + TYGGKL EN+
Sbjct: 602 IELPSGRILSYPGIGVSMEKTNEDDPGEKARPRIKYRGENQLTRQWGWQHTYGGKLAENV 661

Query: 602 VQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGL 661
            QA+ RDIL   M      GY+I+L+VHDE+++ETPDT  ++V  L  LM   P+WAKG 
Sbjct: 662 TQALCRDILAWCMLPVDNAGYEIILSVHDELITETPDTAEYNVAELERLMCDLPAWAKGF 721

Query: 662 PLKAEGYEAKRYRK 675
           PLKAEG+E  RY+K
Sbjct: 722 PLKAEGWEGYRYKK 735


>gi|255994008|ref|ZP_05427143.1| prophage LambdaSa04, DNA polymerase [Eubacterium saphenum ATCC
           49989]
 gi|255993676|gb|EEU03765.1| prophage LambdaSa04, DNA polymerase [Eubacterium saphenum ATCC
           49989]
          Length = 666

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 209/704 (29%), Positives = 310/704 (44%), Gaps = 74/704 (10%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAE--QAVITLCAYAWDDEPVKLWDRTEQSAMPSD---- 56
           KL+IDIET S   +   G++ YAE     + L AYA DD  V+L D T+   +       
Sbjct: 5   KLYIDIETFSSVDIRTAGLYKYAESGDFEVLLLAYAIDDGDVELIDLTDGGEITQQKLVG 64

Query: 57  LLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLAL 116
           + + L  +  +  AHN+ FE    K+ L I I   RW CT V     G P+SL+    AL
Sbjct: 65  VRRLLESQNYIKCAHNAHFEMECLKRALHIIIRPSRWECTMVKGMYRGYPASLEKMGEAL 124

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANHV-QAWQLFGEYCKRDVEATRE 172
           +  E   K+  GKALI  F   CK +  +         H  + W+LF EYCKRDVE  RE
Sbjct: 125 DMPEDKAKLRTGKALINYFCKPCKPTKTNGGRTRNLPKHASEKWELFREYCKRDVEVARE 184

Query: 173 LFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGII 232
           + K L  +  G    W+ D  +N RG  +D  LV     +  + +    + I ++T    
Sbjct: 185 IDKMLPDVPQGVHTEWMRDYLVNWRGIAVDEALVEAAIAIDGEVKSAHLDTIKRITGVD- 243

Query: 233 RSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKL 292
            + R    +  +L      ++  ++  ++K++L  S++T  A+ ++        ++  K 
Sbjct: 244 -NPRSRAQVLDWLNDTLDEEITSLNAASVKALLE-SDLTDDARAVLTAWQGLGKTSTKKY 301

Query: 293 NTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET 352
            TL  A   D R+RG LQFYGASRTGRW+G + QP NLPR +         +      + 
Sbjct: 302 ETLRAAAQKDNRVRGLLQFYGASRTGRWAGRLVQPHNLPRGDVYNLNQAGELVKAGHKKD 361

Query: 353 I----ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI 408
           I           S  +R+C +   G K V+ D + IEARVLAW+AGE W ++ F     I
Sbjct: 362 IELLHGSVPNTLSGLIRTCFVPREGCKFVICDYSAIEARVLAWLAGEHWVLEEFKGDGKI 421

Query: 409 YVTTYAKAFNTPID-----KVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
           Y  T A+ +N           +   R  GK+  LALGYQG     + M +          
Sbjct: 422 YEATAARMYNIDKSTIIKGHSNYAYRQKGKIATLALGYQGAVGALRQMGAS--------- 472

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                          +D+        + +AWR  +  + +LW+ 
Sbjct: 473 -------------------------------EDEFTDDELRGLVRAWRVANPCIAELWRY 501

Query: 524 LTEGFACVVQEGGSISARR--VANVPRLVMRRHKRDVHIVLPSSRRLVYSDV---KGDCS 578
                   V +            +    +   +  ++ I LPS R L Y +     G   
Sbjct: 502 TEMMAKSTVSDEFYSGTNPMIPISFKSTLNAVNGINLAIGLPSGRELYYHNPVIVDGAIY 561

Query: 579 YLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN------GYDIVLTVHDEI 632
           Y +   +   +E+TYGGKL ENIVQAI+RD+L + +   TK          IVL VHDE+
Sbjct: 562 YTDYTHAGKTKEQTYGGKLVENIVQAIARDVLADAINRITKTLVVGGINAHIVLHVHDEV 621

Query: 633 VSETPDTPYFSVGTLCS-LMTKNPSWAKGLPLKAEGYEAKRYRK 675
           V E        V  L   + +  PSWA+GLPLK E + +  Y+K
Sbjct: 622 VVEAEAGCAEKVQELLEGVFSTPPSWAEGLPLKGESFISDYYKK 665


>gi|71276267|ref|ZP_00652545.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71900322|ref|ZP_00682457.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71162875|gb|EAO12599.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71729897|gb|EAO31993.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 262/725 (36%), Positives = 358/725 (49%), Gaps = 61/725 (8%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L+ D+ET SP P+   GV AYAEQA + L AYA  + PV++WD T  + MP +L   L 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAELLLFAYAIGNGPVQVWDCTATATMPEELSAALH 68

Query: 63  DETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
           +  V+   HNS F+R +  +  GIDIP +RW  +   A  + LP +L   C  L      
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQ 127

Query: 123 TKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K ++GK L+A FCK           TR  H   W  F EY +RDV A R++ KRL    
Sbjct: 128 AKAKDGKRLVALFCKPRPAHCTLRRATRDTHPTEWAQFVEYARRDVAAMRDVVKRLPSHN 187

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
            +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ Q  
Sbjct: 188 YTGAELALWFLDQTINDRGVMVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRD 247

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L    
Sbjct: 248 ALLHHLSTEHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALLNCT 307

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+ ++   I A+  G       D 
Sbjct: 308 SGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVFDDV 367

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-------- 408
           + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF + +          
Sbjct: 368 MALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFRDFDTCQGVDGTWH 427

Query: 409 --------------------------------YVTTYAKAFNTPIDKVSKEQRAIGKVME 436
                                           Y   YA +F      V+KEQR IGKV E
Sbjct: 428 SGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQRQIGKVQE 487

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           LALGY GG   F   A+   +DL+  ++            +A     W +          
Sbjct: 488 LALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQ--EAVEALQWTKANQRPTFGLS 545

Query: 497 KLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKR 556
                AC++ K+AWR  H  +   WK L       ++   +           + M+  + 
Sbjct: 546 DRAWLACDVFKRAWRNAHPAIAAFWKALQFAATDAIRHPETAHT-----CCGITMQYSRA 600

Query: 557 DVHIVLPSSRRLVYSDVK----GDCSYLNTA--TSQLMRERTYGGKLTENIVQAISRDIL 610
            + + LPS R L Y+  +    G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L
Sbjct: 601 WLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMTRKWTRITTYGGKLVENITQAVSRDVL 660

Query: 611 CEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEA 670
              M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AEG++ 
Sbjct: 661 AACMPAIEAAGYQIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQT 720

Query: 671 KRYRK 675
            RYRK
Sbjct: 721 HRYRK 725


>gi|273810426|ref|YP_003344897.1| DNA polymerase A [Xylella phage Xfas53]
 gi|257097801|gb|ACV41107.1| DNA polymerase A [Xylella phage Xfas53]
          Length = 726

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 261/725 (36%), Positives = 355/725 (48%), Gaps = 61/725 (8%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L+ D+ET SP P+   GV AYAEQA + L AYA    PV++WD T  + MP +L   L 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGGGPVQVWDCTATATMPEELSAALH 68

Query: 63  DETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
           +  V+   HNS F+R +  +  GI IP +RW  +   A  + LP +L   C  L      
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGISIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQ 127

Query: 123 TKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K ++GK L+A FCK           TR  H   W  F EY +RDV A R++ KRL    
Sbjct: 128 AKAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVEYARRDVTAMRDVVKRLPSHN 187

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
            +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ Q  
Sbjct: 188 YTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRD 247

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L    
Sbjct: 248 ALLHHLSTAHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALLNCT 307

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+E +T  I A+  G       D 
Sbjct: 308 SRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVFDDV 367

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-------- 408
           + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF   +          
Sbjct: 368 MALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGEFDTCQGVDGTWH 427

Query: 409 --------------------------------YVTTYAKAFNTPIDKVSKEQRAIGKVME 436
                                           Y   YA +F      V+K+QR IGKV E
Sbjct: 428 SGEAITHGALRGAPIALQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQE 487

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           LALGY GG   F   A+   +DL+  +             +A     W +  +       
Sbjct: 488 LALGYGGGVGAFAAFAAMYHIDLEAMAAQAALPPLLLQ--EATELLEWTKANHRPTFGLS 545

Query: 497 KLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKR 556
                AC++ K+AWR  H  +   W+ L       +    +           + ++  + 
Sbjct: 546 DRAWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAIGHPETAHT-----CCGITVQYSRA 600

Query: 557 DVHIVLPSSRRLVYSDVK----GDCSYLNTA--TSQLMRERTYGGKLTENIVQAISRDIL 610
            + + LPS R L Y+  +    G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L
Sbjct: 601 WLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSRDVL 660

Query: 611 CEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEA 670
              M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AEG+E 
Sbjct: 661 AACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFET 720

Query: 671 KRYRK 675
            RYRK
Sbjct: 721 HRYRK 725


>gi|170730324|ref|YP_001775757.1| phage-related DNA polymerase [Xylella fastidiosa M12]
 gi|167965117|gb|ACA12127.1| phage-related DNA polymerase [Xylella fastidiosa M12]
          Length = 726

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 259/725 (35%), Positives = 354/725 (48%), Gaps = 61/725 (8%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L+ D+ET SP P+   GV AYAEQA + L AYA  + PV++WD T  + MP +L   L 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAELLLFAYAIGNGPVQVWDCTATATMPEELSAALH 68

Query: 63  DETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
           +  V+   HNS F+R +  +  GIDIP +RW  +   A  + LP +L   C  L      
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQ 127

Query: 123 TKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K ++GK L+A FCK           TR  H   W  F EY +RDV A R++ KRL    
Sbjct: 128 AKAKDGKRLVALFCKPRPTHCTLRRATRDTHPTDWAQFVEYARRDVAAMRDVVKRLPSHN 187

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
            S  E  LW LDQTINDRG  +D DL       + + +  L      LT G ++++ Q  
Sbjct: 188 YSGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKCTLAHRTEALTGGAVQAATQRD 247

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L    
Sbjct: 248 ALLHHLSTEHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALLNCT 307

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+ ++   I A+  G       D 
Sbjct: 308 SRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDVVFDDV 367

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-------- 408
           + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF + +          
Sbjct: 368 MALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDGTWH 427

Query: 409 --------------------------------YVTTYAKAFNTPIDKVSKEQRAIGKVME 436
                                           Y   YA +F      V+KEQR IGKV E
Sbjct: 428 SGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQRQIGKVQE 487

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           LALGY GG   F   A+   +DL+  ++            +A     W +          
Sbjct: 488 LALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQ--EAVEALQWTKANQRPTFGLS 545

Query: 497 KLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKR 556
                AC++ K+AWR  H  +   W+ L       +    +           + ++  + 
Sbjct: 546 DRAWLACDVFKRAWRNAHPAIAAFWQALQFAATDAIGHPETAHT-----CCGITVQYSRA 600

Query: 557 DVHIVLPSSRRLVYSDVK----GDCSYLNTA--TSQLMRERTYGGKLTENIVQAISRDIL 610
            + + LPS R L Y+  +    G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L
Sbjct: 601 WLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSRDVL 660

Query: 611 CEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEA 670
              M      GY IVLTVHDE+++E  D   F+   L +LM   P WA+GLPL AEG++ 
Sbjct: 661 AACMPAIEAAGYAIVLTVHDEMITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQT 720

Query: 671 KRYRK 675
            RYRK
Sbjct: 721 HRYRK 725


>gi|296277208|ref|ZP_06859715.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           MR1]
          Length = 631

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 192/685 (28%), Positives = 293/685 (42%), Gaps = 85/685 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAY--AEQAVITLCAYAWDDEPVKLWDRTEQSAMP---- 54
           M  + IDIET S   + K G + Y  AE   I + AY+ D   +   D T+    P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNAC 113
                  L D  V   A N+ FER    K     +P + WICT V +   GLP+SL    
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 LALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVEA 169
             L       K + GK LI  F   CK +  +         + ++ WQ F +YC RDVE 
Sbjct: 121 EVLRL--QSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEV 178

Query: 170 TRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
              +  ++   P++  E+  W+ DQ INDRG ++   L+L    L  Q +++L +    +
Sbjct: 179 EMAIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHI 238

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGS 287
           T     +      L  +L    G+D+ ++ + T++  L  +     AK ++  RL  S +
Sbjct: 239 TGLE--NPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYLKEATGK--AKKMLEIRLQMSKT 294

Query: 288 AILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQAL 347
           ++ K N + + + SD R+RG  QFYGA  TGRW+G   Q QNL +   S+  L      +
Sbjct: 295 SVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLI 353

Query: 348 NRGETIA-------DPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIK 400
                          P  L S  VR+   A  G +L V+D + IEARV+AW A E W++ 
Sbjct: 354 KEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLD 413

Query: 401 AFANGEDIYVTTYAKAFNTPIDKVSK--EQRAIGKVMELALGYQGGAKVFKTMASHCGLD 458
            F     IY  + ++ FN P++ ++K    R  GKV ELALGYQGGA   K M       
Sbjct: 414 VFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMG------ 467

Query: 459 LQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVL 518
                                           E  +++       + +  +WR  +  ++
Sbjct: 468 ------------------------------ALEMGIEEN----ELQGLVDSWRNANPNIV 493

Query: 519 QLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCS 578
             WK   E          ++ +R+  +   L     K  + I LPS R L Y       +
Sbjct: 494 NFWKACQEAAIN------TVKSRKTHHTHGLRFYMKKGFLMIELPSGRALAYPKALVGEN 547

Query: 579 YLNT---------ATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
              +            +  + +TYGGKL ENIVQA +RD+L   +      G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVH 607

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKN 654
           DE++ E P      +  + ++M K 
Sbjct: 608 DEVIVEIPRGSNG-LKEIETIMNKP 631


>gi|71898927|ref|ZP_00681094.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71731339|gb|EAO33403.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 261/725 (36%), Positives = 358/725 (49%), Gaps = 61/725 (8%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L+ D+ET SP P+   GV AYAEQA + L AYA  D PV++WD T  + MP +L   L 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGDGPVQVWDCTATATMPEELSAALH 68

Query: 63  DETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
           +  V+   HNS F+R +  +  GI+IP +RW  +   A  + LP +L   C  L      
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGINIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQ 127

Query: 123 TKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K ++GK L+A FCK           TR  H   W  F +Y +RDV A R++ KRL    
Sbjct: 128 AKAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVDYARRDVAAMRDVVKRLPSHN 187

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
            +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ Q  
Sbjct: 188 YTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRD 247

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L    
Sbjct: 248 ALLHHLSTEHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALLNCT 307

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+E +T  I A+  G       D 
Sbjct: 308 SGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVFDDV 367

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-------- 408
           + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF + +          
Sbjct: 368 MALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDGTWH 427

Query: 409 --------------------------------YVTTYAKAFNTPIDKVSKEQRAIGKVME 436
                                           Y   YA +F      V+K+QR IGKV E
Sbjct: 428 SGEAITHGALRGAPITLQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQE 487

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           LALGY GG   F   A+   +DL+  +             +A     W +  +       
Sbjct: 488 LALGYGGGVGAFAAFAAMYHIDLEAMAAQAALPPLLLQ--EATELLEWTKANHRPTFGLS 545

Query: 497 KLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKR 556
                AC++ K+AWR  H  +   W+ L       +    +           + ++  + 
Sbjct: 546 DRAWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAIGHPETAHT-----CCGITVQYSRA 600

Query: 557 DVHIVLPSSRRLVYSDVK----GDCSYLNTA--TSQLMRERTYGGKLTENIVQAISRDIL 610
            + + LPS R L Y+  +    G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L
Sbjct: 601 WLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSRDVL 660

Query: 611 CEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEA 670
              M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AEG+E 
Sbjct: 661 AACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFET 720

Query: 671 KRYRK 675
            RYRK
Sbjct: 721 HRYRK 725


>gi|28199026|ref|NP_779340.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|28199602|ref|NP_779916.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182681748|ref|YP_001829908.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|182682343|ref|YP_001830503.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|28057124|gb|AAO28989.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|28057717|gb|AAO29565.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182631858|gb|ACB92634.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|182632453|gb|ACB93229.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|307578624|gb|ADN62593.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
 gi|307580177|gb|ADN64146.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 726

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 261/725 (36%), Positives = 356/725 (49%), Gaps = 61/725 (8%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L+ D+ET SP P+   GV AYAEQA + L AYA  + PV++WD T  + MP +L   L 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGEGPVQVWDCTATATMPEELSAALH 68

Query: 63  DETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
           +  V+   HNS F+R +  +  GI IP +RW  +   A  + LP +L   C  L      
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGISIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQ 127

Query: 123 TKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K ++GK L+A FCK           TR  H   W  F EY +RDV A R++ KRL    
Sbjct: 128 AKAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVEYARRDVTAMRDVVKRLPSHN 187

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
            +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ Q  
Sbjct: 188 YTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRD 247

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L    
Sbjct: 248 ALLHHLSTAHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALLNCT 307

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+E +T  I A+  G       D 
Sbjct: 308 SRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVFDDV 367

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-------- 408
           + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF   +          
Sbjct: 368 MALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGEFDTCQGVDGTWH 427

Query: 409 --------------------------------YVTTYAKAFNTPIDKVSKEQRAIGKVME 436
                                           Y   YA +F      V+K+QR IGKV E
Sbjct: 428 SGEAITHGALRGAPIALQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQE 487

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           LALGY GG   F   A+   +DL+  +             +A     W +  +       
Sbjct: 488 LALGYGGGVGAFAAFAAMYHIDLEAMAAQAALPPLLLQ--EATELLEWTKANHRPTFGLS 545

Query: 497 KLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKR 556
                AC++ K+AWR  H  +   W+ L       +    +           + ++  + 
Sbjct: 546 DRAWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAIGHPETAHT-----CCGITVQYSRA 600

Query: 557 DVHIVLPSSRRLVYSDVK----GDCSYLNTA--TSQLMRERTYGGKLTENIVQAISRDIL 610
            + + LPS R L Y+  +    G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L
Sbjct: 601 WLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSRDVL 660

Query: 611 CEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEA 670
              M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AEG+E 
Sbjct: 661 AACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFET 720

Query: 671 KRYRK 675
            RYRK
Sbjct: 721 HRYRK 725


>gi|71899884|ref|ZP_00682032.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71730324|gb|EAO32407.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 258/728 (35%), Positives = 355/728 (48%), Gaps = 67/728 (9%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L+ D+ET SP P+   GV AYAEQA + L AYA  D PV++WD T  + MP +L   L 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGDGPVQVWDCTATATMPEELSAALH 68

Query: 63  DETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
           +  V+   HNS F+R +  +  GI+IP +RW  +   A  + LP +L   C  L      
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGINIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQ 127

Query: 123 TKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K ++GK L+A FCK           TR  H   W  F +Y +RDV A R++ KRL    
Sbjct: 128 AKAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVDYARRDVTAMRDVVKRLPSHN 187

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
            +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ Q  
Sbjct: 188 YTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRD 247

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L    
Sbjct: 248 ALLHHLSTEHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALLNCT 307

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G + QP NLPR   S+ ++   I A+  G       D 
Sbjct: 308 SGDGRLRGTLQFNGASRTGRWAGRLLQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVFDDV 367

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-------- 408
           + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K+ AF + +          
Sbjct: 368 MALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDGTWH 427

Query: 409 --------------------------------YVTTYAKAFNTPIDKVSKEQRAIGKVME 436
                                           Y   YA +F      V+K+QR IGKV E
Sbjct: 428 SGEAITHGALRGAPITLQWNAEHEPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQE 487

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           LALGY GG   F   A+   +DL+  ++                    +Q          
Sbjct: 488 LALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQQA-----MEALQWTKANQRPTF 542

Query: 497 KLIGTA---CELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRR 553
            L   A   C++ K+AWR  H  +   W+ L       +    +           + ++ 
Sbjct: 543 GLSDRAWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAIGHPETAHT-----CCGITVQY 597

Query: 554 HKRDVHIVLPSSRRLVYSDVK----GDCSYLNTA--TSQLMRERTYGGKLTENIVQAISR 607
            +  + + LPS R L Y+  +    G  SY+ T   T +  R  TYGGKL ENI QA+SR
Sbjct: 598 SRAWLRMRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEG 667
           D+L   M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AEG
Sbjct: 658 DVLAACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 717

Query: 668 YEAKRYRK 675
           +E  RYRK
Sbjct: 718 FETHRYRK 725


>gi|225220079|ref|YP_002720046.1| DNA polymerase I [Enterobacteria phage SSL-2009a]
 gi|224986020|gb|ACN74584.1| DNA polymerase I [Enterobacteria phage SSL-2009a]
          Length = 763

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 243/766 (31%), Positives = 342/766 (44%), Gaps = 94/766 (12%)

Query: 1   MS---KLFIDIETRSPQPLPKVGVWAYAEQA--VITLCAYAWDDEPVKLWDRTEQSAMPS 55
           M    +LF+D ET S   L KVG +AYAE     I +C YA D+  V+ WD TE   MP 
Sbjct: 1   MKDFERLFLDTETFSGVDLKKVGAYAYAEHPTTEIMICTYAIDEGRVQTWDCTESPTMPR 60

Query: 56  DLLQYLRDETVMC---VAHN-SLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKN 111
           +L + LR  +      V  N  LF+R++ ++  GID+P  +   T ++A  + LP SL  
Sbjct: 61  ELRKALRRVSRKKAKIVMANGLLFDRLVIREKWGIDLPVCQIEDTMIMAFRHALPGSLDM 120

Query: 112 ACLALNFSEHLTKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEAT 170
            C  L       K + GKALI RFCK +  +      TR  H + W  F  Y   D+ A 
Sbjct: 121 QCQVLGVDAEHAKDKAGKALIKRFCKPTPKTYKIRRYTRETHPEEWAKFLRYAALDIIAM 180

Query: 171 RELFKRLIPL--SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLT 228
           RE++ R+     +  E ++ L+DQ INDRG+ +D+DL     + +   +++L E+  +  
Sbjct: 181 REVYWRIPDWGNTPKEDEILLIDQLINDRGFYVDVDLARAAIKAVQAHKEELKEEAWERF 240

Query: 229 DGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSA 288
            G +  +    ALR          + +  + TL  +L   +     K LI  RL +S +A
Sbjct: 241 GGKLTGNDFLPALRDLA---PAFTIHNAQKSTLNDLLEDPDFPDEGKVLIEMRLGASSTA 297

Query: 289 ILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALN 348
             K N L   +S+DGR RG LQ+ GA RT RW+G  FQPQNL R E S++   +  +   
Sbjct: 298 STKYNPLVNGLSADGRRRGCLQYGGAKRTLRWAGKGFQPQNLARGEYSDDHEGKIKRREG 357

Query: 349 RGETIADPLGLA-----------------------SDCVRSCIIASNGKKLVVADLAGIE 385
             +                                +  VR CII + GKK VVAD + +E
Sbjct: 358 ESDVAFWVRSHMLTNGINSLLRGTAHWAYDISKLTASTVRGCIIPAKGKKFVVADYSNVE 417

Query: 386 ARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK---VSKEQRAIGKVMELALGYQ 442
            R LAWIAGE   +  F  G DIY  T  K F    +      K+ R IGK  EL LGY 
Sbjct: 418 GRGLAWIAGEKTALMVFKAGRDIYCETAGKMFGLDPEYIKANRKDLRQIGKACELGLGYG 477

Query: 443 GGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTA 502
           GG   F   A + GLDL   ++ +K T     W  A+  + + +    +   K       
Sbjct: 478 GGVAAFLQFAKNLGLDLYAMAEVMKGTFPDHIWAAAKRGYEYARINEAKRPPKPGKKDER 537

Query: 503 ------------CELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGG-------------- 536
                       C+ +K+ WR  H   +  W +L +   C ++  G              
Sbjct: 538 PTYILPKNVWLTCDAIKRMWRESHPKTVAFWAELEDAVLCAIRNPGKAYWAGANVRPDGK 597

Query: 537 -SISARRVANVPRLVMRRH-------KRDVHIVLPSSRRLVYSDV--------------- 573
            ++   R                      + I LPS R + Y  +               
Sbjct: 598 KALKIVRTKAKHDPTFDEERDDPNAAGWWLKIELPSGRIMSYPGIALSVTTEIDEDTGKK 657

Query: 574 ----KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVH 629
               +      N  T Q   + TYGGKLTENIVQA+ RDIL   M      GY+IVL+VH
Sbjct: 658 RTSTRIKYQGENQTTRQWGFQYTYGGKLTENIVQALCRDILAWSMPGVEAAGYEIVLSVH 717

Query: 630 DEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           DE+++E PDT  ++   LC+LM   P WAKG PL AEG    RYRK
Sbjct: 718 DELITEVPDTDDYTTEELCALMCDLPVWAKGFPLAAEGDIMYRYRK 763


>gi|83648986|ref|YP_437421.1| DNA polymerase I [Hahella chejuensis KCTC 2396]
 gi|83637029|gb|ABC32996.1| DNA polymerase I [Hahella chejuensis KCTC 2396]
          Length = 911

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 106/710 (14%), Positives = 195/710 (27%), Gaps = 172/710 (24%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------S 51
                D ET S   +          +A I   ++A +                       
Sbjct: 332 KTFSFDTETTSLNYM----------EAEIVGVSFAVEPGKAAYVPVAHDYMGAPEQLERD 381

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SS 108
            + + L   L D     +  N  ++  +     G+ +       T + +           
Sbjct: 382 KVLAALKPLLEDPAYRKIGQNLKYDAHVLANH-GVQLNGIA-EDTMLESYVLNSTANRHD 439

Query: 109 LKNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           +       L       +   GK                      +  + +  G Y   D 
Sbjct: 440 MDTLASKHLGRETIHFEDIAGKGAKQL---------------TFNQISLEQAGPYAAEDA 484

Query: 168 EATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
           + T +L   L P    E             L  +   +  RG  +D   +    + +A+ 
Sbjct: 485 DITLQLHHALNPKLKKEGRLEQVYRDIELPLVPVLMRMEHRGALVDSQRLRTHSQELAER 544

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITG----IDLVDMSEGTLKSILSHSNITQ 272
             +L+E+  +       +      L+   +   G             T + +L       
Sbjct: 545 MLELEEEAYEKAGQKF-NLGSPKQLQEIFYEKLGFDIIKKTPKGQPSTAEPVLQELAEKY 603

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               ++L     S       + L E ++   GR+  + Q   A  TGR S      QN+P
Sbjct: 604 ELPRVLLEYRGLSKLKSTYTDKLPEMINPRTGRVHTSYQQAVA-ATGRLSSSDPNLQNIP 662

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   IA  G KL+ AD + IE R++A 
Sbjct: 663 ------------------------VRNEQGRRIRQAFIAPKGCKLISADYSQIELRIMAH 698

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           ++G++  +KAF+ G D++  T A+ FN   D+VS EQR   K +                
Sbjct: 699 LSGDEGLLKAFSEGLDVHQATAAEVFNVAFDEVSSEQRRKAKAIN--------------F 744

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
               G+                                   A +  +  +  +     + 
Sbjct: 745 GLIYGMS------------------------------AFGLARQIHVERSEAQSYIDKYF 774

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
            ++ GVL     +                                   +     RRL   
Sbjct: 775 ERYPGVLNYMNRIRAEAQDTGY--------------------------VETLFGRRLYLP 808

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK-------NGYDI 624
           D++     L  A     R            +Q  + DI+   M                +
Sbjct: 809 DIRSSNRNLQQAA---ERTAINAP------MQGTAADIIKRAMLAVDAWLEGDSAPPAKM 859

Query: 625 VLTVHDEIVSETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           ++ VHDE++ E  ++   +V   L  +M+        +PL  E      +
Sbjct: 860 IMQVHDELILEVEESAVEAVKEKLTQIMSSAAD--LNVPLLVEAGVGNNW 907


>gi|71901326|ref|ZP_00683422.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71728910|gb|EAO31045.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  429 bits (1102), Expect = e-118,   Method: Composition-based stats.
 Identities = 259/725 (35%), Positives = 358/725 (49%), Gaps = 61/725 (8%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLR 62
            L+ D+ET SP P+   GV AYAEQA   L AYA  D PV++WD T  + MP +L   L 
Sbjct: 10  ILWGDLETYSPVPIAH-GVHAYAEQAQRLLFAYALGDGPVQVWDCTATATMPEELSAALH 68

Query: 63  DETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
           +  V+   HNS F+R +  +  GI+IP +RW  +   A  + LP +L   C  L      
Sbjct: 69  NPAVLLYFHNSHFDRTVL-RHCGINIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQ 127

Query: 123 TKMEEGKALIARFCKGSIDS-PPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K ++GK L+A FCK           TR  H   W  F +Y +RDV A R++ KRL    
Sbjct: 128 AKAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVDYARRDVAAMRDVVKRLPSHN 187

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
            +  E  LW LDQTINDRG  +D DL       + + ++ L E    LT G+++++ Q  
Sbjct: 188 YTGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRD 247

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  +L    G+ L DM + T++  L    + +  ++L+  R  +S ++  K   L    
Sbjct: 248 ALLHHLSTAHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKYQALLNCT 307

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGET---IADP 356
           S DGRLRGTLQF GASRTGRW+G +FQP NLPR   S+ ++   I A+  G       D 
Sbjct: 308 SGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVFDDV 367

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-------- 408
           + L S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  K++AF + +          
Sbjct: 368 MALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLQAFGDFDTCQGVDGTWH 427

Query: 409 --------------------------------YVTTYAKAFNTPIDKVSKEQRAIGKVME 436
                                           Y   YA +F      V+K+QR IGKV E
Sbjct: 428 SGEAITHGALRGAPITLQWNAEHEPIRKGEDIYKRAYAHSFGIAPQAVTKQQRQIGKVQE 487

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           LALGY GG   F   A+   +DL+  ++            +A     W +  +       
Sbjct: 488 LALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQ--EAVEALQWTKANHRPTFGLS 545

Query: 497 KLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKR 556
                AC++ K+AWR  H  +   W+ L       +    +           + ++  + 
Sbjct: 546 DRAWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAIGHPETAHT-----CCGITVQYSRA 600

Query: 557 DVHIVLPSSRRLVYSDVK----GDCSYLNTA--TSQLMRERTYGGKLTENIVQAISRDIL 610
            + + LPS R L Y+  +    G  SY+ T   T +  R  TYGGKL ENI QA+SRD+L
Sbjct: 601 WLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSRDVL 660

Query: 611 CEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEA 670
              M      GY IVLTVHDEI++E  D   F+   L +LM   P WA+GLPL AEG+E 
Sbjct: 661 AACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFET 720

Query: 671 KRYRK 675
            RYRK
Sbjct: 721 HRYRK 725


>gi|306826828|ref|ZP_07460129.1| DNA-directed DNA polymerase [Streptococcus pyogenes ATCC 10782]
 gi|304430991|gb|EFM33999.1| DNA-directed DNA polymerase [Streptococcus pyogenes ATCC 10782]
          Length = 643

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 199/701 (28%), Positives = 303/701 (43%), Gaps = 85/701 (12%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYA--EQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLL 58
           M  + +D+ET S   + K GV+ YA  E   I   +Y+ +   V L D T +   P  L 
Sbjct: 1   MR-IDLDLETYSSNDI-KNGVYKYADAEDFDILFMSYSINFGDVVLVDLT-KEEFPEFLK 57

Query: 59  QYLRDETVMCVAHNSLFERILFKKTLGID------IPSKRWICTSVLARTNGLPSSLKNA 112
            ++ +      A N++FERI                  K W    V A+  GLP+SL+  
Sbjct: 58  NHILNADATFWAWNTVFERICLSMYFQKKGWSKGYFDPKNWKDIMVHAQELGLPASLERC 117

Query: 113 CLALNFSEHLTKMEEGKALIARF---CKGSIDSPPYDCT-RANHVQAWQLFGEYCKRDVE 168
              L   E   K   GKALI  F   CK +  +         +  + W+ +GEY  +DV 
Sbjct: 118 ASYLGLEEQ--KDTRGKALIRYFSIPCKPTKANGGRTRNLPEHDPEKWEEYGEYNVQDVV 175

Query: 169 ATRELFKRLI--PLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVK 226
               + ++L   P+ D E D +  DQ INDRG  +D +LV         + + L  ++  
Sbjct: 176 TQMAIAEKLESVPVHDREWDHYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKA 235

Query: 227 LTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSG 286
           +T   + +      L  +L    G     +++  ++  L  +      K ++  +L ++ 
Sbjct: 236 ITG--LANPNSRAQLLPWLKEH-GYSANGLTKADVEQELKTAEG--ELKRVLELKLQTAM 290

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           S++ K   +  A+ SDGR+ G LQFYGASRTGRW+G V Q QNL R    +    +    
Sbjct: 291 SSLKKYEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLARNYIKDLDDARGYVK 350

Query: 347 LNRGET----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
               +                VR+ ++A +G    V+D + IEARV+AW AGE W++  F
Sbjct: 351 KRDIDAVEILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAGEQWRLDVF 410

Query: 403 ANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           +    IY  + ++ F  PI+++ KE R  GK+ ELALGYQGG    K M           
Sbjct: 411 STHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMG---------- 460

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A+   +     + +   WR  ++ ++Q WK
Sbjct: 461 ------------------------------ALNMGVKEEELQGLVDDWRRANKKIVQFWK 490

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD------ 576
           D+       ++    I       + +L  R  K  + I LPS R L Y+  K +      
Sbjct: 491 DVQRAAIKAIKSRAPI------KLGKLRFRYRKGFLFITLPSGRNLAYARAKVEPGDYGD 544

Query: 577 -CSYLNTATS-QLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
              Y           + TYGGKL ENIVQA +RDIL E +      G+ +V  VHDE + 
Sbjct: 545 KIIYEGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGHGVVFHVHDEAII 604

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E       ++  +  LM + P WA+GLPL +EGY  K Y K
Sbjct: 605 E---GSGLTIEEVNDLMAQAPDWAEGLPLNSEGYVTKYYMK 642


>gi|9633592|ref|NP_051006.1| P45 [Acyrthosiphon pisum bacteriophage APSE-1]
 gi|9910664|sp|Q9T1Q3|DPOL_BPAPS RecName: Full=Probable DNA polymerase; AltName: Full=P45
 gi|6118040|gb|AAF03988.1|AF157835_45 P45 [Endosymbiont phage APSE-1]
          Length = 993

 Score =  423 bits (1087), Expect = e-116,   Method: Composition-based stats.
 Identities = 226/612 (36%), Positives = 326/612 (53%), Gaps = 24/612 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           LF D+ET S  P+   G   YAE A I L AYA++  PVK+WD T+   MP+DL  YL D
Sbjct: 5   LFCDLETYSDIPI-NCGTHRYAENAEILLFAYAYNHAPVKVWDVTQDKTMPADLKAYLDD 63

Query: 64  ETVMCVAHNS-LFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
             ++ V HN  +F+ ++ K+ L ID+P  R   T V A  +GLP +L   C   N +   
Sbjct: 64  SEILTVWHNGGMFDTVILKRVLNIDLPLSRVHDTLVQALAHGLPGALGLLCDIFNVNSDK 123

Query: 123 TKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K +EGKALI+  CK    +S     T   H + WQ F +Y   D+ A RE+++ L    
Sbjct: 124 AKDKEGKALISLLCKPRPKNSKIQRATALTHAEEWQRFKDYAGSDILAMREIYQHLPNWN 183

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
           ++  E +LW LDQ IN RG  +D++L       +  E+K+L     +LTD  ++++ Q  
Sbjct: 184 MNVHETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++V
Sbjct: 244 ALLQHIASAFGITLPDMQASTLQRRINDPDIPPALRELLSVRLQSCTTSTSKYKALLKSV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI---ADP 356
           S+DGRLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G       D 
Sbjct: 304 SADGRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-----YVT 411
           + L S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+ AF+  ++      Y  
Sbjct: 364 MQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YA+AFN   + V+KEQR IGKVMEL LGY GG   F T A   GLDL + ++       
Sbjct: 424 AYARAFNLLPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
                +A   +    +    + + +K+  T C+ +K+ WR  H   +  W D+ +     
Sbjct: 484 PGVKREAMRWYQKSVETDKTYGLSEKIFVT-CDSLKRMWRNAHPQTVSFWYDIEDAVKQA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC---SYLNT--ATSQ 586
           +Q  G           +L +RR K  + I LPS R L Y   + +    +Y+ T   + +
Sbjct: 543 IQSPGI-----AFKCRKLSVRRDKSWLRICLPSGRSLCYPSARIENGQITYMGTNPYSRK 597

Query: 587 LMRERTYGGKLT 598
             R +TYGGK  
Sbjct: 598 WERLKTYGGKSC 609



 Score = 97.9 bits (242), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 51/78 (65%)

Query: 598 TENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSW 657
            ENI QA +RD+L   M    K GY+IVLTVHDEI+SE PDTP FS   L  L++ N  W
Sbjct: 915 CENICQAAARDVLAYNMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSDW 974

Query: 658 AKGLPLKAEGYEAKRYRK 675
           A  LPL A G+E  RYRK
Sbjct: 975 AWDLPLSANGFETYRYRK 992


>gi|182679659|ref|YP_001833805.1| DNA polymerase I [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635542|gb|ACB96316.1| DNA polymerase I [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 1043

 Score =  422 bits (1084), Expect = e-115,   Method: Composition-based stats.
 Identities = 117/721 (16%), Positives = 208/721 (28%), Gaps = 186/721 (25%)

Query: 4    LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ------------- 50
            L ID ET S  P+           A +   +   +                         
Sbjct: 454  LAIDTETTSLDPML----------ADLAGLSLCAEPGKAFYVPVGHTSGEGQDLFEGKGL 503

Query: 51   -------SAMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTN 103
                     +   L   L D +++ +  N  ++ I+ K+  G+++       T +L+   
Sbjct: 504  LPGQLPIGVVLERLKPLLEDPSILKIGQNVKYDWIVLKQH-GVEMRP--LDDTLLLSYVL 560

Query: 104  GLP---SSLKNACL-ALNFSEHLTKMEEGKAL--IARFCKGSIDSPPYDCTRANHVQAWQ 157
                    +       L           G     I         +               
Sbjct: 561  DAGLTDHGMDVLSEKHLGHKPIPFSAVAGSGRTFIGFARVAIDKAT-------------- 606

Query: 158  LFGEYCKRDVEATRELFKRLIPLSDGE----------RDLWLLDQTINDRGYRIDLDLVL 207
               EY   D + T  L++ L P    E          R +  +   +  RG  ID  L+ 
Sbjct: 607  ---EYAAEDADVTLRLWRVLKPRLPAEKMTTVYETLERPMIDVLARMERRGVAIDPPLLG 663

Query: 208  KLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKS 263
            +L    AQ+  + + +I +L      +      L   LF   G+     +      T   
Sbjct: 664  RLSSDFAQDMARYEAEIYELAGEKF-NLGSPKQLGDILFGKLGLPGAKKTATGAWSTAAG 722

Query: 264  ILSHSNITQL-AKDLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWS 321
            +L       +     IL+    +       + L   ++   GR+  +     A+ TGR S
Sbjct: 723  VLEDLAEQGVDLAARILDWRQLAKLKSTYTDALPNYINPSSGRVHTSYALA-ATTTGRLS 781

Query: 322  GCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADL 381
                  QN+P                            A   +R   IA  G+KLV AD 
Sbjct: 782  SSEPNLQNIP------------------------VRNEAGRKIRRAFIAPPGRKLVSADY 817

Query: 382  AGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGY 441
            + IE R+LA IA       AFA   DI+  T ++ F  P++ +  E R   K +   + Y
Sbjct: 818  SQIELRLLAHIADIKSLKNAFAENLDIHAMTASEMFGVPVEGMPSEIRRRAKAINFGIIY 877

Query: 442  QGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGT 501
                           L + +          FE +    ++    + +  E    + + G 
Sbjct: 878  G-----ISAFGLANQLAIPREEAAAYIKKYFERFPGIRAYMDDTKKKARENGYVETIFGR 932

Query: 502  ACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIV 561
             C          +  +                                            
Sbjct: 933  KCH---------YPRIKASN---------------------------------------- 943

Query: 562  LPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA---- 617
             PS R L       + + +N                    +Q  + DI+   M +     
Sbjct: 944  -PSERAL------NERAAINAP------------------IQGSAADIIRRAMIHMEAAL 978

Query: 618  --TKNGYDIVLTVHDEIVSETPDTPYF-SVGTLCSLMTKNPSWA--KGLPLKAEGYEAKR 672
               K    ++L VHDE++ E PD     ++  +  +M + P  A    +PL+ +   A+ 
Sbjct: 979  AAEKLSAQMLLQVHDELIFEVPDDEVEATIAVVRKIMVEAPLPAVHLSVPLQVDAKAAQN 1038

Query: 673  Y 673
            +
Sbjct: 1039 W 1039


>gi|212499741|ref|YP_002308549.1| DNA polymerase [Bacteriophage APSE-2]
 gi|238898732|ref|YP_002924413.1| APSE-2 prophage; DNA polymerase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|211731710|gb|ACJ10198.1| DNA polymerase [Bacteriophage APSE-2]
 gi|229466491|gb|ACQ68265.1| APSE-2 prophage; DNA polymerase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 993

 Score =  421 bits (1082), Expect = e-115,   Method: Composition-based stats.
 Identities = 225/612 (36%), Positives = 326/612 (53%), Gaps = 24/612 (3%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           LF D+ET S  P+   G   YAE A I L AYA++  PVK+WD T+   MP+DL  Y  D
Sbjct: 5   LFCDLETYSDIPI-NCGTHRYAENAEILLFAYAYNHAPVKVWDVTQDKTMPADLKAYFDD 63

Query: 64  ETVMCVAHNS-LFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSEHL 122
             ++ V HN  +F+ ++ K+ L ID+P  R   T V A  +GLP +L   C   N +   
Sbjct: 64  SEILTVWHNGGMFDTVILKRVLNIDLPLSRVHDTLVQALAHGLPGALGLLCDIFNVNSDK 123

Query: 123 TKMEEGKALIARFCKGS-IDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRL--IP 179
            K +EGKALI+  CK    +S     T   H + WQ F +Y   D+ A RE+++ L    
Sbjct: 124 AKDKEGKALISLLCKPRPKNSKIQRATALTHAEEWQRFKDYAGSDILAMREIYQHLPNWN 183

Query: 180 LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTY 239
           ++  E +LW LDQ IN RG  +D++L       +  E+K+L     +LTD  ++++ Q  
Sbjct: 184 MNVDETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRD 243

Query: 240 ALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299
           AL  ++    GI L DM   TL+  ++  +I    ++L+  RL S  ++  K   L ++V
Sbjct: 244 ALLQHIASAFGITLPDMQASTLQRRINDPDIPPDLRELLSVRLQSCTTSTSKYKALLKSV 303

Query: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI---ADP 356
           S+DGRLRGT QF GASRTGRW+G VFQP NLPR       +   I+AL  G       D 
Sbjct: 304 SADGRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICDDI 363

Query: 357 LGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDI-----YVT 411
           + L S  +R CIIA  GKKLV++DL+ IE R+LAW+AGE+WK+KAF+  ++      Y  
Sbjct: 364 MQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKL 423

Query: 412 TYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTST 471
            YA+AFN   + V+K+QR IGKVMEL LGY GG   F T A   GLDL + ++       
Sbjct: 424 AYARAFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPHIP 483

Query: 472 FEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACV 531
                +A S +    +    + + +K+    C+ +K+ WR  H   +  W D+ +     
Sbjct: 484 PGVKREATSWYQKSVETDKTYGLSEKIFVN-CDSLKRMWRNAHPQTVSFWYDIEDAVKQA 542

Query: 532 VQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC---SYLNT--ATSQ 586
           +Q  G           +L +RR K  + I LPS R L Y   + +    +Y+ T   + +
Sbjct: 543 IQSPGI-----AFKCRKLSVRRDKGWLRICLPSGRSLCYPSARIENGQITYMGTNPYSRK 597

Query: 587 LMRERTYGGKLT 598
             R +TYGGK  
Sbjct: 598 WERLKTYGGKSC 609



 Score = 97.9 bits (242), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 51/78 (65%)

Query: 598 TENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSW 657
            ENI QA +RD+L   M    K GY+IVLTVHDEI+SE PDTP FS   L  L++ N  W
Sbjct: 915 CENICQAAARDVLAYNMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSDW 974

Query: 658 AKGLPLKAEGYEAKRYRK 675
           A  LPL A G+E  RYRK
Sbjct: 975 AWDLPLSANGFETYRYRK 992


>gi|160898852|ref|YP_001564434.1| DNA-directed DNA polymerase [Delftia acidovorans SPH-1]
 gi|160364436|gb|ABX36049.1| DNA-directed DNA polymerase [Delftia acidovorans SPH-1]
          Length = 704

 Score =  421 bits (1082), Expect = e-115,   Method: Composition-based stats.
 Identities = 228/701 (32%), Positives = 337/701 (48%), Gaps = 31/701 (4%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQYLRD 63
           L++D ET S + L +VG   YAE A   L AYA  D P ++WD T    M  +L   + D
Sbjct: 5   LWLDRETWSERDLKEVGTARYAEVAEDLLFAYAIGDGPARVWDCTA-EEMHDELYHAMDD 63

Query: 64  ETVMCVAHNSLFERILF---KKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120
                 AHN+ F+R +     +     I  +RW C+  +A ++ LP  L + C  L    
Sbjct: 64  ADSEAWAHNAFFDRTIHNGPAQAHLPRIADERWRCSMAMALSHALPGGLADLCRVLKVPA 123

Query: 121 HLTKMEEGKALIARFCKGSIDSPP-YDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIP 179
            + K+ +GK L+  F +   D+      TR  H   W+ F +Y   D+ A RE  +R+  
Sbjct: 124 DMAKLADGKKLVRLFTQPQPDNRKVRRATRLTHPAEWERFKQYAANDITAMRECVRRMPA 183

Query: 180 LSDGERDL--WLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQ 237
            +     +  W LDQ IN RG+++D  L         +E+ ++     +L+ G      Q
Sbjct: 184 WNWDASAIAEWHLDQRINQRGFQVDQALTRAGARAAVEEKARIATRFAQLSGGQFT-PGQ 242

Query: 238 TYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQLAKDLILNRLASSGSAILKLNTLSE 297
               R+YL    G +L +   GT + +L    +    +++I   +AS+ ++  K   L  
Sbjct: 243 REKFRVYLGQRLGYELDNTQAGTFQVMLRDPGLPADVREMIELAIASNKTSTAKYAALDP 302

Query: 298 AVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE----EILTQTIQALNRGETI 353
           AVS DGR RG LQF GASRT RW+G +FQPQNLP +        E   + ++        
Sbjct: 303 AVSPDGRFRGGLQFAGASRTRRWAGRLFQPQNLPSRGLPSAEVIEDYIEHLKMGTHALFF 362

Query: 354 ADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGED------ 407
            + + L +  +R C++A+ GKKLVVADL+ IE RVLAWIA E+WK+KAF   +       
Sbjct: 363 DNLMLLGAAALRGCVVAAPGKKLVVADLSNIEGRVLAWIAREEWKLKAFREYDAGTGPDL 422

Query: 408 IYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVK 467
             +T  +     P +   K + A GKV +LA GYQGG   ++T A   GL +  F   ++
Sbjct: 423 YNITAVSIIGGDPWNVEKKNRNAFGKVPDLASGYQGGVAGYQTFARSYGLKMADFWDTIQ 482

Query: 468 STSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEG 527
                +   +A  +         E    D++   A E  K AWRA+H    + W  L   
Sbjct: 483 QMVPAQHVAKAWENLASWGHPQLESLEIDEIEWVASETCKLAWRARHPATSKFWYALGGA 542

Query: 528 FACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK------------- 574
               ++  GS+         R V  R ++ + + LPS R L Y +               
Sbjct: 543 AKDAIRNPGSVFTAGPFIKLRTVSHRGQKWLVVRLPSGRFLTYFEPHIVGQGRDETIAYW 602

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
           G+ S     T Q +R  T+GGK+T N  Q I+RDIL   M  A   GY  VL+VHDE ++
Sbjct: 603 GEASEEGKTTRQWVRVFTHGGKMTGNCCQTIARDILAPSMAVAENRGYLPVLSVHDEALT 662

Query: 635 ETPDTPYFSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           E PDT  F+   L  ++  NP+WA  LPL A G+EA RY+K
Sbjct: 663 EVPDTDDFTAAGLVEILATNPAWAPDLPLAAAGFEAYRYKK 703


>gi|307823067|ref|ZP_07653297.1| DNA polymerase I [Methylobacter tundripaludum SV96]
 gi|307735842|gb|EFO06689.1| DNA polymerase I [Methylobacter tundripaludum SV96]
          Length = 930

 Score =  421 bits (1082), Expect = e-115,   Method: Composition-based stats.
 Identities = 102/698 (14%), Positives = 191/698 (27%), Gaps = 153/698 (21%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSA----------M 53
              D ET S           Y++ A I   ++A                          +
Sbjct: 354 FAFDTETTSLD---------YSK-AQIVGVSFAVTPGKAAYVPLAHDYPGVPDQLDRSEI 403

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
              L   L +     +  N  ++  +     GI +       T + +          ++ 
Sbjct: 404 LEKLRPLLENPRKAKLGQNLKYDTHVLANH-GIALRGIA-HDTMLESYVLNSTATKHNMD 461

Query: 111 NAC-LALNFSEHLTKMEEGK--ALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           +     L       +   GK    I         + PY    A+                
Sbjct: 462 DLAKEYLGVETIHYEDVAGKGAKQIGFQEVSIDQAAPYAAEDADITLQLHQVLNAKLAQH 521

Query: 168 EATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
               EL+       D E  L  +   I + G  ID  ++ +    ++ +   L++    L
Sbjct: 522 PRLLELYS------DMEVPLISVLARIENNGVLIDAAMLAQQSLELSSQIISLEQHAHDL 575

Query: 228 TDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
                 +      ++  L+    +            T +S+L    +      LIL   +
Sbjct: 576 AGQTF-NLGSPKQIQDILYDQQKLPVLKKTPKGQPSTEESVLQELALDYPLPKLILEYRS 634

Query: 284 SSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
            S       + L + +    GR+  +     A  TGR S      QN+P           
Sbjct: 635 LSKLKSTYTDKLPQQIDGQTGRIHTSYHQAIA-ATGRLSSSDPNLQNIP----------- 682

Query: 343 TIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
                                +R   IA  GKK+V AD + IE R++A ++ ++  +KAF
Sbjct: 683 -------------IRSEEGRKIRQAFIAPEGKKIVAADYSQIELRIMAHLSADEGLLKAF 729

Query: 403 ANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
           +  +D++  T A+ F    ++V+ + R   K +   L Y        +            
Sbjct: 730 SEEQDVHRATAAEVFGVAPEQVTTDLRRSAKAINFGLIY-----GMSSFGL--------- 775

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                         A +  L  +  +     + A++ GV     
Sbjct: 776 ------------------------------AQQLGLSRSQAQSYIDLYFARYPGVKNYMD 805

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT 582
            + E                                 I     RRL   ++    +    
Sbjct: 806 RIREQAREQGY--------------------------IETLFGRRLYLPEINSRNAARRQ 839

Query: 583 ATSQLMRERTYGGKLTENIVQAISRDILCEGMKN----ATKN--GYDIVLTVHDEIVSET 636
                 R            +Q  + DI+   M        K      +++ VHDE+V E 
Sbjct: 840 YA---ERTAINAP------MQGTAADIIKRAMIAADQWLYKEQPDAKMIMQVHDELVFEI 890

Query: 637 PDTPYFS-VGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            +         + S+M         +PL  +      +
Sbjct: 891 AEEHVDDCAAKIRSIMCAAAD--LDVPLIVDIGIGNNW 926


>gi|269975277|gb|ACZ55501.1| DNA polymerase I [Staphylococcus phage SA1]
          Length = 645

 Score =  421 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 185/682 (27%), Positives = 286/682 (41%), Gaps = 80/682 (11%)

Query: 34  AYAWDDEPVKLWDRTEQSAMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRW 93
           A++ +   V+  D      +P +L + L D  V   A N+ FER++ ++ LGI  P K W
Sbjct: 3   AWSINGGAVQHVDLHRGKKLPGELREALEDPDVEKWAFNAQFERVMTRRVLGIKTPYKAW 62

Query: 94  ICTSVLARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKG---SIDSPPYDCTRA 150
            CT  LA   G    L      +   E   K  EGK LI  F K    +  +P      A
Sbjct: 63  RCTMALAYMLGFAGDLLAVGTQIGLPEDKLKDPEGKRLIDLFSKPQRVTKKNPFEWRNEA 122

Query: 151 NHVQAWQLFGEYCKRDVEATRELFKRL--IPLSDGERDLWLLDQTINDRGYRIDLDLVLK 208
              + W  F +Y  RDVE    +  RL   P+ D E D++ LDQ IND G  ID +    
Sbjct: 123 TDPEDWWHFCKYNIRDVETELAIKARLMRYPVLDAEWDMYALDQFINDTGVMIDREFAYS 182

Query: 209 LQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHS 268
              L    + ++ E++  +T   + +      L  +L    G    D+   T+  ++  +
Sbjct: 183 ALALAEARKPQIIEEMADITG--LNNPNSPAQLTPWLKER-GYPFSDLRSDTVNKVIREA 239

Query: 269 NI---TQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVF 325
           +       A  ++  RL S+ +++ K  T+ +A   DGR R +LQF GASRT RW+G   
Sbjct: 240 DENGVDPEAIRVLQMRLNSAKNSLSKYQTMIDAAGEDGRFRFSLQFAGASRTNRWAGRRI 299

Query: 326 QPQNLPRQERSEEILTQ---------TIQALNRGETIADPLGLASDCVRSCIIASNGKKL 376
           Q QNLPR  +  E +T                    + +P+     C+RS  I + G K 
Sbjct: 300 QTQNLPRTPKLIEDVTDLSIVNKMIHQRDLDALTLYVGEPMDALVGCIRSAFIPTPGHKF 359

Query: 377 VVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVME 436
           +VADL+ IE+ V+ W+    W +   A   D+Y +  A   + P ++     R+  K   
Sbjct: 360 IVADLSSIESVVIGWLTDCKWFMNTLAAKHDLYRSFAAHWLHLPYEETKP-HRSKAKPAT 418

Query: 437 LALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKD 496
           L  GY+ G           GL                       +   M           
Sbjct: 419 LGAGYRLGGGHMDENGKKTGL---------------------WGYAENMGVH-------- 449

Query: 497 KLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKR 556
            +     E   +A+R     +++ W DL             I  R+      L++   K 
Sbjct: 450 -MTQKEAEESVQAFRDLCPEIVRAWYDLENAVFK------VIRTRQAVVWGCLIIEYTKP 502

Query: 557 DVHIVLPSSRRLVYSDVKGDCSYL-----------------------NTATSQLMRERTY 593
            + I LPS R++ Y   +     +                         + ++  +  ++
Sbjct: 503 FLTIRLPSGRKMYYFRPRLVERQMTVQKGPKKGEKYTKTNFQYEGKVEGSGTKWGKIYSH 562

Query: 594 GGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTK 653
           GGKL ENIVQA++RD+L EG+K A + G+ IV+ +HDEIV+E P+    +V  L S M  
Sbjct: 563 GGKLVENIVQALARDVLAEGLKKAHRMGFRIVMHIHDEIVTEVPEDSPLTVDDLISCMAA 622

Query: 654 NPSWAKGLPLKAEGYEAKRYRK 675
              WA+GLPL A G+E   YRK
Sbjct: 623 ELPWAEGLPLGAAGWEGYFYRK 644


>gi|119773235|ref|YP_925975.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B]
 gi|119765735|gb|ABL98305.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B]
          Length = 923

 Score =  421 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 106/701 (15%), Positives = 200/701 (28%), Gaps = 158/701 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
           + +D ET S   +          QA +   ++A +                       A 
Sbjct: 346 IAVDTETTSLDYM----------QAELVGLSFAIEAGKAAYLPLGHDYPGAPSQLPREAT 395

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
            + L   L +  +  V  N  ++  +     GI +    +  T + +           + 
Sbjct: 396 LAKLKPLLENPDIKKVGQNLKYDMSVLANA-GIQLKGVAF-DTMLESYVFNSVASRHDMD 453

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 L       +   GK                      +  A +    Y   D + 
Sbjct: 454 GLALKYLGHKNISFEEIAGKGAKQL---------------TFNQIALEQAAPYAAEDADI 498

Query: 170 TRELFKRLIPLS-----------DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P             + E  L  +   I  RG  ID  L+ +  E +A++  
Sbjct: 499 TLRLHQHLWPRLSKEEGLESVFTELELPLIEVLSDIERRGVLIDSMLLGQQSEELARKID 558

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+   F   G          +  T + +L    +    
Sbjct: 559 ELEQHAHEIAGEPF-NLSSTKQLQELFFTKLGYPVIKKTPKGAPSTAEEVLVELALDYPL 617

Query: 275 KDLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL   + +       + L   ++   GR+  +     A  TGR S      QN+P  
Sbjct: 618 PKIILEHRSLTKLKSTYTDKLPLMINGRTGRVHTSYHQANA-ATGRLSSSDPNLQNIP-- 674

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   +A  GK+++ AD + IE R++A ++
Sbjct: 675 ----------------------IRTEEGRRIRQAFVAPEGKRILAADYSQIELRIMAHLS 712

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            ++  ++AFA G+DI+  T A+ F+   + V+ EQR   K +   L Y            
Sbjct: 713 QDEGLLRAFAEGKDIHRATAAEVFDVAFETVTSEQRRRAKAVNFGLIYGMS-----AFGL 767

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              LD+ +        + F+ +     +    +    E      L G    L        
Sbjct: 768 ARQLDIPRNEAQSYIDTYFKRYPGVLKYMEETRAMASEQGYVSTLFGRRLYL-------- 819

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
              +        +                      ++                       
Sbjct: 820 -PEIRDRNAMRRQAAERAAINAPMQGTAADIIKKAMI----------------------- 855

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                    A    ++  T G       +Q                    +++ VHDE+V
Sbjct: 856 ---------AIQHWIKTETQGE------IQ--------------------MIMQVHDELV 880

Query: 634 SETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            E       ++   +C LM    S    +PL AE      +
Sbjct: 881 FEVDADKADALKEKVCELMAAAAS--LDVPLLAEAGLGDNW 919


>gi|331665510|ref|ZP_08366408.1| DNA polymerase I (POL I) [Escherichia coli TA143]
 gi|331057195|gb|EGI29185.1| DNA polymerase I (POL I) [Escherichia coli TA143]
          Length = 928

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVLQ  +                                     +     RRL   D+
Sbjct: 795 YPGVLQYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|215489197|ref|YP_002331628.1| DNA polymerase I [Escherichia coli O127:H6 str. E2348/69]
 gi|312969394|ref|ZP_07783596.1| DNA polymerase I [Escherichia coli 2362-75]
 gi|215267269|emb|CAS11718.1| fused DNA polymerase I 5'->3' exonuclease/3'->5'polymerase/3'->5'
           exonuclease [Escherichia coli O127:H6 str. E2348/69]
 gi|312285941|gb|EFR13859.1| DNA polymerase I [Escherichia coli 2362-75]
          Length = 928

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 194/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL   +                                     +     RRL   D+
Sbjct: 795 YPGVLGYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|306813871|ref|ZP_07448047.1| DNA polymerase I [Escherichia coli NC101]
 gi|305852869|gb|EFM53316.1| DNA polymerase I [Escherichia coli NC101]
          Length = 928

 Score =  419 bits (1076), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQNILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|218701437|ref|YP_002409066.1| DNA polymerase I [Escherichia coli IAI39]
 gi|218371423|emb|CAR19256.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli IAI39]
          Length = 928

 Score =  419 bits (1076), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|218550897|ref|YP_002384688.1| DNA polymerase I [Escherichia fergusonii ATCC 35469]
 gi|218358438|emb|CAQ91085.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia fergusonii ATCC 35469]
          Length = 928

 Score =  419 bits (1076), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKNKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|227885402|ref|ZP_04003207.1| DNA polymerase I [Escherichia coli 83972]
 gi|300937085|ref|ZP_07151949.1| DNA-directed DNA polymerase [Escherichia coli MS 21-1]
 gi|300976637|ref|ZP_07173526.1| DNA-directed DNA polymerase [Escherichia coli MS 45-1]
 gi|301046666|ref|ZP_07193796.1| DNA-directed DNA polymerase [Escherichia coli MS 185-1]
 gi|227837660|gb|EEJ48126.1| DNA polymerase I [Escherichia coli 83972]
 gi|300301386|gb|EFJ57771.1| DNA-directed DNA polymerase [Escherichia coli MS 185-1]
 gi|300410020|gb|EFJ93558.1| DNA-directed DNA polymerase [Escherichia coli MS 45-1]
 gi|300457842|gb|EFK21335.1| DNA-directed DNA polymerase [Escherichia coli MS 21-1]
 gi|307556005|gb|ADN48780.1| DNA polymerase I [Escherichia coli ABU 83972]
 gi|315292801|gb|EFU52153.1| DNA-directed DNA polymerase [Escherichia coli MS 153-1]
          Length = 928

 Score =  419 bits (1076), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|331649706|ref|ZP_08350786.1| DNA polymerase I (POL I) [Escherichia coli M605]
 gi|330908181|gb|EGH36700.1| DNA polymerase 1 [Escherichia coli AA86]
 gi|331041339|gb|EGI13489.1| DNA polymerase I (POL I) [Escherichia coli M605]
          Length = 928

 Score =  419 bits (1076), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|301023768|ref|ZP_07187505.1| DNA-directed DNA polymerase [Escherichia coli MS 69-1]
 gi|300396890|gb|EFJ80428.1| DNA-directed DNA polymerase [Escherichia coli MS 69-1]
          Length = 928

 Score =  419 bits (1076), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|260870580|ref|YP_003236982.1| DNA polymerase I [Escherichia coli O111:H- str. 11128]
 gi|300906177|ref|ZP_07123891.1| DNA-directed DNA polymerase [Escherichia coli MS 84-1]
 gi|301303329|ref|ZP_07209453.1| DNA-directed DNA polymerase [Escherichia coli MS 124-1]
 gi|301328175|ref|ZP_07221307.1| DNA-directed DNA polymerase [Escherichia coli MS 78-1]
 gi|257766936|dbj|BAI38431.1| DNA polymerase I [Escherichia coli O111:H- str. 11128]
 gi|300402027|gb|EFJ85565.1| DNA-directed DNA polymerase [Escherichia coli MS 84-1]
 gi|300841283|gb|EFK69043.1| DNA-directed DNA polymerase [Escherichia coli MS 124-1]
 gi|300845357|gb|EFK73117.1| DNA-directed DNA polymerase [Escherichia coli MS 78-1]
 gi|315254225|gb|EFU34193.1| DNA-directed DNA polymerase [Escherichia coli MS 85-1]
          Length = 928

 Score =  419 bits (1076), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|110644203|ref|YP_671933.1| DNA polymerase I [Escherichia coli 536]
 gi|191173870|ref|ZP_03035390.1| DNA polymerase I [Escherichia coli F11]
 gi|300985836|ref|ZP_07177621.1| DNA-directed DNA polymerase [Escherichia coli MS 200-1]
 gi|110345795|gb|ABG72032.1| DNA polymerase I [Escherichia coli 536]
 gi|190905828|gb|EDV65447.1| DNA polymerase I [Escherichia coli F11]
 gi|300306506|gb|EFJ61026.1| DNA-directed DNA polymerase [Escherichia coli MS 200-1]
 gi|324006871|gb|EGB76090.1| DNA-directed DNA polymerase [Escherichia coli MS 57-2]
 gi|324012590|gb|EGB81809.1| DNA-directed DNA polymerase [Escherichia coli MS 60-1]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|324111949|gb|EGC05929.1| DNA polymerase I [Escherichia fergusonii B253]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKNKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLEAVAKKIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|281180926|dbj|BAI57256.1| DNA polymerase I [Escherichia coli SE15]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|331660412|ref|ZP_08361346.1| DNA polymerase I (POL I) [Escherichia coli TA206]
 gi|315300272|gb|EFU59508.1| DNA-directed DNA polymerase [Escherichia coli MS 16-3]
 gi|331052361|gb|EGI24398.1| DNA polymerase I (POL I) [Escherichia coli TA206]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|260846368|ref|YP_003224146.1| DNA polymerase I [Escherichia coli O103:H2 str. 12009]
 gi|257761515|dbj|BAI33012.1| DNA polymerase I [Escherichia coli O103:H2 str. 12009]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|170683498|ref|YP_001746191.1| DNA polymerase I [Escherichia coli SMS-3-5]
 gi|170521216|gb|ACB19394.1| DNA polymerase I [Escherichia coli SMS-3-5]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 105/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L +E  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLENEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|16131704|ref|NP_418300.1| fused DNA polymerase I 5'->3' polymerase/3'->5' exonuclease/5'->3'
           exonuclease [Escherichia coli str. K-12 substr. MG1655]
 gi|74314369|ref|YP_312788.1| DNA polymerase I [Shigella sonnei Ss046]
 gi|89110164|ref|AP_003944.1| fused DNA polymerase I 5'->3' exonuclease, 3'->5' polymerase and
           3'->5' exonuclease [Escherichia coli str. K-12 substr.
           W3110]
 gi|157158243|ref|YP_001465344.1| DNA polymerase I [Escherichia coli E24377A]
 gi|170022122|ref|YP_001727076.1| DNA polymerase I [Escherichia coli ATCC 8739]
 gi|170083336|ref|YP_001732656.1| DNA polymerase I [Escherichia coli str. K-12 substr. DH10B]
 gi|187733745|ref|YP_001882560.1| DNA polymerase I [Shigella boydii CDC 3083-94]
 gi|188493758|ref|ZP_03001028.1| DNA polymerase I [Escherichia coli 53638]
 gi|191169441|ref|ZP_03031178.1| DNA polymerase I [Escherichia coli B7A]
 gi|193063893|ref|ZP_03044979.1| DNA polymerase I [Escherichia coli E22]
 gi|193068096|ref|ZP_03049061.1| DNA polymerase I [Escherichia coli E110019]
 gi|194430447|ref|ZP_03062929.1| DNA polymerase I [Escherichia coli B171]
 gi|194440160|ref|ZP_03072207.1| DNA polymerase I [Escherichia coli 101-1]
 gi|209921336|ref|YP_002295420.1| DNA polymerase I [Escherichia coli SE11]
 gi|218556422|ref|YP_002389336.1| DNA polymerase I [Escherichia coli IAI1]
 gi|218697577|ref|YP_002405244.1| DNA polymerase I [Escherichia coli 55989]
 gi|238902931|ref|YP_002928727.1| DNA polymerase I [Escherichia coli BW2952]
 gi|253775502|ref|YP_003038333.1| DNA polymerase I [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163815|ref|YP_003046923.1| DNA polymerase I [Escherichia coli B str. REL606]
 gi|256021501|ref|ZP_05435366.1| DNA polymerase I [Shigella sp. D9]
 gi|256026104|ref|ZP_05439969.1| DNA polymerase I [Escherichia sp. 4_1_40B]
 gi|293470175|ref|ZP_06664586.1| DNA polymerase I [Escherichia coli B088]
 gi|300819242|ref|ZP_07099442.1| DNA-directed DNA polymerase [Escherichia coli MS 107-1]
 gi|300823683|ref|ZP_07103809.1| DNA-directed DNA polymerase [Escherichia coli MS 119-7]
 gi|300919043|ref|ZP_07135589.1| DNA-directed DNA polymerase [Escherichia coli MS 115-1]
 gi|300948178|ref|ZP_07162305.1| DNA-directed DNA polymerase [Escherichia coli MS 116-1]
 gi|300958283|ref|ZP_07170427.1| DNA-directed DNA polymerase [Escherichia coli MS 175-1]
 gi|301027901|ref|ZP_07191194.1| DNA-directed DNA polymerase [Escherichia coli MS 196-1]
 gi|301648434|ref|ZP_07248167.1| DNA-directed DNA polymerase [Escherichia coli MS 146-1]
 gi|307140557|ref|ZP_07499913.1| DNA polymerase I [Escherichia coli H736]
 gi|309797831|ref|ZP_07692214.1| DNA-directed DNA polymerase [Escherichia coli MS 145-7]
 gi|331644592|ref|ZP_08345711.1| DNA polymerase I (POL I) [Escherichia coli H736]
 gi|331655544|ref|ZP_08356536.1| DNA polymerase I (POL I) [Escherichia coli M718]
 gi|331670705|ref|ZP_08371541.1| DNA polymerase I (POL I) [Escherichia coli TA271]
 gi|331675321|ref|ZP_08376071.1| DNA polymerase I (POL I) [Escherichia coli TA280]
 gi|331679970|ref|ZP_08380632.1| DNA polymerase I (POL I) [Escherichia coli H591]
 gi|118825|sp|P00582|DPO1_ECOLI RecName: Full=DNA polymerase I; Short=POL I
 gi|42461|emb|CAA23607.1| unnamed protein product [Escherichia coli]
 gi|147312|gb|AAA24402.1| DNA polymerase I [Escherichia coli]
 gi|304969|gb|AAB02998.1| DNA polymerase I [Escherichia coli str. K-12 substr. MG1655]
 gi|1790294|gb|AAC76861.1| fused DNA polymerase I 5'->3' polymerase/3'->5' exonuclease/5'->3'
           exonuclease [Escherichia coli str. K-12 substr. MG1655]
 gi|73857846|gb|AAZ90553.1| DNA polymerase I [Shigella sonnei Ss046]
 gi|85676195|dbj|BAE77445.1| fused DNA polymerase I 5'->3' exonuclease, 3'->5' polymerase and
           3'->5' exonuclease [Escherichia coli str. K12 substr.
           W3110]
 gi|157080273|gb|ABV19981.1| DNA polymerase I [Escherichia coli E24377A]
 gi|169757050|gb|ACA79749.1| DNA polymerase I [Escherichia coli ATCC 8739]
 gi|169891171|gb|ACB04878.1| DNA polymerase I [Escherichia coli str. K-12 substr. DH10B]
 gi|187430737|gb|ACD10011.1| DNA polymerase I [Shigella boydii CDC 3083-94]
 gi|188488957|gb|EDU64060.1| DNA polymerase I [Escherichia coli 53638]
 gi|190900509|gb|EDV60321.1| DNA polymerase I [Escherichia coli B7A]
 gi|192929358|gb|EDV82966.1| DNA polymerase I [Escherichia coli E22]
 gi|192958716|gb|EDV89154.1| DNA polymerase I [Escherichia coli E110019]
 gi|194411506|gb|EDX27846.1| DNA polymerase I [Escherichia coli B171]
 gi|194420903|gb|EDX36943.1| DNA polymerase I [Escherichia coli 101-1]
 gi|209914595|dbj|BAG79669.1| DNA polymerase I [Escherichia coli SE11]
 gi|218354309|emb|CAV01020.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli 55989]
 gi|218363191|emb|CAR00833.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli IAI1]
 gi|238860827|gb|ACR62825.1| DNA polymerase I [Escherichia coli BW2952]
 gi|242379401|emb|CAQ34215.1| DNA polymerase I, 5'--> 3' polymerase, 5'--> 3' and 3'--> 5'
           exonuclease [Escherichia coli BL21(DE3)]
 gi|253326546|gb|ACT31148.1| DNA polymerase I [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975716|gb|ACT41387.1| DNA polymerase I [Escherichia coli B str. REL606]
 gi|253979872|gb|ACT45542.1| DNA polymerase I [Escherichia coli BL21(DE3)]
 gi|260451301|gb|ACX41723.1| DNA polymerase I [Escherichia coli DH1]
 gi|291321385|gb|EFE60824.1| DNA polymerase I [Escherichia coli B088]
 gi|299879003|gb|EFI87214.1| DNA-directed DNA polymerase [Escherichia coli MS 196-1]
 gi|300315036|gb|EFJ64820.1| DNA-directed DNA polymerase [Escherichia coli MS 175-1]
 gi|300413850|gb|EFJ97160.1| DNA-directed DNA polymerase [Escherichia coli MS 115-1]
 gi|300452272|gb|EFK15892.1| DNA-directed DNA polymerase [Escherichia coli MS 116-1]
 gi|300523745|gb|EFK44814.1| DNA-directed DNA polymerase [Escherichia coli MS 119-7]
 gi|300528128|gb|EFK49190.1| DNA-directed DNA polymerase [Escherichia coli MS 107-1]
 gi|301073504|gb|EFK88310.1| DNA-directed DNA polymerase [Escherichia coli MS 146-1]
 gi|308118587|gb|EFO55849.1| DNA-directed DNA polymerase [Escherichia coli MS 145-7]
 gi|315138432|dbj|BAJ45591.1| DNA polymerase I [Escherichia coli DH1]
 gi|320174864|gb|EFW49985.1| DNA polymerase I [Shigella dysenteriae CDC 74-1112]
 gi|323161077|gb|EFZ46995.1| DNA polymerase I [Escherichia coli E128010]
 gi|323174273|gb|EFZ59900.1| DNA polymerase I [Escherichia coli LT-68]
 gi|323189713|gb|EFZ74992.1| DNA polymerase I [Escherichia coli RN587/1]
 gi|323939084|gb|EGB35300.1| DNA polymerase I [Escherichia coli E482]
 gi|323959369|gb|EGB55030.1| DNA polymerase I [Escherichia coli H489]
 gi|323969730|gb|EGB65013.1| DNA polymerase I [Escherichia coli TA007]
 gi|324019768|gb|EGB88987.1| DNA-directed DNA polymerase [Escherichia coli MS 117-3]
 gi|331036054|gb|EGI08290.1| DNA polymerase I (POL I) [Escherichia coli H736]
 gi|331046645|gb|EGI18730.1| DNA polymerase I (POL I) [Escherichia coli M718]
 gi|331061960|gb|EGI33883.1| DNA polymerase I (POL I) [Escherichia coli TA271]
 gi|331067381|gb|EGI38786.1| DNA polymerase I (POL I) [Escherichia coli TA280]
 gi|331072296|gb|EGI43629.1| DNA polymerase I (POL I) [Escherichia coli H591]
 gi|332105090|gb|EGJ08436.1| fused DNA polymerase I 5'->3' exonuclease/3'->5' polymerase/3'->5'
           exonuclease [Shigella sp. D9]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|332084081|gb|EGI89286.1| DNA polymerase I [Shigella boydii 5216-82]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|323974266|gb|EGB69395.1| DNA polymerase I [Escherichia coli TW10509]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|325499168|gb|EGC97027.1| DNA polymerase I [Escherichia fergusonii ECD227]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKNKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLEAVAKKIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|323964211|gb|EGB59694.1| DNA polymerase I [Escherichia coli M863]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLEAVAKKIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|157163334|ref|YP_001460652.1| DNA polymerase I [Escherichia coli HS]
 gi|157069014|gb|ABV08269.1| DNA polymerase I [Escherichia coli HS]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/706 (15%), Positives = 193/706 (27%), Gaps = 169/706 (23%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
             +IL     +       + L   ++   R   T      + TGR S      QN+P   
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTRRVHTSYHQAVTATGRLSSTDPNLQNIP--- 680

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   IA     +V AD + IE R++A ++ 
Sbjct: 681 ---------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLSR 719

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                   
Sbjct: 720 DKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLI 765

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            G+                                   A +  +     +     +  ++
Sbjct: 766 YGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFERY 795

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            GVL+  +                                     +     RRL   D+K
Sbjct: 796 PGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDIK 829

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLTV 628
                   A  +               +Q  + DI+   M               +++ V
Sbjct: 830 SSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQV 880

Query: 629 HDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           HDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 881 HDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|300931708|ref|ZP_07147013.1| DNA-directed DNA polymerase [Escherichia coli MS 187-1]
 gi|300460499|gb|EFK23992.1| DNA-directed DNA polymerase [Escherichia coli MS 187-1]
          Length = 928

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYATEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|323954361|gb|EGB50146.1| DNA polymerase I [Escherichia coli H263]
          Length = 928

 Score =  418 bits (1074), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGRGENW 924


>gi|293413298|ref|ZP_06655959.1| DNA polymerase I [Escherichia coli B354]
 gi|291468046|gb|EFF10544.1| DNA polymerase I [Escherichia coli B354]
          Length = 928

 Score =  418 bits (1074), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|307314016|ref|ZP_07593630.1| DNA polymerase I [Escherichia coli W]
 gi|306906333|gb|EFN36849.1| DNA polymerase I [Escherichia coli W]
 gi|315063149|gb|ADT77476.1| DNA polymerase I [Escherichia coli W]
 gi|323380787|gb|ADX53055.1| DNA polymerase I [Escherichia coli KO11]
          Length = 928

 Score =  418 bits (1074), Expect = e-114,   Method: Composition-based stats.
 Identities = 105/707 (14%), Positives = 194/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +    +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQITLEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|91213409|ref|YP_543395.1| DNA polymerase I [Escherichia coli UTI89]
 gi|117626137|ref|YP_859460.1| DNA polymerase I [Escherichia coli APEC O1]
 gi|218560939|ref|YP_002393852.1| DNA polymerase I [Escherichia coli S88]
 gi|237702893|ref|ZP_04533374.1| DNA polymerase I [Escherichia sp. 3_2_53FAA]
 gi|91074983|gb|ABE09864.1| DNA polymerase I [Escherichia coli UTI89]
 gi|115515261|gb|ABJ03336.1| DNA polymerase I [Escherichia coli APEC O1]
 gi|218367708|emb|CAR05497.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli S88]
 gi|226902830|gb|EEH89089.1| DNA polymerase I [Escherichia sp. 3_2_53FAA]
 gi|294492133|gb|ADE90889.1| DNA polymerase I [Escherichia coli IHE3034]
 gi|307628940|gb|ADN73244.1| DNA polymerase I [Escherichia coli UM146]
 gi|315289553|gb|EFU48946.1| DNA-directed DNA polymerase [Escherichia coli MS 110-3]
 gi|323949358|gb|EGB45247.1| DNA polymerase I [Escherichia coli H252]
          Length = 928

 Score =  418 bits (1074), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGRGENW 924


>gi|194433216|ref|ZP_03065497.1| DNA polymerase I [Shigella dysenteriae 1012]
 gi|194418500|gb|EDX34588.1| DNA polymerase I [Shigella dysenteriae 1012]
          Length = 928

 Score =  418 bits (1074), Expect = e-114,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           KL++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 KLEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|218692150|ref|YP_002400362.1| DNA polymerase I [Escherichia coli ED1a]
 gi|218429714|emb|CAV18034.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli ED1a]
          Length = 928

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGRGENW 924


>gi|251793585|ref|YP_003008314.1| DNA polymerase I [Aggregatibacter aphrophilus NJ8700]
 gi|247534981|gb|ACS98227.1| DNA polymerase I (POL I) [Aggregatibacter aphrophilus NJ8700]
          Length = 985

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 201/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRT----------EQS 51
             + +D ET     +           A +   ++A ++                   E+S
Sbjct: 409 KLIAVDTETDGLDYM----------SANLVGVSFALENGEAAYLPLHLDYLGAPKTLEKS 458

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + L   L +  +  V  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 459 TALAALKPILENPNIGKVGQNLKFDMTIFARN-GIELRGIEF-DTMLLSYTLDSTGRHNM 516

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +  GEY   D +
Sbjct: 517 DDLAKRYLGHQTIGFEDIAGKGKNQL---------------TFNQIPLEQAGEYAAEDAD 561

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L                 E  L  +   +   G  ID D +      I +  
Sbjct: 562 VTMKLQQVLWEKLKSQPSLVELYQSIELPLLGVLSRMERCGVLIDSDALFLQSNEITERL 621

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L+    +L      +   T  L+  LF   G+         +  T + +L     +  
Sbjct: 622 TALEMQAHELAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELAYSHE 680

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+   GR+  +      + TGR S      QN+P 
Sbjct: 681 LPKVLVEHRGLSKLKSTYTDKLPQMVNPQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 738

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA +G K++ AD + IE R++A +
Sbjct: 739 -----------------------IRNEEGRRIRQAFIARDGYKIIAADYSQIELRIMAHL 775

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           + +   I AFA G+DI+ +T A+ F  P+++V+ EQR   K +   L Y        +  
Sbjct: 776 SNDAGLINAFAQGKDIHRSTAAELFGLPLEQVTSEQRRNAKAINFGLIYG-----MSSFG 830

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
                                                        +     +     +  
Sbjct: 831 LSRQ---------------------------------------LGISRADAQRYMDLYFQ 851

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++ GV     D+ E                                 +     RRL   +
Sbjct: 852 RYPGVQTFMHDIREKAKAQGY--------------------------VETLFGRRLYLPE 885

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +         +++ 
Sbjct: 886 INSSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKLDEITRDDPDIHMIMQ 936

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  +    + +
Sbjct: 937 VHDELVFEVRSEKIAFFSDLIKQHMEAAAELV--VPLIVDVGVGENW 981


>gi|15804448|ref|NP_290488.1| DNA polymerase I [Escherichia coli O157:H7 EDL933]
 gi|15834040|ref|NP_312813.1| DNA polymerase I [Escherichia coli O157:H7 str. Sakai]
 gi|168755528|ref|ZP_02780535.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4401]
 gi|168768145|ref|ZP_02793152.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4486]
 gi|168780763|ref|ZP_02805770.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4076]
 gi|208808881|ref|ZP_03251218.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4206]
 gi|208812650|ref|ZP_03253979.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4045]
 gi|208818813|ref|ZP_03259133.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4042]
 gi|209400301|ref|YP_002273378.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4115]
 gi|217325868|ref|ZP_03441952.1| DNA polymerase I [Escherichia coli O157:H7 str. TW14588]
 gi|254039074|ref|ZP_04873124.1| DNA polymerase I [Escherichia sp. 1_1_43]
 gi|254795854|ref|YP_003080691.1| DNA polymerase I [Escherichia coli O157:H7 str. TW14359]
 gi|261223490|ref|ZP_05937771.1| DNA polymerase I [Escherichia coli O157:H7 str. FRIK2000]
 gi|261257253|ref|ZP_05949786.1| DNA polymerase I [Escherichia coli O157:H7 str. FRIK966]
 gi|12518742|gb|AAG59052.1|AE005617_1 DNA polymerase I [Escherichia coli O157:H7 str. EDL933]
 gi|13364262|dbj|BAB38209.1| DNA polymerase I [Escherichia coli O157:H7 str. Sakai]
 gi|189001592|gb|EDU70578.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4076]
 gi|189357227|gb|EDU75646.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4401]
 gi|189362585|gb|EDU81004.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4486]
 gi|208728682|gb|EDZ78283.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4206]
 gi|208733927|gb|EDZ82614.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4045]
 gi|208738936|gb|EDZ86618.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4042]
 gi|209161701|gb|ACI39134.1| DNA polymerase I [Escherichia coli O157:H7 str. EC4115]
 gi|209752838|gb|ACI74726.1| essential GTPase for cell cycle [Escherichia coli]
 gi|209752840|gb|ACI74727.1| essential GTPase for cell cycle [Escherichia coli]
 gi|209752842|gb|ACI74728.1| essential GTPase for cell cycle [Escherichia coli]
 gi|209752844|gb|ACI74729.1| essential GTPase for cell cycle [Escherichia coli]
 gi|209752846|gb|ACI74730.1| essential GTPase for cell cycle [Escherichia coli]
 gi|217322089|gb|EEC30513.1| DNA polymerase I [Escherichia coli O157:H7 str. TW14588]
 gi|226838510|gb|EEH70539.1| DNA polymerase I [Escherichia sp. 1_1_43]
 gi|254595254|gb|ACT74615.1| DNA polymerase I [Escherichia coli O157:H7 str. TW14359]
 gi|309704289|emb|CBJ03638.1| DNA polymerase I [Escherichia coli ETEC H10407]
 gi|320191047|gb|EFW65697.1| DNA polymerase I [Escherichia coli O157:H7 str. EC1212]
 gi|320644589|gb|EFX13643.1| DNA polymerase I [Escherichia coli O157:H- str. 493-89]
 gi|320655220|gb|EFX23166.1| DNA polymerase I [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320660846|gb|EFX28292.1| DNA polymerase I [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666006|gb|EFX33025.1| DNA polymerase I [Escherichia coli O157:H7 str. LSU-61]
 gi|323934350|gb|EGB30763.1| DNA polymerase I [Escherichia coli E1520]
 gi|326338135|gb|EGD61965.1| DNA polymerase I [Escherichia coli O157:H7 str. 1044]
 gi|326342571|gb|EGD66344.1| DNA polymerase I [Escherichia coli O157:H7 str. 1125]
          Length = 928

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHRDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|222035576|emb|CAP78321.1| DNA polymerase I [Escherichia coli LF82]
 gi|312948433|gb|ADR29260.1| DNA polymerase I [Escherichia coli O83:H1 str. NRG 857C]
          Length = 928

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGRGENW 924


>gi|110807452|ref|YP_690972.1| DNA polymerase I [Shigella flexneri 5 str. 8401]
 gi|110617000|gb|ABF05667.1| DNA polymerase I [Shigella flexneri 5 str. 8401]
          Length = 928

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISHERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +        +                            +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKELGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|30064847|ref|NP_839018.1| DNA polymerase I [Shigella flexneri 2a str. 2457T]
 gi|30043107|gb|AAP18829.1| DNA polymerase I [Shigella flexneri 2a str. 2457T]
 gi|281603252|gb|ADA76236.1| DNA polymerase I, 3--> 5 polymerase, 5--> 3 and 3--> 5 exonuclease
           [Shigella flexneri 2002017]
          Length = 928

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISHERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +        +                            +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKELGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|320649913|gb|EFX18421.1| DNA polymerase I [Escherichia coli O157:H- str. H 2687]
          Length = 928

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHRDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|320198938|gb|EFW73536.1| DNA polymerase I [Escherichia coli EC4100B]
          Length = 928

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 194/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D   
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDANV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|293417324|ref|ZP_06659948.1| DNA polymerase I [Escherichia coli B185]
 gi|291430844|gb|EFF03840.1| DNA polymerase I [Escherichia coli B185]
          Length = 928

 Score =  417 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 194/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIESGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A    G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALDEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|320639201|gb|EFX08828.1| DNA polymerase I [Escherichia coli O157:H7 str. G5101]
          Length = 916

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 340 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 389

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 390 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 447

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 448 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 492

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 493 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 552

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 553 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 611

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 612 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 668

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 669 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 706

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 707 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 752

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 753 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 782

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 783 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 816

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 817 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 867

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 868 VHDELVFEVHRDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 912


>gi|323943759|gb|EGB39856.1| DNA polymerase A [Escherichia coli H120]
          Length = 810

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 234 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 283

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 284 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 341

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 342 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDSDV 386

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 387 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 446

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 447 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 505

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 506 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 562

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 563 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 600

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 601 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 646

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 647 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 676

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 677 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 710

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 711 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 761

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 762 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 806


>gi|260857738|ref|YP_003231629.1| DNA polymerase I [Escherichia coli O26:H11 str. 11368]
 gi|257756387|dbj|BAI27889.1| DNA polymerase I [Escherichia coli O26:H11 str. 11368]
 gi|323155157|gb|EFZ41344.1| DNA polymerase I [Escherichia coli EPECa14]
          Length = 928

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F+ P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFSLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|282547321|gb|ADA82378.1| putative DNA polymerase [Escherichia phage K1ind1]
          Length = 698

 Score =  417 bits (1071), Expect = e-114,   Method: Composition-based stats.
 Identities = 233/694 (33%), Positives = 324/694 (46%), Gaps = 55/694 (7%)

Query: 34  AYAWDDEPVKLWDRTEQSAMPSDLLQYLR-----DETVMCVAHN-SLFERILFKKTLGID 87
           AYA+DDEPV++WD T  S MP DL + LR     +  +  V HN S+F+R++ K   G D
Sbjct: 8   AYAFDDEPVQVWDCTNGSDMPGDLHRALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFD 67

Query: 88  IPSKRWICTSVLARTNGLPSSLKNACLALNFSEHLTKMEEGKALIARFCKGSIDS-PPYD 146
           IP    I T + A  + LP SL   C  L  S    K + GKALI RF K +  +     
Sbjct: 68  IPVSNTIDTMIWAFRHALPGSLDALCEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRR 127

Query: 147 CTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL--SDGERDLWLLDQTINDRGYRIDLD 204
            T   H   W LF +Y   D+ A RE+F +L     S+ E  +  LDQ INDRG+++D+ 
Sbjct: 128 YTAETHPDEWALFIKYAVSDITAMREVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVA 187

Query: 205 LVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSI 264
           L     E + + + +L E+  +   G +        LR          + +  + TL  +
Sbjct: 188 LAEAAIEAVEKHKAQLQEEAQRKYGGSLTGKDFLPILRELAPAHR---IHNAQKSTLNDL 244

Query: 265 LSHSNITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCV 324
           L+  ++   A  +I  RL ++ +A  K N L    SSD R RG +Q+ GA RT R++G  
Sbjct: 245 LADDDLPDDASAIIEMRLGAASTASTKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKG 304

Query: 325 FQPQNLPRQERSEEILTQTIQALNRGETI--ADPLGLASDCVRSCIIASNGKKLVVADLA 382
           FQPQNL R    ++ L + I AL +G      D   L +  VRSCII   G K VVAD +
Sbjct: 305 FQPQNLARGYYHDDELDKGISALLKGRAHRRFDVAKLTASTVRSCIIPETGHKFVVADYS 364

Query: 383 GIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKE---QRAIGKVMELAL 439
            +E R LAW+AGE+  +  F  G DIY  T  K F    D + KE    R IGK  EL L
Sbjct: 365 NVEGRGLAWLAGEETALDTFRAGLDIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGL 424

Query: 440 GYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDK-- 497
           GY GG   F   A + GLDL   ++ +  T     W      + W + Q  +   +    
Sbjct: 425 GYAGGVGAFVQFAKNLGLDLVDMAKTMDGTFPDHIWAATARGYEWARIQEAKRPPRPGEK 484

Query: 498 ----------LIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVP 547
                      +   C+ +K+ WR  H   +  W+D+ +     ++  G         V 
Sbjct: 485 DDRPSYILDKKVWRTCDAIKRMWRESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVK 544

Query: 548 --------RLVMRRHKRDVHIVLPSSRRLVYS------------------DVKGDCSYLN 581
                       +     + + LPS R + Y                   +V+      N
Sbjct: 545 FSRNVETDNNGNKVAGWWLRMTLPSGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGEN 604

Query: 582 TATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPY 641
             T Q   + TY GKL EN  QA+ RD+L   + N   NGY IVL VHDEI+ ETPD P 
Sbjct: 605 QLTRQWGFQYTYSGKLVENCTQALCRDLLANALLNVEANGYPIVLHVHDEIICETPDLPE 664

Query: 642 FSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRYRK 675
           ++V  L  LM + P WA+G PL AEG E KRY K
Sbjct: 665 YNVAELERLMCELPEWAEGFPLVAEGAEMKRYAK 698


>gi|291285274|ref|YP_003502092.1| DNA polymerase I [Escherichia coli O55:H7 str. CB9615]
 gi|290765147|gb|ADD59108.1| DNA polymerase I [Escherichia coli O55:H7 str. CB9615]
          Length = 928

 Score =  417 bits (1071), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQSY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHRDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|82546208|ref|YP_410155.1| DNA polymerase I [Shigella boydii Sb227]
 gi|81247619|gb|ABB68327.1| DNA polymerase I [Shigella boydii Sb227]
          Length = 928

 Score =  417 bits (1071), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNPL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|254447582|ref|ZP_05061048.1| DNA polymerase I [gamma proteobacterium HTCC5015]
 gi|198262925|gb|EDY87204.1| DNA polymerase I [gamma proteobacterium HTCC5015]
          Length = 900

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/708 (14%), Positives = 192/708 (27%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +          QA I   ++A +                       A+
Sbjct: 323 FSFDTETTSLNYM----------QAEIVGVSFAVEYNKAAYVPLGHDYPGAPEQLDRDAV 372

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
            + L   L D     V  +  +++ +  +  GI++       T + +           + 
Sbjct: 373 LNALKPLLEDTGKAKVGQHLKYDKNVLARY-GIELKGIA-HDTMLASYVLNSVAGRHDMD 430

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L+      +   GK                      +    +    Y   D + 
Sbjct: 431 SLAERYLDRHTVHYEDIAGKGAKQL---------------TFNQIDLEQAAPYAAEDADI 475

Query: 170 TRELFKRLIPLSDGER-----------DLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L + L P    E             L  +   I   G ++D D +    + +A+  +
Sbjct: 476 TLQLHRELWPKLQTEPSLERVYQSLEVPLVDVLARIEQNGVKVDADALYAQSQELAEGMR 535

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNIT-QL 273
           + + +      G   +      L+  LF   G+            T + +L         
Sbjct: 536 QAE-EAAHNEAGESFNLGSPKQLQAILFEKQGLPVVRKTPKGQPSTAEDVLEELAAQGHP 594

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
               IL   A S       + L + +    GR+  +     A  TGR S      QN+P 
Sbjct: 595 LPQWILRYRALSKLKSTYTDKLPQLIDSKTGRVHTSYHQAVA-ATGRLSSSDPNLQNIP- 652

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   +A  G K++ AD + IE R++A +
Sbjct: 653 -----------------------IRSEEGRRIREAFVAEPGHKILAADYSQIELRIMAHL 689

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G++  I+AF  G DI+  T ++ F  P+D+V  EQR   K +                 
Sbjct: 690 SGDETLIRAFKEGRDIHQATASEVFGVPLDEVESEQRRRAKAVNF--------------G 735

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   A +  +     +     +  
Sbjct: 736 LIYGMS------------------------------AFGLAKQLGISRGEAQGYVDTYFE 765

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++ GV    +   E                                       RRL   +
Sbjct: 766 RYPGVRDYMERTREQAREQGYVETEF--------------------------GRRLYLPE 799

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN------GYDIVL 626
           ++              R            +Q  + DI+   M               +V+
Sbjct: 800 IQSRNVPRRQHA---ERTAINAP------MQGTAADIIKRAMIAIHDALEKELPDVRMVM 850

Query: 627 TVHDEIVSETPDTPYFSVGTLCSL-MTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E P+        L    M +       + L  E   A  +
Sbjct: 851 QVHDELVFEVPEDQAKQTQALVETKMVEAAD--LRVALDVESDIADSW 896


>gi|320185486|gb|EFW60254.1| DNA polymerase I [Shigella flexneri CDC 796-83]
          Length = 928

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNPL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|94501578|ref|ZP_01308095.1| DNA polymerase I [Oceanobacter sp. RED65]
 gi|94426261|gb|EAT11252.1| DNA polymerase I [Oceanobacter sp. RED65]
          Length = 916

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 103/701 (14%), Positives = 191/701 (27%), Gaps = 159/701 (22%)

Query: 5   FIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAMP 54
            ID ET S           Y E A I   + A                          + 
Sbjct: 341 AIDTETTSL---------KYME-AEIVGISLAVAPNEACYIPLAHDYAGAPEQLDRDWVL 390

Query: 55  SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLKN 111
             +   L DET   V  N  ++  + K    I++       T + +          ++ +
Sbjct: 391 QKMKPLLEDETPKKVGQNLKYDAHVLKNY-DIELNGIA-HDTMLESYVLNSTASKHNMDD 448

Query: 112 ACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEAT 170
                L       +   GK                      +    +  GEY   D + T
Sbjct: 449 LAKHYLGHECIDFESIAGKGAKQL---------------TFNQIPVEQAGEYAAEDADIT 493

Query: 171 RELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKK 219
             L + L P  +            E  L  +   +   G  ++ D + +    I Q  ++
Sbjct: 494 LRLHQVLWPQLEADESLLTLYKKVELPLVQVLTNMEYVGASVNADKLHQQSSEIEQRLQE 553

Query: 220 LDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLAK 275
           L+     +  G + +   T  L+   F    +            T + +L   +      
Sbjct: 554 LERKAHDIA-GEVFNLGSTKQLQAIFFEKLELPVIKKTPKGQPSTAEEVLVELSHDYELP 612

Query: 276 DLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQER 335
            +IL     +       + L   ++S  +   T      + TGR S      QN+P    
Sbjct: 613 KVILEHRGLAKLKNTYTDKLPLMINSKSQRVHTSYHQAVTATGRLSSSDPNLQNIP---- 668

Query: 336 SEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGE 395
                                       +R    A  G  LV AD + IE R++A ++G+
Sbjct: 669 --------------------IRNEEGRKIRQAFEAPEGYTLVAADYSQIELRIMAHLSGD 708

Query: 396 DWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHC 455
              + AF NG+DI+  T A+        V  EQR   K +   L Y              
Sbjct: 709 KGLLDAFKNGKDIHRATAAEIMEVDEADVDNEQRRRAKAVNFGLIYGMS-----AFGLAR 763

Query: 456 GLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQ 515
            L + +          F+ +   + +    ++   +    + L G    L          
Sbjct: 764 QLGIGRSEAQEYIDKYFDRYPGVKKYMESTRELAAKQGYVETLFGRRLYL---------P 814

Query: 516 GVLQLWKDLTEGFAC-VVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            +        +      +      +A  +     + M +                     
Sbjct: 815 EINSRNGMRRQAAERTAINAPMQGTAADIIKRAMIKMHQW-------------------- 854

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                                      +Q  + D+              +++ VHDE++ 
Sbjct: 855 ---------------------------IQESAHDV-------------HMIMQVHDELIF 874

Query: 635 ETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRYR 674
           E PD    +V   + S+M         +PL  +      ++
Sbjct: 875 EVPDGQLDAVSAEIKSIMEAAAD--LDVPLLVDVGHGDNWQ 913


>gi|320196914|gb|EFW71536.1| DNA polymerase I [Escherichia coli WV_060327]
          Length = 884

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 308 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 357

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 358 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 415

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 416 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 460

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 461 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 520

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 521 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 579

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 580 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 636

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 637 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 674

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 675 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 720

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 721 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 750

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 751 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 784

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 785 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 835

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 836 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 880


>gi|324115642|gb|EGC09580.1| DNA polymerase I [Escherichia coli E1167]
          Length = 928

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIELGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|308051440|ref|YP_003915006.1| DNA polymerase I [Ferrimonas balearica DSM 9799]
 gi|307633630|gb|ADN77932.1| DNA polymerase I [Ferrimonas balearica DSM 9799]
          Length = 922

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 109/707 (15%), Positives = 199/707 (28%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
             ID ET S   +           A +   ++A +                        +
Sbjct: 346 FAIDTETTSIDYMA----------AELVGLSFAVEAGKGAYLPVAHDYEGAPVQLDRDTV 395

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
            + L   L D     V  N  ++  +  K  GI +    +  T + +          ++ 
Sbjct: 396 LAKLKPLLEDTAPRKVGQNLKYDMSVLAKY-GIALNGIAF-DTMLESYCFNSTAGRHNMD 453

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                   +  +    +    Y   D + 
Sbjct: 454 DMALKYLGHKTIHFEDIAGKGAKQ---------------KTFNQIPLEEAAPYAAEDADI 498

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P               ER L  +   +   G  ID D + +    IA    
Sbjct: 499 TLRLHQHLWPRLQELAGPTRVFEQLERPLVPIMSAMERHGVLIDTDQLHQQSSEIATTLD 558

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
            L++   ++  G + +   T  L+   F   G          +  T + +L    +    
Sbjct: 559 SLEQQAHEIA-GEVFNLGSTKQLQAIFFDKLGYPVLKKTPKGAPSTAEEVLQELALDYPL 617

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
             +IL   + +       + L + V   GR+  +      + TGR S      QN+P   
Sbjct: 618 PKIILEHRSLAKLKNTYTDKLPQLVKPSGRVHTSYHQAV-TATGRLSSSDPNLQNIP--- 673

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   IA  G KL+  D + IE R++A ++ 
Sbjct: 674 ---------------------IRTAEGRRIRQAFIAPEGYKLLAIDYSQIELRIMAHLSQ 712

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +   ++AFA G+DI+  T A+ F    D V+ EQR   K +                   
Sbjct: 713 DKGLLEAFAAGKDIHKATAAEVFGVDFDSVTTEQRRRAKAVNF--------------GLI 758

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            G+                                   A +  +     +     +  ++
Sbjct: 759 YGMS------------------------------AFGLAKQLDIGRAEAQEYIDRYFHRY 788

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            GVL+                  +                           RRL   ++ 
Sbjct: 789 PGVLEYMDRTRAQAHDKEYVETLM--------------------------GRRLHLPEI- 821

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA-------TKNGYDIVLT 627
              + +        R            +Q  + DI+ + M           ++   +++ 
Sbjct: 822 NARNKMRQ--QAAERTAINAP------MQGTAADIIKKAMLLVADYLSQQAEDEIHLIMQ 873

Query: 628 VHDEIVSETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E  +         LC LM++       +PL AEG     +
Sbjct: 874 VHDELVFEVREGVAEQHKDALCELMSQAAE--LDVPLLAEGGLGDNW 918


>gi|293391271|ref|ZP_06635605.1| DNA polymerase I [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951805|gb|EFE01924.1| DNA polymerase I [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 933

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 203/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRT----------EQS 51
             + +D ET     +           A +   ++A ++                   E++
Sbjct: 357 KLIAVDTETDGLDYM----------SANLVGISFALENGEAAYLPLHLDYLGAPKTLEKN 406

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              S L   L +  +  +  N  F+  +F +  GID+    +  T +L+ T       ++
Sbjct: 407 TALSALKPILENPNIGKIGQNLKFDMTIFARN-GIDLQGIEF-DTMLLSYTLDSTGRHNM 464

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +  GEY   D +
Sbjct: 465 DDLAKRYLGHQTISFEDIAGKGKNQL---------------TFNQIPLEQAGEYAAEDAD 509

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L    +            E  L  +   +   G  ID D +      I +  
Sbjct: 510 VTMKLQQVLWEKLEPQPGLVALYQSIELPLLSVLSRMERCGVLIDSDALFLQSNEITERL 569

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L+     L      +   T  L+  LF   G+         +  T + +L     +  
Sbjct: 570 TALEMQAYALAGQPF-NLASTKQLQEILFGKLGLPVLQKTPKGAPSTNEEVLEELAYSHE 628

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+   GR+  +      + TGR S      QN+P 
Sbjct: 629 LPKVLVEHRGLSKLKSTYTDKLPQMVNPQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 686

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                      A   +R   IA +G K++ AD + IE R++A +
Sbjct: 687 -----------------------IRNEAGRRIRQAFIARDGYKIIAADYSQIELRIMAHL 723

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           + +   I AFA G+DI+ +T A+ F  P+++V+ EQR   K +   L Y   + VF    
Sbjct: 724 SNDQGLINAFAQGKDIHRSTAAEIFGLPLEQVTSEQRRNAKAINFGLIYGMSSFVFPA-- 781

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
                                                     +  +     +     +  
Sbjct: 782 ------------------------------------------RLGISRADAQRYMDLYFQ 799

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V     D+ E                                 +     RRL   +
Sbjct: 800 RYPNVQTFIHDIREKAKAQGY--------------------------VETLFGRRLYLPE 833

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA-----TKNGYDIVLT 627
           +    +          R            +Q  + DI+   M              +++ 
Sbjct: 834 INSSNAMRR---KGTERVAINAP------MQGTAADIIKRAMIKLDGITRDDPDIHMIMQ 884

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  +    + +
Sbjct: 885 VHDELVFEVRSEKIAFFSDLIKQHMEAAAELV--VPLIVDVGVGENW 929


>gi|320182134|gb|EFW57037.1| DNA polymerase I [Shigella boydii ATCC 9905]
          Length = 884

 Score =  416 bits (1068), Expect = e-114,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 308 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 357

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 358 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 415

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 416 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 460

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 461 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 520

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 521 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 579

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 580 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 636

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 637 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 674

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 675 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 720

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 721 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 750

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 751 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 784

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 785 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 835

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 836 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 880


>gi|188532189|ref|YP_001905986.1| DNA polymerase I [Erwinia tasmaniensis Et1/99]
 gi|188027231|emb|CAO95070.1| DNA polymerase I [Erwinia tasmaniensis Et1/99]
          Length = 929

 Score =  416 bits (1068), Expect = e-113,   Method: Composition-based stats.
 Identities = 113/708 (15%), Positives = 203/708 (28%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D+ET S   L           A I   ++A                        + +
Sbjct: 352 FAFDLETDSLDTL----------SANIIGLSFATAPGVAAYLPVAHDYLDAPAQLDRNDV 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
            + L   L +   + V  N  F+R + K    I++   R+  T + +           + 
Sbjct: 402 LARLKPLLENPQALKVGQNLKFDRGVLKSY-DIELQGIRF-DTMLESYALNSVIGRHDMD 459

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 LN      +   GK                      +  A +  G Y   D + 
Sbjct: 460 TLALRWLNHKTVTFEEIAGKGKKQL---------------TFNQIALEQAGHYAAEDADV 504

Query: 170 TRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P  + E             L  +   I   G  ID  ++    + +     
Sbjct: 505 TLQLHLKMWPALEKEQGPKNVFEQLEMPLVPVMSRIERNGVLIDQGILATHSQELGSRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   +L      +      L+  LF   GI     +      T + +L+   +    
Sbjct: 565 ELEQKAHELAGEPF-NLSSPKQLQTILFEKQGIKPTKKTPGGAPSTSEEVLAELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     S       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEHRGLSKLKSTYTDKLPLMINPHSGRVHTSYHQTV-TATGRLSSSDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA  G ++V AD + IE R++A ++
Sbjct: 681 ----------------------VRNDEGRRIRQAFIAPPGYRIVAADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA+ +DI+  T A+ F   +DKVS EQR   K +   L Y        +   
Sbjct: 719 QDKGLLSAFASEQDIHRATAAEVFGVSLDKVSGEQRRSAKAINFGLIYGMS-----SFGL 773

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              L++                                            +     +  +
Sbjct: 774 SRQLNIGAG---------------------------------------EAKKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVLQ  +   E  A                              +     RRL   D+
Sbjct: 795 YPGVLQYMESTRELAAEKGY--------------------------VSTLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT-------KNGYDIVL 626
               +          R            +Q  + DI+   M                +++
Sbjct: 829 NASNAIRR---KAAERAAINAP------MQGTAADIIKRAMIAVDGWLEQQTSPDVKMIM 879

Query: 627 TVHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E       +    + +LM  +   A  +PL+ +      +
Sbjct: 880 QVHDELVFEVRADAVEAASAQIRALMEGSM--ALDVPLRVDIGVGDNW 925


>gi|218707489|ref|YP_002415008.1| DNA polymerase I [Escherichia coli UMN026]
 gi|293407483|ref|ZP_06651402.1| DNA polymerase I [Escherichia coli FVEC1412]
 gi|298383226|ref|ZP_06992819.1| DNA polymerase I [Escherichia coli FVEC1302]
 gi|300896902|ref|ZP_07115390.1| DNA-directed DNA polymerase [Escherichia coli MS 198-1]
 gi|218434586|emb|CAR15515.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Escherichia coli UMN026]
 gi|291425400|gb|EFE98439.1| DNA polymerase I [Escherichia coli FVEC1412]
 gi|298276260|gb|EFI17780.1| DNA polymerase I [Escherichia coli FVEC1302]
 gi|300359277|gb|EFJ75147.1| DNA-directed DNA polymerase [Escherichia coli MS 198-1]
          Length = 928

 Score =  415 bits (1067), Expect = e-113,   Method: Composition-based stats.
 Identities = 104/707 (14%), Positives = 194/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L +E  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLENEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   I      +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIGPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|326793522|ref|YP_004311342.1| DNA polymerase I [Marinomonas mediterranea MMB-1]
 gi|326544286|gb|ADZ89506.1| DNA polymerase I [Marinomonas mediterranea MMB-1]
          Length = 919

 Score =  415 bits (1067), Expect = e-113,   Method: Composition-based stats.
 Identities = 102/706 (14%), Positives = 194/706 (27%), Gaps = 170/706 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSA----------M 53
           +  D ET S   +          QA +   + A +                        +
Sbjct: 344 VAFDTETTSLNYM----------QAELVGVSVAIEAGKAAYIPVAHDYEDAPEQLDRDWV 393

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
              L  +L DE    V  +  ++  +      I +   ++  T + +           + 
Sbjct: 394 LEQLKPWLEDEGKAKVGQHLKYDANVLNNY-DITLRGIKF-DTMLESYVFNSTGTRHDMD 451

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L  S    +   GK                   +  +    +    Y   D + 
Sbjct: 452 SLSSKFLGHSTVKFEDIAGKGAKQ---------------KTFNQIDLEQAAFYAAEDADI 496

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + ++P  +            E  L  +   +   G  ID D +      IA   +
Sbjct: 497 TLRLHQAILPKLEKTPELVSVFSDIELPLVPVLAKMEQTGALIDPDRLHAQSAEIASRLQ 556

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
           +++    +       +      L+  LF   G+            T + IL         
Sbjct: 557 EVEIKAHEEAGQEF-NLSSPKQLQEILFEKQGLPVIKKTPKGQPSTAEPILQELAENYEL 615

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
             LI+   + +       + L E +   GR+  +      + TGR S      QN+P   
Sbjct: 616 PRLIMEHRSLAKLKSTYTDKLPEMIQHTGRIHTSYHQAV-TATGRLSSTDPNLQNIP--- 671

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   +A  G KLV AD + IE R++A ++ 
Sbjct: 672 ---------------------IRTQEGRRIRQAFVAPEGHKLVAADYSQIELRIMAHLSQ 710

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +   + AFA+ ED++  T A+ F   +D V+ EQR   K +                   
Sbjct: 711 DKGLLDAFAHDEDVHKATAAEVFEVAVDDVTAEQRRRAKAINF--------------GLI 756

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            G+                                   A +  +     +   + +  ++
Sbjct: 757 YGMS------------------------------AFGLAKQLGISRPEAQKYVQRYFERY 786

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            GV    +   E                                       RRL   ++K
Sbjct: 787 PGVRTYMETTRENAKEKGYVETIF--------------------------GRRLYLPEIK 820

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLTV 628
              + +  A     R            +Q  + DI+   M            G  +++ V
Sbjct: 821 ARNAMMRQAA---ERTAINAP------MQGSAADIIKRAMIKMHNWLADTDLGVKMIMQV 871

Query: 629 HDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           HDE++ E  +    +    +  +M  +      +PL  E      +
Sbjct: 872 HDELIFEVAEKDLEAAQAKIIDIMQNSTE--IDVPLLVEAGVGDNW 915


>gi|315633357|ref|ZP_07888648.1| DNA-directed DNA polymerase I [Aggregatibacter segnis ATCC 33393]
 gi|315477857|gb|EFU68598.1| DNA-directed DNA polymerase I [Aggregatibacter segnis ATCC 33393]
          Length = 950

 Score =  415 bits (1067), Expect = e-113,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 201/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRT----------EQS 51
             + +D ET     +           A +   ++A ++                   E+S
Sbjct: 374 KLIAVDTETDGLDYM----------SANLVGVSFALENGEAAYLPLHLDYLGAPKTLEKS 423

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + L   L +  +  V  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 424 TALAALKPILENPNIGKVGQNLKFDMTIFARN-GIELRGIEF-DTMLLSYTLDSTGRHNM 481

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +  GEY   D +
Sbjct: 482 DDLAKRYLGHQTIGFEDIAGKGKNQL---------------TFNQIPLEQAGEYAAEDAD 526

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L                 E  L  +   +   G  ID D +      I +  
Sbjct: 527 VTMKLQQVLWGKLQSQPSLVELYQSIELPLLGVLSRMERCGVLIDSDALFLQSNEITERL 586

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L+    +L      +   T  L+  LF   G+         +  T + +L     +  
Sbjct: 587 TALEMQAHELAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEDVLEELAYSHE 645

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+   GR+  +      + TGR S      QN+P 
Sbjct: 646 LPKVLVEHRGLSKLKSTYTDKLPQMVNPQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 703

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA +G K++ AD + IE R++A +
Sbjct: 704 -----------------------IRNEEGRRIRQAFIARDGYKIIAADYSQIELRIMAHL 740

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           + +   I AFA G+DI+ +T A+ F  P+++V+ EQR   K +   L Y        +  
Sbjct: 741 SNDAGLINAFAQGKDIHRSTAAEIFGLPLEQVTSEQRRNAKAINFGLIYG-----MSSFG 795

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
                                                        +     +     +  
Sbjct: 796 LSRQ---------------------------------------LGISRADAQRYMDLYFQ 816

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++ GV     D+ E                                 +     RRL   +
Sbjct: 817 RYPGVQTFMHDIREKAKAQGY--------------------------VETLFGRRLYLPE 850

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +         +++ 
Sbjct: 851 INSSNAMRR---KGAERVAINAP------MQGTAADIIKCAMIKLDEITRDDPDIHMIMQ 901

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  +    + +
Sbjct: 902 VHDELVFEVRSEKIAFFSDLIKQHMEAAAELV--VPLIVDVGVGENW 946


>gi|331685599|ref|ZP_08386182.1| DNA polymerase I (POL I) [Escherichia coli H299]
 gi|331077070|gb|EGI48285.1| DNA polymerase I (POL I) [Escherichia coli H299]
          Length = 928

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 105/707 (14%), Positives = 194/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF    I  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQSIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|24115152|ref|NP_709662.1| DNA polymerase I [Shigella flexneri 2a str. 301]
 gi|24054427|gb|AAN45369.1| DNA polymerase I, 3 --> 5 polymerase, 5 --> 3 and 3 --> 5
           exonuclease [Shigella flexneri 2a str. 301]
          Length = 928

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 105/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISHERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y     + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEHADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +        +                            +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKELGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|90415433|ref|ZP_01223367.1| putative DNA polymerase I [marine gamma proteobacterium HTCC2207]
 gi|90332756|gb|EAS47926.1| putative DNA polymerase I [marine gamma proteobacterium HTCC2207]
          Length = 926

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
           + +D ET S   +           A +   + +                           
Sbjct: 350 VAVDTETTSLDYMR----------AKLVGISLSTAPGEACYIPFAHDYMGAPEQLQPEFA 399

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L  YL D     V  N  ++  +  +  GI +    +  T + +           + 
Sbjct: 400 LEKLKPYLEDPAFPKVGQNLKYDMSVLAQH-GISLRGITF-DTMLESYVLDSVASRHDMD 457

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L           GK                      +  A    G Y   D + 
Sbjct: 458 SLALNYLGEETIKFADVAGKG---------------AAQLTFNQVALDQAGPYAAEDADI 502

Query: 170 TRELFKRLIP-----------LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P             + E  L  +   I   G  +D  L+ +  + ++    
Sbjct: 503 TLRLHQTLWPRVAAEPTLTKVFEEIELPLVPVLSRIERTGALVDDTLLFQQSQELSARLG 562

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNITQLA 274
           +L+ +  +L  G   +      L   LF    I ++  +      T + +L    +    
Sbjct: 563 ELETEAWELA-GQQFNLASPKQLGEILFEKLQIPVLKKTAKGAPSTKEEVLQELALDYPL 621

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             ++L     +       + L   ++S  GR+  +    G + TGR S      QN+P  
Sbjct: 622 PKVLLEHRGLAKLKSTYTDKLPTMINSVTGRIHTSYHQSG-TATGRLSSSDPNLQNIP-- 678

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         VR   +A+ G KLV AD + IE R++A ++
Sbjct: 679 ----------------------IRSAEGRRVRQAFVAAPGCKLVAADYSQIELRIMAHLS 716

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AF+ G+DI+  T A+ F    ++V+ +QR   K +                  
Sbjct: 717 EDPSLLAAFSAGQDIHRATAAEVFGVENEEVTIDQRRSAKAINF--------------GL 762

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +         + +  +
Sbjct: 763 IYGMS------------------------------AFGLARQLGINRKQAAEYIELYFTR 792

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GV     ++    A                              +     RRL   ++
Sbjct: 793 YPGVQNYMNNIRHSAAEQG--------------------------FVETVFGRRLYLPEI 826

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
                    A     R            +Q  + DI+   M N             I++ 
Sbjct: 827 NASNGMRRQAA---ERTAINAP------MQGTAADIIKLAMINVHNWLETSDLTSKIIMQ 877

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E P++    V   L  LM         +PL  +      +
Sbjct: 878 VHDELVLEVPESEMEEVQKGLNDLMESAAELL--VPLVVDIGVGDNW 922


>gi|311281673|ref|YP_003943904.1| DNA polymerase I [Enterobacter cloacae SCF1]
 gi|308750868|gb|ADO50620.1| DNA polymerase I [Enterobacter cloacae SCF1]
          Length = 928

 Score =  414 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 111/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S               A +   ++A +                         
Sbjct: 352 FAFDTETDSLDN----------HSANMVGLSFACEPGVAAYVPVAHDYIGAPEQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    W  T + + T         + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAW-DTMLESYTLDSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +    +  G Y   D + 
Sbjct: 460 SLSERWLKHKTITFEEIAGKGKNQL---------------TFNQIDLEQAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPKLQKREGPLNVFRNIEMPLVPVLSRIERNGVKIDPQVLQKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEQKAHDIAGEPF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   +KAFA G+DI+  T A+ F  P++ VS EQR   K +                  
Sbjct: 719 RDKGLLKAFAEGKDIHRATAAEVFGLPLESVSAEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKESQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +    A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQEEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM  +   A  +PL  E      +
Sbjct: 880 VHDELVFEVHKDALDAVSKKIHELMESSM--ALDVPLLVEVGSGDNW 924


>gi|300925951|ref|ZP_07141783.1| DNA-directed DNA polymerase [Escherichia coli MS 182-1]
 gi|300417979|gb|EFK01290.1| DNA-directed DNA polymerase [Escherichia coli MS 182-1]
          Length = 928

 Score =  414 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGPAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|114322007|ref|YP_743690.1| DNA polymerase I [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228401|gb|ABI58200.1| DNA polymerase I [Alkalilimnicola ehrlichii MLHE-1]
          Length = 912

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 104/708 (14%), Positives = 192/708 (27%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
              D+ET S   +           A I   A A                       +  +
Sbjct: 335 FAFDLETSSLNYM----------DAEIVGVALAVGAGEAAYVPLAHEGPDTPTQLDRDRV 384

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
            + L   L D     V  N  ++  +  +   I +    +  T + +           + 
Sbjct: 385 LAALKPLLEDPDRAKVGQNLKYDMSVLARY-DIHLEGVAY-DTMLESYVLDSTASRHDMD 442

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L  +    +   GK                         A +    Y   D + 
Sbjct: 443 SLALKYLGRATVKYEDVCGKGAKQ---------------IPFAQVAVETATRYAGEDADI 487

Query: 170 TRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P  + E             L  +   +   G ++D  L+ +    +A+   
Sbjct: 488 TLRLHQTLYPRLEAEGRLVQVFHAIEMPLLPVLSRMERHGVKVDRALLEQQSTELAEGMA 547

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNIT-QL 273
            L++   +  +G   +      ++  LF   G+         +  T +S+L         
Sbjct: 548 ALEQRAHEEAEGPF-NLSSPKQIQEILFERMGLPVLQKTPKGAPSTAESVLEELAARGYE 606

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              LIL   + +       + L   +    GR+  +     A  TGR S      QN+P 
Sbjct: 607 LPRLILAYRSLAKLKTTYTDKLPRLIHPKTGRVHTSYHQAVA-ATGRLSSSDPNLQNIP- 664

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   +A  G KL+ AD + +E R++A +
Sbjct: 665 -----------------------VRTAEGRRIRKAFVAEPGCKLLAADYSQVELRIMAHL 701

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G++   +AFA G DI+  T A+ F    ++V  EQR   K +                 
Sbjct: 702 SGDEGLRQAFAEGADIHSATAAEVFGLAPERVGGEQRRAAKAINF--------------G 747

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   A +  +     +     +  
Sbjct: 748 LIYGMS------------------------------AYGLARQLGIERGEAQAYVDRYFE 777

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++ GV +                                        +     RRL   +
Sbjct: 778 RYPGVKEYMDRTRAEARERGY--------------------------VETLFGRRLYLPE 811

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVL 626
           +               R            +Q  + D++   M           +   +V+
Sbjct: 812 INARNRQRREYA---ERTAINAP------MQGTAADLIKRAMVAVDAWLTEAHSKARMVM 862

Query: 627 TVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E P     +V   L   M      A  +PL+ +   A  +
Sbjct: 863 QVHDELVLEVPAADVPAVAEGLRERMQAAGELA--VPLEVDVGVADDW 908


>gi|116053643|ref|YP_793970.1| DNA polymerase I [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115588864|gb|ABJ14879.1| DNA polymerase I [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 913

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 106/709 (14%), Positives = 199/709 (28%), Gaps = 172/709 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
           +  D ET S            A+QA +   ++A  +                    + A+
Sbjct: 334 IAFDTETTSID----------AQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKT-LGIDIPSKRWICTSVLARTNGLP---SSL 109
              L   L D   + V  ++ ++  +       I +    +  T + +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L  S    +   GK                         A +  G Y   D +
Sbjct: 443 DSLALKYLGHSTIRFEDIAGKGAKQL---------------TFDQIAIEQAGPYAAEDAD 487

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T  L + L    +            E  L  +   I   G  +D +L+      + ++ 
Sbjct: 488 VTLRLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKM 547

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNI-TQ 272
             L+     L      +      L   L+   G+ ++  +      T +++L+       
Sbjct: 548 VALERQAYDLAGQEF-NLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDF 606

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               +I+   + S       + L E ++   GR+  +     A  TGR S      QN+P
Sbjct: 607 ELPKVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVA-ATGRLSSSDPNLQNIP 665

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   +A  G KL+ AD + IE R++A 
Sbjct: 666 ------------------------IRTAEGRRIRQAFVAPQGYKLLAADYSQIELRIMAH 701

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           +A +D  + AF +  D++  T A+ F  P++ VS +QR   K +                
Sbjct: 702 LAKDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF-------------- 747

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
               G+                                   A +  +     +     + 
Sbjct: 748 GLIYGMS------------------------------AFGLAKQIGVERKEAQAYIDRYF 777

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
           A++ GVL   +      A                              +     RRL   
Sbjct: 778 ARYPGVLAYMERTRAQAAEQG--------------------------FVETLFGRRLYLP 811

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIV 625
           ++      +        R            +Q  + DI+   M               ++
Sbjct: 812 EIHSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLQESGLDARVI 862

Query: 626 LTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           L VHDE+V E  +     V   +  LM+   +    +PL  E      +
Sbjct: 863 LQVHDELVLEVREDLVEQVREGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|296392358|ref|ZP_06881833.1| DNA polymerase I [Pseudomonas aeruginosa PAb1]
          Length = 913

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 106/709 (14%), Positives = 199/709 (28%), Gaps = 172/709 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
           +  D ET S            A+QA +   ++A  +                    + A+
Sbjct: 334 IAFDTETTSID----------AQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKT-LGIDIPSKRWICTSVLARTNGLP---SSL 109
              L   L D   + V  ++ ++  +       I +    +  T + +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L  S    +   GK                         A +  G Y   D +
Sbjct: 443 DSLALKYLGHSTIRFEDIAGKGAKQL---------------TFDQIAIEQAGPYAAEDAD 487

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T  L + L    +            E  L  +   I   G  +D +L+      + ++ 
Sbjct: 488 VTLRLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKM 547

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNI-TQ 272
             L+     L      +      L   L+   G+ ++  +      T +++L+       
Sbjct: 548 VALERQAYDLAGQEF-NLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDF 606

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               +I+   + S       + L E ++   GR+  +     A  TGR S      QN+P
Sbjct: 607 ELPKVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVA-ATGRLSSSDPNLQNIP 665

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   +A  G KL+ AD + IE R++A 
Sbjct: 666 ------------------------IRTAEGRRIRQAFVAPQGYKLLAADYSQIELRIMAH 701

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           +A +D  + AF +  D++  T A+ F  P++ VS +QR   K +                
Sbjct: 702 LAKDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF-------------- 747

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
               G+                                   A +  +     +     + 
Sbjct: 748 GLIYGMS------------------------------AFGLAKQIGVERKEAQAYIDRYF 777

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
           A++ GVL   +      A                              +     RRL   
Sbjct: 778 ARYPGVLAYMERTRAQAAEQG--------------------------FVETLFGRRLYLP 811

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIV 625
           ++      +        R            +Q  + DI+   M               ++
Sbjct: 812 EIHSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLLESGLDARVI 862

Query: 626 LTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           L VHDE+V E  +     V   +  LM+   +    +PL  E      +
Sbjct: 863 LQVHDELVLEVREDLVEQVREGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|330831571|ref|YP_004394523.1| DNA polymerase I [Aeromonas veronii B565]
 gi|328806707|gb|AEB51906.1| DNA polymerase I [Aeromonas veronii B565]
          Length = 921

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 108/708 (15%), Positives = 195/708 (27%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQS----------AM 53
              D ET S   +          +A I   ++A +                        +
Sbjct: 344 FAFDTETTSLDYM----------EARIVGVSFAVEAGKAAYVPFGHDYLGAPVQLSEAVV 393

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
              L   L D T + V  N  ++R +      ID+    +  T + +           + 
Sbjct: 394 LGKLKPLLEDPTCLKVGQNLKYDRNVLLNH-DIDLQGIAY-DTMLESYVLNSTASRHDMD 451

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK +                    +    +    Y   D + 
Sbjct: 452 SLAKRYLGVETTSFEDIAGKGVKQL---------------TFNQIELEQAAPYAAEDADI 496

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L    +            E  L  +   +   G  ID  L+ +  + I     
Sbjct: 497 TLRLHQTLWGQLEAVPGLAKVFSEIELPLLPVLARMELLGTTIDPKLLHQQSQEIELRLA 556

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
           +L++   +L      +      L   LF   G+ +       +  T + +L+    T   
Sbjct: 557 ELEKQAHELAGQEF-NLSSPKQLGEILFTKLGLPIIKKTPKGAPSTAEEVLAELAETYEL 615

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             L++     +       + L   +    GR+  +     A  TGR S      QN+P  
Sbjct: 616 PQLLMEHRGLAKLKSTYTDKLPLMIKPQTGRVHTSYHQAVA-ATGRLSSSDPNLQNIP-- 672

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   I S G KLV AD + IE R++A ++
Sbjct: 673 ----------------------VRNEQGRRIRQAFIPSAGYKLVAADYSQIELRIMAHLS 710

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
           G+   + AFA G+DI+  T A+ F   ID V+ + R   K +                  
Sbjct: 711 GDKGLLTAFAEGKDIHKATAAEVFGVAIDAVTTDMRRSAKAINF--------------GL 756

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 757 IYGMS------------------------------AFGLAKQLGIGRAEAQKYMDLYFER 786

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +   +                                 +     RRL   D+
Sbjct: 787 YPGVLEYMERTRQQAEAQGY--------------------------VETLFGRRLYLPDI 820

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKN-------ATKNGYDIVL 626
           K   + L        R            +Q  + DI+   M N              +++
Sbjct: 821 KSRNAGLR---KAAERAAINAP------MQGTAADIIKRAMINVDSWIRGIEDESIRMLM 871

Query: 627 TVHDEIVSETPDTPYFS-VGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  +      +  +   M+        +PL  E      +
Sbjct: 872 QVHDELVFEIREEKLEEYIAIIKEKMSAAAE--LDVPLVVEAGTGDNW 917


>gi|152985854|ref|YP_001351604.1| DNA polymerase I [Pseudomonas aeruginosa PA7]
 gi|150961012|gb|ABR83037.1| DNA polymerase I [Pseudomonas aeruginosa PA7]
          Length = 917

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 107/709 (15%), Positives = 199/709 (28%), Gaps = 172/709 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
           +  D ET S            A+QA +   ++A  +                    + A+
Sbjct: 338 IAFDTETTSID----------AQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPDQLERDAV 387

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKT-LGIDIPSKRWICTSVLARTNGLP---SSL 109
              L   L D   + V  ++ ++  +       I +    +  T + +           +
Sbjct: 388 LRALKPLLEDPQKLKVGQHAKYDINVLANASTPIAMQGVAY-DTMLESYVLDSTATRHDM 446

Query: 110 KNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L  S    +   GK                         A +  G Y   D +
Sbjct: 447 DSLALKYLGHSTIRFEDIAGKGAKQL---------------TFDQIAIEQAGPYAAEDAD 491

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T  L + L    +            E  L  +   I   G  +D +L+      + ++ 
Sbjct: 492 VTLRLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKM 551

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNI-TQ 272
             L+     L      +      L   L+   G+ ++  +      T +++L+       
Sbjct: 552 VALERQAYDLAGQEF-NLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDF 610

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               +I+   + S       + L E ++   GR+  +     A  TGR S      QN+P
Sbjct: 611 ELPKVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVA-ATGRLSSSDPNLQNIP 669

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   IA  G KL+ AD + IE R++A 
Sbjct: 670 ------------------------IRTAEGRRIRQAFIAPQGYKLLAADYSQIELRIMAH 705

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           +A ++  + AF +  D++  T A+ F  P++ VS +QR   K +                
Sbjct: 706 LAKDEGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF-------------- 751

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
               G+                                   A +  +     +     + 
Sbjct: 752 GLIYGMS------------------------------AFGLAKQIGVERKEAQAYIDRYF 781

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
           A++ GVL   +      A                              +     RRL   
Sbjct: 782 ARYPGVLAYMERTRAQAAEQG--------------------------FVETLFGRRLYLP 815

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIV 625
           ++      +        R            +Q  + DI+   M               ++
Sbjct: 816 EIHSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLRESGLDARVI 866

Query: 626 LTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           L VHDE+V E  +     V   +  LM+   S    +PL  E      +
Sbjct: 867 LQVHDELVLEVREDLVEQVREGIRPLMSGAAS--LDVPLVVEAGIGSNW 913


>gi|88705360|ref|ZP_01103071.1| DNA polymerase I [Congregibacter litoralis KT71]
 gi|88700450|gb|EAQ97558.1| DNA polymerase I [Congregibacter litoralis KT71]
          Length = 909

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 103/707 (14%), Positives = 192/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
              D ET S   +          +A I   ++A +                     + A+
Sbjct: 333 FAFDTETTSLNYM----------EADIVGLSFAVERGEAAYVPLAHSYPGAPAQLDRDAI 382

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
            + L   L D     +  N  ++  +  +   I +    +  T + +           + 
Sbjct: 383 LAALKPLLEDPAKPKLGQNLKYDASVLARY-DIHMQGIAF-DTMLESYVLDSTGTRHDMD 440

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L  S    +   GK                           +  G Y   D E 
Sbjct: 441 SLALKYLGRSTTHFEDVAGKGAKQ---------------ITFDQVGIEQAGPYAAEDAEV 485

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P               E  L  +   +   G  +D + + +    +    +
Sbjct: 486 TLALHETLWPKLQESAGLASVFSDIELPLVPVLSRMERTGALLDEERLWEQSRELGGRLQ 545

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
            L+E+   L  G + +      L   LF    +         +  T + +L    +    
Sbjct: 546 ALEEEAHNLA-GQVFNLGSPKQLGQILFEKLELPVIKKTPKGAPSTAEEVLQELALDYPL 604

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             L++     S       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 605 PKLLIEHRGLSKLKSTYTDKLPGMINPRTGRIHTSYHQAV-TATGRLSSSDPNLQNIP-- 661

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA+ G ++V AD + IE R++A ++
Sbjct: 662 ----------------------IRTEEGRRIRQAFIAAEGYQVVAADYSQIELRIMAHLS 699

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   ++AF    D++  T A+ F   +D VS EQR   K +                  
Sbjct: 700 KDAGLLEAFRENLDVHSATAAEVFGVSLDAVSGEQRRKAKAINF--------------GL 745

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A + +L     +     +  +
Sbjct: 746 IYGMS------------------------------AFGLARQLRLDRGEAQRYIDVYFER 775

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GV +   +                                    +     RRL   ++
Sbjct: 776 YPGVREYMDNTRALAHEQGY--------------------------VETLFGRRLYLPEI 809

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
                    A     R            +Q  + DI+   M    +          +++ 
Sbjct: 810 NVRNKNRQQAA---ERTAINAP------MQGTAADIIKRAMITVDRWIADDSVDAKMIMQ 860

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E  +     V   LC  M+     A  +PL  E      +
Sbjct: 861 VHDELVLEVAEDQLDPVCDELCKQMSAAAELA--VPLLVEVGRGANW 905


>gi|284923965|emb|CBG37064.1| DNA polymerase I [Escherichia coli 042]
          Length = 928

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 105/707 (14%), Positives = 194/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPSVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   I      +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIGPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|153871900|ref|ZP_02000951.1| DNA-directed DNA polymerase [Beggiatoa sp. PS]
 gi|152071634|gb|EDN69049.1| DNA-directed DNA polymerase [Beggiatoa sp. PS]
          Length = 914

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 106/706 (15%), Positives = 197/706 (27%), Gaps = 170/706 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   L          QA I   ++A                          +
Sbjct: 339 FAFDTETTSLDYL----------QAQIVGVSFAVQVGEAAYVPLAHDYLGAPQQLSCDNV 388

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSLKN 111
            + L   L +     +  N  ++  +     GI +    +  T + +          + +
Sbjct: 389 LAVLKPLLENPKKRKIGQNLKYDAHVLANH-GIHLQGMAF-DTMLESYVLNSTTKHDMDS 446

Query: 112 ACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEAT 170
                L  +    +   GK                    + +    +    Y   D + T
Sbjct: 447 LAQIYLQKTTITFEDVAGKGKKQL---------------SFNQIPLEHATPYACEDADIT 491

Query: 171 RELFKRLIPLS-----------DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKK 219
            +L + L               D E  L  +   +   G +ID  L+ +    +A   ++
Sbjct: 492 LQLHQNLWEQLQNRPKLERIFDDLEMPLIPVLIRMERHGVKIDATLLHQQSAELATRLQQ 551

Query: 220 LDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLAK 275
           L++   +       +      L+  LF    +            T   +L    I     
Sbjct: 552 LEQAAYEEAGTEF-NLNSPKQLQTILFDKLSLPVLKKTPKKDPSTAVEVLEELAIDYPLP 610

Query: 276 DLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
            LIL   + S       +TL + ++   GR+  +      + TGR S      QN+P   
Sbjct: 611 QLILIYRSLSKLKSTYTDTLPQQINPKTGRVHTSYHQAV-TTTGRLSSTNPNLQNIP--- 666

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   IA  G  L+ AD + IE R++A ++ 
Sbjct: 667 ---------------------IRSAEGRRIRQAFIAPKGYCLLAADYSQIELRIMAHLSE 705

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           ++  + A   GEDI+    A+ F+  +D+V+ EQR   K +                   
Sbjct: 706 DEKLLSALTAGEDIHKAVAAEVFDLAMDEVTTEQRRQAKAVN--------------FGLM 751

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            G+                              Q    A +  +     ++   A+ A++
Sbjct: 752 YGM------------------------------QAFGLAKQLGIERHQAQIYMDAYFARY 781

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            GV     D+                                         RRL   ++K
Sbjct: 782 PGVKAYMDDMRVLAKQQGYVETVF--------------------------GRRLYIPEIK 815

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLTV 628
                    T  + R +          +Q  + D++   M               +++ V
Sbjct: 816 ---------TRHIGRRQAAERTAINAPMQGTAADLIKRAMLTVDDWIEKSGLDVKMLMQV 866

Query: 629 HDEIVSETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           HDE+V E  +T        +   MT+       +PL  +    K +
Sbjct: 867 HDELVFEIAETVIEEAKVAIIEAMTQVAE--LKVPLIVDIGIGKNW 910


>gi|90581061|ref|ZP_01236861.1| DNA polymerase I [Vibrio angustum S14]
 gi|90437757|gb|EAS62948.1| DNA polymerase I [Vibrio angustum S14]
          Length = 923

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 100/710 (14%), Positives = 200/710 (28%), Gaps = 172/710 (24%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------S 51
                D ET     +           A +   ++A ++                      
Sbjct: 344 KAFAFDTETDGLDYMT----------ANVVGVSFAIEEGKAAYVPVAHDYLDAPAQLDRD 393

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSS 108
            +   L   L D     +  N  F+  +  +  GI++       T + +           
Sbjct: 394 WVLEQLKPLLEDPKQAKIGQNLKFDASIVARY-GIEMQGI-VFDTMLESYVFNSVVGRHD 451

Query: 109 LKNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           + +     L       +   GK                      +    +  G Y   D 
Sbjct: 452 MDSLALRYLEHKNISFEEVAGKGKKQL---------------TFNQIDLEQAGPYAAEDA 496

Query: 168 EATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
           + T  L   L P  +            E  L  +   +   G  +D  L+      IA  
Sbjct: 497 DITLRLHNTLYPKVEADDKLNHVFETIEMPLVPVLSRMERTGVYVDSMLLGAQSTEIAAR 556

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQ 272
             ++++   ++ +    +      L+  LF   G+         +  T + +L    +  
Sbjct: 557 LDEIEKKAFEIAEQEF-NLSSPKQLQAILFEKMGLPVLKKTPSGTPSTNEEVLQELALDY 615

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               L+L     +       + L + V+   GR+  +      + TGR S      QN+P
Sbjct: 616 PLPKLLLEYRGLAKLKSTYTDKLPKMVNPATGRVHTSYHQAV-TATGRLSSSDPNLQNIP 674

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   +A +G K++  D + IE R++A 
Sbjct: 675 ------------------------VRNEEGRRIRQAFVAQSGYKILAVDYSQIELRIMAH 710

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           ++G+   + AF +G+DI+  T A+  +  I++VS EQR   K +                
Sbjct: 711 LSGDKALLDAFRHGKDIHAATAAEILSLDIEEVSSEQRRRAKAINF-------------- 756

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
               G+                                   A +  +     +     + 
Sbjct: 757 GLIYGMS------------------------------AFGLAKQLDMGRNEAQNYMNVYF 786

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
            ++ GVL+  +      +                              +     RRL   
Sbjct: 787 ERYPGVLEYMESTRNAASEQGY--------------------------VETLFGRRLYLP 820

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT-------KNGYDI 624
           D+K              R            +Q  + DI+   M           +    +
Sbjct: 821 DIKSRNGLRR---KAAERAAINAP------MQGTAADIIKLAMIAVDGWVQQQPEGNVRL 871

Query: 625 VLTVHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           ++ VHDE+V E  ++   +V  ++ +LM +  +    +PL A+      +
Sbjct: 872 LMQVHDELVFEVKESALEAVTASVKALMEQAAT--LDVPLIADTGYGDNW 919


>gi|170769667|ref|ZP_02904120.1| DNA polymerase I [Escherichia albertii TW07627]
 gi|170121475|gb|EDS90406.1| DNA polymerase I [Escherichia albertii TW07627]
          Length = 928

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 105/707 (14%), Positives = 194/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                        +
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYVPVAHDYLDAPEQISRERV 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +      I++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-DIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPELQKHKGPLNVFENIEMPLVPVISRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPQDHVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT------KNGYDIVLT 627
           K   +       +               +Q  + DI+   M          K    +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEKPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E        V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDVVAKKIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|330444881|ref|ZP_08308536.1| DNA polymerase I, 3' -- 5' polymerase, 5' -- 3' and 3' -- 5'
           exonuclease [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489191|dbj|GAA03033.1| DNA polymerase I, 3' -- 5' polymerase, 5' -- 3' and 3' -- 5'
           exonuclease [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 923

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 104/710 (14%), Positives = 198/710 (27%), Gaps = 172/710 (24%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------S 51
                D ET     +           A +   ++A ++                      
Sbjct: 344 KAFAFDTETDGLDYMT----------ANVVGVSFAIEEGKAAYVPVAHDYLDAPAQLDRD 393

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSS 108
            + + L   L D     +  N  F+  +  +  GI++       T + +           
Sbjct: 394 WVLAQLKPLLEDPNQAKIGQNLKFDASIVARY-GIEMQGI-VFDTMLESYVFNSVVGRHD 451

Query: 109 LKNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           + +     L       +   GK                      +       G Y   D 
Sbjct: 452 MDSLALRYLEHKNISFEEIAGKGKKQL---------------TFNQIDLAQAGPYAAEDA 496

Query: 168 EATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
           + T  L   L P  +            E  L  +   +   G  +D  L+      IA  
Sbjct: 497 DITLRLHNALYPKVEADEKLKHVFETIEMPLVPVLSRMERTGVYVDSMLLGAQSTEIAAR 556

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQ 272
             +L++   ++ D    +      L+  LF   G+         +  T + +L    +  
Sbjct: 557 LDELEKKAFEIADQEF-NLSSPKQLQAILFEKMGLPVLKKTPSGTPSTNEEVLQELALDY 615

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               LIL     +       + L + V+   GR+  +      + TGR S      QN+P
Sbjct: 616 PLPKLILEYRGLAKLKSTYTDKLPKMVNPATGRVHTSYHQAV-TATGRLSSSDPNLQNIP 674

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   +A +G K++  D + IE R++A 
Sbjct: 675 ------------------------VRNEEGRRIRQAFVAQSGYKILAVDYSQIELRIMAH 710

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           ++G+   + AF +G+DI+  T A+     I++VS EQR   K +                
Sbjct: 711 LSGDKALLDAFRHGKDIHAATAAEILGLDIEQVSSEQRRRAKAINF-------------- 756

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
               G+                                   A +  +     +     + 
Sbjct: 757 GLIYGMS------------------------------AFGLAKQLDMGRNEAQDYMNVYF 786

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
            ++ GVL+  +      +                              +     RRL   
Sbjct: 787 ERYPGVLEYMESTRNTASEKGY--------------------------VETLFGRRLYLP 820

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK-------NGYDI 624
           D+K              R            +Q  + DI+   M            +   +
Sbjct: 821 DIKSRNGLRR---KAAERAAINAP------MQGTAADIIKLAMIAVDNWVQQQPQDEVRL 871

Query: 625 VLTVHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           ++ VHDE+V E  ++   SV   + +LM +  +    +PL A+      +
Sbjct: 872 LMQVHDELVFEVKESALESVTAEVKALMEQAAT--LDVPLIADAGFGDNW 919


>gi|157830862|pdb|1DPI|A Chain A, Structure Of Large Fragment Of Escherichia Coli Dna
           Polymerase I Complexed With DTMP
 gi|157831606|pdb|1KFD|A Chain A, Crystal Structures Of The Klenow Fragment Of Dna
           Polymerase I Complexed With Deoxynucleoside Triphosphate
           And Pyrophosphate
          Length = 605

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 29  FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 78

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 79  LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 136

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 137 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 181

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 182 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 241

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 242 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 300

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 301 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 357

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 358 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 395

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 396 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 441

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 442 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 471

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 472 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 505

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 506 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 556

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 557 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 601


>gi|15600686|ref|NP_254180.1| DNA polymerase I [Pseudomonas aeruginosa PAO1]
 gi|81539387|sp|Q9HT80|DPO1_PSEAE RecName: Full=DNA polymerase I; Short=POL I
 gi|9951828|gb|AAG08878.1|AE004962_2 DNA polymerase I [Pseudomonas aeruginosa PAO1]
          Length = 913

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 106/709 (14%), Positives = 199/709 (28%), Gaps = 172/709 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
           +  D ET S            A+QA +   ++A  +                    + A+
Sbjct: 334 IAFDTETTSID----------AQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKT-LGIDIPSKRWICTSVLARTNGLP---SSL 109
              L   L D   + V  ++ ++  +       I +    +  T + +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L  S    +   GK                         A +  G Y   D +
Sbjct: 443 DSLALKYLGHSTIRFEDIAGKGAKQL---------------TFDQIAIEQAGPYAAEDAD 487

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T  L + L    +            E  L  +   I   G  +D +L+      + ++ 
Sbjct: 488 VTLRLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKM 547

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNI-TQ 272
             L+     L      +      L   L+   G+ ++  +      T +++L+       
Sbjct: 548 VALERQAYDLAGQEF-NLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDF 606

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               +I+   + S       + L E ++   GR+  +     A  TGR S      QN+P
Sbjct: 607 ELPKVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVA-ATGRLSSSDPNLQNIP 665

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   +A  G KL+ AD + IE R++A 
Sbjct: 666 ------------------------IRTAEGRRIRQAFVAPQGYKLLAADYSQIELRIMAH 701

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           +A +D  + AF +  D++  T A+ F  P++ VS +QR   K +                
Sbjct: 702 LAKDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF-------------- 747

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
               G+                                   A +  +     +     + 
Sbjct: 748 GLIYGMS------------------------------AFGLAKQIGVERKEAQAYIDRYF 777

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
           A++ GVL   +      A                              +     RRL   
Sbjct: 778 ARYPGVLAYMERTRAQAAEQG--------------------------FVETLFGRRLYLP 811

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIV 625
           ++      +        R            +Q  + DI+   M               ++
Sbjct: 812 EIHSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLQESGLDARVI 862

Query: 626 LTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           L VHDE+V E  +     V   +  LM+   +    +PL  E      +
Sbjct: 863 LQVHDELVLEVREDLVEQVCEGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|260599983|ref|YP_003212554.1| DNA polymerase I [Cronobacter turicensis z3032]
 gi|260219160|emb|CBA34515.1| DNA polymerase I [Cronobacter turicensis z3032]
          Length = 966

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 204/707 (28%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
           + +D ET S   L           A +   ++A +                        +
Sbjct: 390 VAVDTETDSLDNLT----------ANLVGISFATEPGLAAYIPVAHDYLDAPDQLPRDRV 439

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE+++ V  N  F+R + +   GI++       T + +           + 
Sbjct: 440 LELLKPLLEDESLVKVGQNLKFDRGILQNY-GIELRGI-VFDTMLESYILDSVSGRHDMD 497

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L  +    +   GK                      +    +  G Y   D + 
Sbjct: 498 SLSSRWLKHTTITFEQIAGKGKNQL---------------TFNQIDLEQAGRYAAEDADV 542

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    + IA +  
Sbjct: 543 TLQLHLKMWPKLQQHKGPLNIFEHIEMPLVPVLSRIERNGVKIDPAVLHAHSQEIALKLA 602

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 603 ELEQKAHEIAGEPF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 661

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L + ++   GR+  +      + TGR S      QN+P  
Sbjct: 662 PKVILQYRGLAKLKSTYTDKLPQMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 718

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 719 ----------------------VRNDEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 756

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ VS EQR   K +                  
Sbjct: 757 RDKGLLSAFAEGKDIHRATAAEVFGLPLESVSNEQRRSAKAINF--------------GL 802

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 803 IYGMS------------------------------AFGLSRQLNIPRKESQKYMDLYFER 832

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +   +                                 +     RRL   D+
Sbjct: 833 YPGVLEYMERTRKQAKEQGY--------------------------VETLDGRRLYLPDI 866

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT------KNGYDIVLT 627
               +       +               +Q  + DI+   M          +    +++ 
Sbjct: 867 NASNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDGWLEKEQPRVKMIMQ 917

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM  +      +PL  E      +
Sbjct: 918 VHDELVFEVHKDDVEAVSQKIHELMENSMQ--LDVPLLVEVGSGVNW 962


>gi|107104595|ref|ZP_01368513.1| hypothetical protein PaerPA_01005674 [Pseudomonas aeruginosa PACS2]
          Length = 913

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 106/709 (14%), Positives = 199/709 (28%), Gaps = 172/709 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
           +  D ET S            A+QA +   ++A  +                    + A+
Sbjct: 334 IAFDTETTSID----------AQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKT-LGIDIPSKRWICTSVLARTNGLP---SSL 109
              L   L D   + V  ++ ++  +       I +    +  T + +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L  S    +   GK                         A +  G Y   D +
Sbjct: 443 DSLALKYLGHSTIRFEDIAGKGAKQL---------------TFDQIAIEQAGPYAAEDAD 487

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T  L + L    +            E  L  +   I   G  +D +L+      + ++ 
Sbjct: 488 VTLRLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKM 547

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNI-TQ 272
             L+     L      +      L   L+   G+ ++  +      T +++L+       
Sbjct: 548 VALERQAYDLAGQEF-NLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDF 606

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               +I+   + S       + L E ++   GR+  +     A  TGR S      QN+P
Sbjct: 607 ELPKVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVA-ATGRLSSSDPNLQNIP 665

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   +A  G KL+ AD + IE R++A 
Sbjct: 666 ------------------------IRTAEGRRIRQAFVAPQGYKLLAADYSQIELRIMAH 701

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           +A +D  + AF +  D++  T A+ F  P++ VS +QR   K +                
Sbjct: 702 LAKDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF-------------- 747

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
               G+                                   A +  +     +     + 
Sbjct: 748 GLIYGMS------------------------------AFGLAKQIGVERKEAQAYIDRYF 777

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
           A++ GVL   +      A                              +     RRL   
Sbjct: 778 ARYPGVLAYMERTRAQAAEQG--------------------------FVETLFGRRLYLP 811

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIV 625
           ++      +        R            +Q  + DI+   M               ++
Sbjct: 812 EIHSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLQESGLDARVI 862

Query: 626 LTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           L VHDE+V E  +     V   +  LM+   +    +PL  E      +
Sbjct: 863 LQVHDELVLEVREELVEQVCEGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|237807112|ref|YP_002891552.1| DNA polymerase I [Tolumonas auensis DSM 9187]
 gi|237499373|gb|ACQ91966.1| DNA polymerase I [Tolumonas auensis DSM 9187]
          Length = 910

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 109/708 (15%), Positives = 197/708 (27%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +          QA +   ++A                           
Sbjct: 333 FSFDTETNSLDYI----------QAQVVGLSFAVAPGDAAYLPLAHDYLGAPEQLDREQT 382

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
            + L   L D T + V  +  F+R + +   GI +    +  T + +          ++ 
Sbjct: 383 LAKLKPLLEDPTRLKVGQHLKFDRNVLRNH-GIHLQGIAF-DTMLESYVLNSTASRHNMD 440

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     LN++    +   GK +                    +    +    Y   D + 
Sbjct: 441 DLAKKYLNYTTQTFEDVAGKGVKQL---------------TFNQVELEKAAFYAAEDADI 485

Query: 170 TRELFKRLIPL-----------SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P             + E  L  +   +   G  ID  L+    + I     
Sbjct: 486 TLRLHQTLWPQVEKEPALKSLLLEMELPLAEVLSDMERTGALIDPFLLQNQSQQIEVRLA 545

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
           +L+    ++  G   +      L   LF    +         +  T + +L         
Sbjct: 546 ELESQAHEIAGGPF-NLGSPKQLGEVLFEKLQLPVIKKTPKGAPSTAEEVLQELAYDYPL 604

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             L+L   + S       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 605 PKLLLEHRSLSKLKSTYTDKLPLMIAPSTGRVHTSYHQAV-TATGRLSSSDPNLQNIP-- 661

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   +A +G K+V AD + IE R++A ++
Sbjct: 662 ----------------------VRTEEGRRIRQAFVADHGYKIVAADYSQIELRIMAHLS 699

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +D  ++AFA+G+DI+  T A+  N   + V+ EQR   K +                  
Sbjct: 700 EDDGLLQAFAHGQDIHRATAAEIMNITPEAVTSEQRRNAKAINF--------------GL 745

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 746 IYGMS------------------------------AFGLAKQLGIPRGEAQRYMDRYFER 775

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL   +   E                                 +     RRL   D+
Sbjct: 776 YPGVLTYMERTREQAEQAGY--------------------------VETLFGRRLYLPDI 809

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA-------TKNGYDIVL 626
           K     L        R            +Q  + DI+   M                +V+
Sbjct: 810 KAKNMGLR---KAAERAAINAP------MQGTAADIIKRAMIKLADWIKTCDNGTIRMVM 860

Query: 627 TVHDEIVSETPDTPYFS-VGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  +    + V  +   M    S    +PL         +
Sbjct: 861 QVHDELVFEVREDKLDAYVPVIRQYMMDAAS--LKVPLDVGIGVGDNW 906


>gi|218894596|ref|YP_002443466.1| DNA polymerase I [Pseudomonas aeruginosa LESB58]
 gi|218774825|emb|CAW30643.1| DNA polymerase I [Pseudomonas aeruginosa LESB58]
          Length = 913

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 107/709 (15%), Positives = 200/709 (28%), Gaps = 172/709 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
           +  D ET S            A+QA +   ++A  +                    + A+
Sbjct: 334 IAFDTETTSID----------AQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKT-LGIDIPSKRWICTSVLARTNGLP---SSL 109
              L   L D   + V  ++ ++  +       I +    +  T + +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L  S    +   GK                         A +  G Y   D +
Sbjct: 443 DSLALKYLGHSTIRFEDIAGKGAKQL---------------TFDQIAIEQAGPYAAEDAD 487

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T  L + L    +            E  L  +   I   G  +D +L+      + ++ 
Sbjct: 488 VTLRLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKM 547

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNI-TQ 272
             L+     L      +      L   L+   G+ ++  +      T +++L+       
Sbjct: 548 VALERQAYDLAGQEF-NLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDF 606

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               +I+   + S       + L E ++   GR+  +     A  TGR S      QN+P
Sbjct: 607 ELPKVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVA-ATGRLSSSDPNLQNIP 665

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   +A  G KL+ AD + IE R++A 
Sbjct: 666 ------------------------IRTAEGRRIRQAFVAPQGYKLLAADYSQIELRIMAH 701

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           +A +D  + AF +G D++  T A+ F  P++ VS +QR   K +                
Sbjct: 702 LAKDDGLLDAFRHGLDVHRATAAEVFGVPLEDVSGDQRRSAKAINF-------------- 747

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
               G+                                   A +  +     +     + 
Sbjct: 748 GLIYGMS------------------------------AFGLAKQIGVERKEAQAYIDRYF 777

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
           A++ GVL   +      A                              +     RRL   
Sbjct: 778 ARYPGVLAYMERTRAQAAEQG--------------------------FVETLFGRRLYLP 811

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIV 625
           ++      +        R            +Q  + DI+   M               ++
Sbjct: 812 EIHSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLQESGLDARVI 862

Query: 626 LTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           L VHDE+V E  +     V   +  LM+   +    +PL  E      +
Sbjct: 863 LQVHDELVLEVREELVEQVCEGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|312971852|ref|ZP_07786026.1| DNA polymerase I domain protein [Escherichia coli 1827-70]
 gi|2982102|pdb|1KFS|A Chain A, Dna Polymerase I Klenow Fragment (E.C.2.7.7.7) MutantDNA
           Complex
 gi|2982104|pdb|1KRP|A Chain A, Dna Polymerase I Klenow Fragment (E.C.2.7.7.7) MutantDNA
           Complex
 gi|2982108|pdb|1KSP|A Chain A, Dna Polymerase I Klenow Fragment (E.C.2.7.7.7) MutantDNA
           Complex
 gi|3891304|pdb|2KFN|A Chain A, Klenow Fragment With Bridging-Sulfur Substrate And
           Manganese
 gi|3891306|pdb|2KFZ|A Chain A, Klenow Fragment With Bridging-Sulfur Substrate And Zinc
           Only
 gi|4558217|pdb|2KZM|A Chain A, Klenow Fragment With Normal Substrate And Zinc And
           Manganese
 gi|4558219|pdb|2KZZ|A Chain A, Klenow Fragment With Normal Substrate And Zinc Only
 gi|5542481|pdb|1QSL|A Chain A, Klenow Fragment Complexed With Single-Stranded Substrate
           And Europium (Iii) Ion
 gi|6730280|pdb|1D9D|A Chain A, Crystall Structure Of The Complex Of Dna Polymerase I
           Klenow Fragment With Short Dna Fragment Carrying 2'-0-
           Aminopropyl-Rna Modifications 5'-D(Tcg)-Ap(Auc)-3'
 gi|6730282|pdb|1D9F|A Chain A, Crystal Structure Of The Complex Of Dna Polymerase I
           Klenow Fragment With Dna Tetramer Carrying
           2'-O-(3-Aminopropyl)- Rna Modification
           5'-D(Tt)-Ap(U)-D(T)-3'
 gi|310334229|gb|EFQ00434.1| DNA polymerase I domain protein [Escherichia coli 1827-70]
 gi|315618773|gb|EFU99357.1| DNA polymerase I domain protein [Escherichia coli 3431]
 gi|323167488|gb|EFZ53195.1| DNA polymerase I domain protein [Shigella sonnei 53G]
 gi|323177872|gb|EFZ63456.1| DNA polymerase I domain protein [Escherichia coli 1180]
 gi|323182379|gb|EFZ67786.1| DNA polymerase I domain protein [Escherichia coli 1357]
 gi|332085134|gb|EGI90312.1| DNA polymerase I domain protein [Shigella dysenteriae 155-74]
          Length = 605

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 29  FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 78

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 79  LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 136

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 137 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 181

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 182 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 241

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 242 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 300

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 301 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 357

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 358 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 395

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 396 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 441

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 442 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 471

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 472 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 505

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 506 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 556

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 557 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 601


>gi|301169575|emb|CBW29176.1| fused DNA polymerase I 5'->3' exonuclease/3'->5' polymerase/3'->5'
           exonuclease [Haemophilus influenzae 10810]
          Length = 935

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 203/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDR----------TEQS 51
             + +D ET S   +           A +   ++A ++                   E+S
Sbjct: 359 KLIAVDTETDSLDYM----------SANLVGISFALENGEAAYLPLQLDYLDAPKTLEKS 408

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + +   L +  +  +  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 409 TALAAIKPILENPNIHKIGQNIKFDESIFARH-GIELQGVEF-DTMLLSYTLNSTGRHNM 466

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +   EY   D +
Sbjct: 467 DDLAKRYLGHETIAFESLAGKGKSQL---------------TFNQIPLEQATEYAAEDAD 511

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L      E             L  +   +   G  ID D +      IA   
Sbjct: 512 VTMKLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSDALFMQSNEIASRL 571

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L++    L      +   T  L+  LF   G+         +  T + +L   + +  
Sbjct: 572 TALEKQAYALAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELSYSHE 630

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+S  GR+  +      + TGR S      QN+P 
Sbjct: 631 LPKILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 688

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA  G  +V AD + IE R++A +
Sbjct: 689 -----------------------IRNEEGRRIRQAFIAREGYSIVAADYSQIELRIMAHL 725

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+   I AF+ G+DI+ +T A+ F   +D+V+ EQR   K +                 
Sbjct: 726 SGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------G 771

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   + +  +     +     +  
Sbjct: 772 LIYGMS------------------------------AFGLSRQLGISRPDAQKYMDLYFQ 801

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V Q   D+ E                                 +     RRL   D
Sbjct: 802 RYPSVQQFMTDIREKAKTQGY--------------------------VETLFGRRLYLPD 835

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +        ++++ 
Sbjct: 836 INSSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKLDEVIHHDPNIEMIMQ 886

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  E    + +
Sbjct: 887 VHDELVFEVRSEKVAFFREQIKQHMESAAELV--VPLIVEVGVGQNW 931


>gi|156936143|ref|YP_001440059.1| DNA polymerase I [Cronobacter sakazakii ATCC BAA-894]
 gi|156534397|gb|ABU79223.1| hypothetical protein ESA_04040 [Cronobacter sakazakii ATCC BAA-894]
          Length = 927

 Score =  412 bits (1058), Expect = e-112,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 205/707 (28%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
           + +D ET S   L           A +   ++A +                        +
Sbjct: 351 VAVDTETDSLDNLT----------ANLVGISFATEPGLAAYIPVAHDYLDAPDQLSRDRV 400

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE+++ V  N  F+R + +   GI++    +  T + +           + 
Sbjct: 401 LELLKPLLEDESLVKVGQNLKFDRGILQNY-GIELRGIAF-DTMLESYILDSVSGRHDMD 458

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L  +    +   GK                      +    +  G Y   D + 
Sbjct: 459 SLSSRWLKHTTITFEQIAGKGKNQL---------------TFNQIDLEQAGRYAAEDADV 503

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    + IA +  
Sbjct: 504 TLQLHLKMWPKLQQHKGPLNIFEHIEMPLVPVLSRIERNGVKIDPAVLHAHSQEIALKLT 563

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 564 ELEQKAHEIAGEPF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 622

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L + ++   GR+  +      + TGR S      QN+P  
Sbjct: 623 PKVILQYRGLAKLKSTYTDKLPQMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 679

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 680 ----------------------VRNDEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 717

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ VS EQR   K +                  
Sbjct: 718 RDKGLLSAFAEGKDIHRATAAEVFGLPLESVSNEQRRSAKAINF--------------GL 763

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 764 IYGMS------------------------------AFGLSRQLNIPRKESQKYMDLYFER 793

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +   +                                 +     RRL   D+
Sbjct: 794 YPGVLEYMERTRKQAKEQGY--------------------------VETLDGRRLYLPDI 827

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT------KNGYDIVLT 627
               +       +               +Q  + DI+   M          +    +++ 
Sbjct: 828 NASNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDGWLQKEQPRVKMIMQ 878

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM  +      +PL  E      +
Sbjct: 879 VHDELVFEVHKDDVEAVSQKIHELMENSMQ--LDVPLLVEVGSGVNW 923


>gi|290466795|gb|ADD25725.1| putative DNA polymerase [Lactococcus phage 1358]
          Length = 653

 Score =  412 bits (1058), Expect = e-112,   Method: Composition-based stats.
 Identities = 207/700 (29%), Positives = 308/700 (44%), Gaps = 73/700 (10%)

Query: 1   MSK-LFIDIETRSPQPLPKVGVWAYAEQ--AVITLCAYAWDDEPVKLWDRTEQSAMPSDL 57
           M K L IDIET S   L   GV+ YA      I L +Y + DEPV   D  +   +PS +
Sbjct: 1   MKKPLHIDIETFSDVDLAGCGVYRYAASPAFYIQLFSYRFGDEPVTRLDLQQGDVIPSKV 60

Query: 58  LQYLRDETVMCVAHNSLFERILFKKTL-GIDIPSKRWICTSVLARTNGLPSSLKNACLAL 116
           L+ LRD   + VAHN+ FER+     L G  +    W CT V     GLP SL     AL
Sbjct: 61  LRALRDPKRIKVAHNAQFERVCIGYELDGRPLDPTNWRCTMVWGSCLGLPQSLDGMGKAL 120

Query: 117 NFSEHLTKMEEGKALIARF---CKGSIDSPPYDCTRANH-VQAWQLFGEYCKRDVEATRE 172
                  K +EGK LI  F   CK +  +         H  + W+ +G+Y + DVE    
Sbjct: 121 GLDVQ--KDKEGKRLIQYFSKPCKPTKANGGRTQNLPEHAPEDWEHYGKYNEIDVEVETG 178

Query: 173 LFKRL---IPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTD 229
           +  +L     L   E   +  DQ IND G  +D+  V +  +L  + +K+    + +LT 
Sbjct: 179 ISDKLAAIYELPADEWRGYENDQRINDAGVPVDVPFVRQAIKLKDKLKKRSSMKLRRLTG 238

Query: 230 GIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSHSNITQ---LAKDLILNRLASSG 286
               S  +   L+ +     G  +  + +   +  L+   + Q       +I     + G
Sbjct: 239 VE--SVTKVQQLKAWA-AAQGYPVESLDKQHCEDYLNDPELHQDFPEVYRMIELYQEAGG 295

Query: 287 SAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQA 346
           +A+ K + +   +  DG ++G L+F GA  T RW+G   Q QNLPR     + L    Q 
Sbjct: 296 AAVAKYDKIMAQLMPDGTIKGQLRFCGAGATARWAGKGVQVQNLPRVYLKADKLEAARQI 355

Query: 347 LNRGET-----IADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKA 401
           + +G+T       +P+ + +  VR+ +      +  V+D + IEARV+AW AGE W +KA
Sbjct: 356 VAKGKTVGLKKFGNPIDVITQLVRTSLKPPTDYEFGVSDYSAIEARVVAWFAGESWVLKA 415

Query: 402 FANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQ 461
           F +GEDIYV T +K ++   +  ++  R  GK   LALGYQGGA     M          
Sbjct: 416 FEDGEDIYVATASKMYHVTGE-EAEAMRQKGKQATLALGYQGGANALIVMG--------- 465

Query: 462 FSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLW 521
                                          A++  +       + + WR  +  ++ LW
Sbjct: 466 -------------------------------ALRAGIPEEELPELVQLWRKANPNIVNLW 494

Query: 522 KDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK---GDCS 578
             + +     +  GG+           +  +  +  + + LPS R+L Y D K      S
Sbjct: 495 HTVDKAARMAINNGGAKRYVLADGKLVISYKGDEHVLQVQLPSGRKLNYFDCKIRDNKIS 554

Query: 579 YLNTATSQLMR--ERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
           YL        R    TYGGKLTEN+VQA SRD+L   +      G   V  VHDE ++  
Sbjct: 555 YLKGVRGDGSRFYADTYGGKLTENLVQATSRDLLLAALMRIEAAGIQTVFHVHDETINIV 614

Query: 637 PDTPYFSVGTLCSLMTK-NPSWAKGLPLKAEGYEAKRYRK 675
           P+     +  + +LMT   P WA GLPL +EG   K YRK
Sbjct: 615 PEGT--KIEEINNLMTSPAPEWADGLPLDSEGDVIKYYRK 652


>gi|146280510|ref|YP_001170663.1| DNA polymerase I [Pseudomonas stutzeri A1501]
 gi|145568715|gb|ABP77821.1| DNA polymerase I [Pseudomonas stutzeri A1501]
          Length = 931

 Score =  411 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 104/708 (14%), Positives = 199/708 (28%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S            A++A +   ++A +                       A+
Sbjct: 354 FAFDTETTSLD----------AQRAELVGVSFAVEPGQAAYVPLRHSYMGVPQQLELDAV 403

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
            S L   L D     +  +  ++  +     GI++    +  T + +           + 
Sbjct: 404 LSALKPLLEDPAKTKICQHGKYDMNVLM-HYGIEMRGMAF-DTMLESYVLDATATRHDMD 461

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                         A +  G Y   D + 
Sbjct: 462 SLALKYLGRGTIRFEDIAGKGAKQL---------------TFDQIAIEQAGPYAAEDADV 506

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L+   +            E  L  +   I   G  +D  L+ +    +  +  
Sbjct: 507 TLRLHQTLLGKLEQTPSLLKVLTEIEMPLVPVLARIERNGALVDAQLLGQQSVELGDKLV 566

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNI-TQL 273
           +L+ +   +      +      L   L+   G  ++  +      T +S+L+        
Sbjct: 567 QLEREAFDIAGEEF-NLGSPKQLCAILYDKLGCPVISKTAGGQPSTAESVLAELAEQDYP 625

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +I+   + S       + L + ++   GR+  +      + TGR S      QN+P 
Sbjct: 626 LPKVIMQHRSLSKLKGTYTDKLPQQINPRTGRIHTSYHQAV-TATGRLSSSDPNLQNIP- 683

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   +A+ G KL+ AD + IE R++A +
Sbjct: 684 -----------------------IRTAEGRRIRQAFVAAPGYKLLAADYSQIELRIMAHL 720

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           A +   + AF N  D++  T A+ F  P+++VS +QR   K +                 
Sbjct: 721 AQDAGLLHAFQNDLDVHRATAAEVFGVPLEQVSNDQRRSAKAINF--------------G 766

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   A +  +     +     + A
Sbjct: 767 LIYGMS------------------------------AFGLAKQIDVGRKEAQEYIDRYFA 796

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++ GVL   +      A                              +     RRL   +
Sbjct: 797 RYPGVLAYMERTRTQAAEQGY--------------------------VETLFGRRLYLPE 830

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVL 626
           +      +        R            +Q  + DI+   M               ++L
Sbjct: 831 INSKNGAMR---KGAERTAINAP------MQGTAADIIKRAMIAVDGWLQDSGLDARVIL 881

Query: 627 TVHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  +     V   +C LM+        +PL  E      +
Sbjct: 882 QVHDELVLEVREDLVEQVREAICPLMSGAAQ--LDVPLLVEAGVGNNW 927


>gi|226942232|ref|YP_002797305.1| DNA polymerase I [Azotobacter vinelandii DJ]
 gi|226717159|gb|ACO76330.1| DNA polymerase I [Azotobacter vinelandii DJ]
          Length = 908

 Score =  411 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 104/708 (14%), Positives = 200/708 (28%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
           +  D ET S            A+QA +   ++A                       + A+
Sbjct: 331 IAFDSETTSLD----------AQQAELVGLSFAVAPLEAAYIPLAHSYMGVPDQLDRDAV 380

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
            + L   L D     V  ++ ++  +     GI++    +  T + +           + 
Sbjct: 381 LAALRPILEDPARAKVGQHAKYDMNVLA-HYGIEVRGVAY-DTMLESYVLDSTATRHDMD 438

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                         A +  G Y   D + 
Sbjct: 439 SLALKYLGQGTIRFEDIAGKGAKQL---------------TFDQIALEQAGPYAAEDADV 483

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L    +            E  L  +   I   G  +D  L+ +    + ++ +
Sbjct: 484 TLRLHQCLWQKLEAIPALAKVLKEIEMPLVPVLARIERHGALVDAKLLGEQSLELGEKLQ 543

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNIT-QL 273
           +L+ +  +L      +      L   L+   G+ ++  +      T +S+L+        
Sbjct: 544 QLEREAHELAGEPF-NLASPKQLGAILYDKLGLPVLSKTAKGQPSTAESVLADLAEQGYP 602

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +I+   + +       + L + ++   GR+  +      + TGR S      QN+P 
Sbjct: 603 LPQVIMRHRSLNKLKGTYTDKLPQQINPRTGRIHTSYHQAV-TATGRLSSSDPNLQNIP- 660

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   +A  G +LV AD + IE R++A +
Sbjct: 661 -----------------------IRTTEGRRIRQAFVAPEGYRLVAADYSQIELRIMAHL 697

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           A +   + AF N  D++  T A+ F    + VS +QR   K +                 
Sbjct: 698 AQDTSLLHAFRNDLDVHRATAAEVFGVAPEAVSADQRRSAKAINF--------------G 743

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   A +  +     +     + A
Sbjct: 744 LIYGMS------------------------------AFGLARQIGVERKEAQAYIDRYFA 773

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++ GVL   +      A                              +     RRL   +
Sbjct: 774 RYPGVLAYMERTRAQAAEQGY--------------------------VETLFGRRLYLPE 807

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVL 626
           +      L        R            +Q  + DI+   M               ++L
Sbjct: 808 IHSKNGALR---KAAERTAINAP------MQGSAADIIKRAMVTVDAWLLESGLDARMIL 858

Query: 627 TVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  +    ++   L   M+     A  +PL  E      +
Sbjct: 859 QVHDELVLEVREDQVEALKAGLLPRMSGAA--ALDVPLLVEAGVGGNW 904


>gi|327250490|gb|EGE62198.1| DNA polymerase I domain protein [Escherichia coli STEC_7v]
          Length = 605

 Score =  411 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 29  FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 78

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 79  LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 136

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 137 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 181

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 182 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 241

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 242 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 300

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 301 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 357

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 358 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 395

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 396 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 441

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 442 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 471

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 472 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 505

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 506 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 556

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 557 VHDELVFEVHKDDLEAVAKKIHQLMENCTR--LDVPLLVEVGSGENW 601


>gi|313111566|ref|ZP_07797365.1| DNA polymerase I [Pseudomonas aeruginosa 39016]
 gi|310883867|gb|EFQ42461.1| DNA polymerase I [Pseudomonas aeruginosa 39016]
          Length = 913

 Score =  411 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 105/709 (14%), Positives = 199/709 (28%), Gaps = 172/709 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
           +  D ET S            A+QA +   ++A  +                    + A+
Sbjct: 334 IAFDTETTSID----------AQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAV 383

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKT-LGIDIPSKRWICTSVLARTNGLP---SSL 109
              L   L D   + V  ++ ++  +       I +    +  T + +           +
Sbjct: 384 LRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAY-DTMLESYVLDSTATRHDM 442

Query: 110 KNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L  S    +   GK                         A +  G Y   D +
Sbjct: 443 DSLALKYLGHSTIRFEDIAGKGAKQL---------------TFDQIAIEQAGPYAAEDAD 487

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T  L + L    +            E  L  +   I   G  +D +L+      + ++ 
Sbjct: 488 VTLRLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKM 547

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNI-TQ 272
             L+     L      +      L   L+   G+ ++  +      T +++L+       
Sbjct: 548 VALERQAYDLAGQEF-NLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDF 606

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               +I+   + S       + L E ++   GR+  +     A  TGR S      QN+P
Sbjct: 607 ELPKVIMQYRSMSKLKSTYTDRLPEQINLRTGRIHTSYHQAVA-ATGRLSSSDPNLQNIP 665

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   +A  G KL+ AD + IE R++A 
Sbjct: 666 ------------------------IRTAEGRRIRQAFVAPQGYKLLAADYSQIELRIMAH 701

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           +A +D  + AF +  D++  T A+ F  P++ V+ +QR   K +                
Sbjct: 702 LAKDDGLLDAFRHDLDVHRATAAEVFGVPLEDVNGDQRRSAKAINF-------------- 747

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
               G+                                   A +  +     +     + 
Sbjct: 748 GLIYGMS------------------------------AFGLAKQIGVERKEAQAYIDRYF 777

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
           A++ GVL   +      A                              +     RRL   
Sbjct: 778 ARYPGVLAYMERTRAQAAEQG--------------------------FVETLFGRRLYLP 811

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIV 625
           ++      +        R            +Q  + DI+   M               ++
Sbjct: 812 EIHSKNGAMR---KAAERTAINAP------MQGTAADIMKRAMVAVDNWLQESGLDARVI 862

Query: 626 LTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           L VHDE+V E  +     V   +  LM+   +    +PL  E      +
Sbjct: 863 LQVHDELVLEVREDLVEQVCEGIRPLMSGAAT--LDVPLVVEAGVGSNW 909


>gi|89074464|ref|ZP_01160941.1| DNA polymerase I [Photobacterium sp. SKA34]
 gi|89049752|gb|EAR55302.1| DNA polymerase I [Photobacterium sp. SKA34]
          Length = 923

 Score =  411 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 100/708 (14%), Positives = 198/708 (27%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET     +           A +   ++A ++                       +
Sbjct: 346 FAFDTETDGLDYMT----------ANVVGVSFAIEEGKAAYVPLAHDYLDAPAQLDRDWV 395

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L D     +  N  F+  +  +  GI++       T + +           + 
Sbjct: 396 LEQLKPLLEDPKQAKIGQNLKFDASIVARY-GIEMQGI-VFDTMLESYVFNSVVGRHDMD 453

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +    +  G Y   D + 
Sbjct: 454 SLALRYLEHKNISFEEVAGKGKKQL---------------TFNQIDLEQAGPYAAEDADI 498

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L   L P  +            E  L  +   +   G  +D  L+      IA    
Sbjct: 499 TLRLHNTLYPKVEADDKLKHVFENIEMPLVPVLSRMERTGVYVDSMLLGAQSTEIAVRLD 558

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
           ++++   ++ +    +      L+  LF   G+         +  T + +L    +    
Sbjct: 559 EIEKKAFEIAEQEF-NLSSPKQLQAILFEKMGLPVLKKTPSGTPSTNEEVLQELALDYPL 617

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             L+L     +       + L + V+   GR+  +      + TGR S      QN+P  
Sbjct: 618 PKLLLEYRGLAKLKSTYTDKLPKMVNPATGRVHTSYHQAV-TATGRLSSSDPNLQNIP-- 674

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   +A +G K++  D + IE R++A ++
Sbjct: 675 ----------------------VRNEEGRRIRQAFVAQSGYKILAVDYSQIELRIMAHLS 712

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
           G+   + AF +G+DI+  T A+  +  I+ VS EQR   K +                  
Sbjct: 713 GDKALLDAFRHGKDIHAATAAEILSLDIENVSSEQRRRAKAINF--------------GL 758

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 759 IYGMS------------------------------AFGLAKQLDMGRNEAQNYMNVYFER 788

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +      +                              +     RRL   D+
Sbjct: 789 YPGVLEYMESTRNAASEQGY--------------------------VETLFGRRLYLPDI 822

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT-------KNGYDIVL 626
           K              R            +Q  + DI+   M           +    +++
Sbjct: 823 KSRNGLRR---KAAERAAINAP------MQGTAADIIKLAMIAVDDWVQQQPEGDVRLLM 873

Query: 627 TVHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  ++   +V  ++ +LM +       +PL A+      +
Sbjct: 874 QVHDELVFEVKESALEAVTASVKALMEQAA--MLDVPLIADTGYGDNW 919


>gi|313647099|gb|EFS11554.1| DNA polymerase I domain protein [Shigella flexneri 2a str. 2457T]
          Length = 605

 Score =  411 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 29  FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISHERA 78

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 79  LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 136

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 137 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 181

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 182 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 241

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 242 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 300

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 301 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 357

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 358 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 395

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 396 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 441

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 442 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 471

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +        +                            +     RRL   D+
Sbjct: 472 YPGVLEYMERTRAQAKELGY--------------------------VETLDGRRLYLPDI 505

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 506 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 556

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 557 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 601


>gi|327478747|gb|AEA82057.1| DNA polymerase I [Pseudomonas stutzeri DSM 4166]
          Length = 914

 Score =  411 bits (1056), Expect = e-112,   Method: Composition-based stats.
 Identities = 103/708 (14%), Positives = 198/708 (27%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S            A++A +   ++A +                       A+
Sbjct: 337 FAFDTETTSLD----------AQRAELVGVSFAVEPGQAAYVPLRHSYMGVPQQLELDAV 386

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
              L   L D     +  +  ++  +     GI++    +  T + +           + 
Sbjct: 387 LGALKPLLEDPAKTKICQHGKYDMNVLM-HYGIEMRGMAF-DTMLESYVLDATATRHDMD 444

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                         A +  G Y   D + 
Sbjct: 445 SLALKYLGRGTIRFEDIAGKGAKQL---------------TFDQIAIEQAGPYAAEDADV 489

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L+   +            E  L  +   I   G  +D  L+ +    +  +  
Sbjct: 490 TLRLHQTLLGKLEQTPSLLKVLTEIEMPLVPVLARIERNGALVDAQLLGQQSVELGDKLV 549

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNI-TQL 273
           +L+ +   +      +      L   L+   G  ++  +      T +S+L+        
Sbjct: 550 QLEREAFDIAGEEF-NLGSPKQLCAILYDKLGCPVISKTAGGQPSTAESVLAELAEQDYP 608

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +I+   + S       + L + ++   GR+  +      + TGR S      QN+P 
Sbjct: 609 LPKVIMQHRSLSKLKGTYTDKLPQQINPRTGRIHTSYHQAV-TATGRLSSSDPNLQNIP- 666

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   +A+ G KL+ AD + IE R++A +
Sbjct: 667 -----------------------IRTAEGRRIRQAFVAAPGYKLLAADYSQIELRIMAHL 703

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           A +   + AF N  D++  T A+ F  P+++VS +QR   K +                 
Sbjct: 704 AQDAGLLHAFQNDLDVHRATAAEVFGVPLEQVSNDQRRSAKAINF--------------G 749

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   A +  +     +     + A
Sbjct: 750 LIYGMS------------------------------AFGLAKQIDVGRKEAQEYIDRYFA 779

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++ GVL   +      A                              +     RRL   +
Sbjct: 780 RYPGVLAYMERTRTQAAEQGY--------------------------VETLFGRRLYLPE 813

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVL 626
           +      +        R            +Q  + DI+   M               ++L
Sbjct: 814 INSKNGAMR---KGAERTAINAP------MQGTAADIIKRAMIAVDGWLQDSGLDARVIL 864

Query: 627 TVHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  +     V   +C LM+        +PL  E      +
Sbjct: 865 QVHDELVLEVREDLVEQVREAICPLMSGAAQ--LDVPLLVEAGVGNSW 910


>gi|253998100|ref|YP_003050163.1| DNA polymerase I [Methylovorus sp. SIP3-4]
 gi|253984779|gb|ACT49636.1| DNA polymerase I [Methylovorus sp. SIP3-4]
          Length = 918

 Score =  411 bits (1056), Expect = e-112,   Method: Composition-based stats.
 Identities = 111/700 (15%), Positives = 191/700 (27%), Gaps = 158/700 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSA----------M 53
           +  D ET S  PL           A +   +++           T               
Sbjct: 343 VCFDTETTSLDPLT----------AKLVGMSFSIKAGEAAYLPLTHDYPGAPDQLPFAAT 392

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSLKN 111
            + +   L +  +  V  N  +++ +     GI +       T + +          + +
Sbjct: 393 LARIKPLLENPAIKKVGQNLKYDKHVLANH-GIALNGIA-HDTLLQSYVLESHRTHGMDD 450

Query: 112 AC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEAT 170
                L       +   GK                    +    A +   EY   D + T
Sbjct: 451 LAMRHLGVQTITYEQVAGKGAKQ---------------VSFSQVALEQASEYAAEDADVT 495

Query: 171 RELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKK 219
            +L + L P               E  +  +  TI   G  ID D++ +    I Q+   
Sbjct: 496 LQLHENLYPQVAEDAKLEFVYRQIEMPVLDILFTIERNGVLIDNDMLNRQSHEIGQKLMA 555

Query: 220 LDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLAK 275
           L++   +L      +      L+  LF   GI         +  T + +L    +     
Sbjct: 556 LEQQAYELAGQPF-NLGSPKQLQEILFGKLGIKPLKKTPSGTPSTDEDVLQELALDYPLP 614

Query: 276 DLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
            ++L     +       + L   ++   GR+  +     A  TGR S      QN+P   
Sbjct: 615 KVLLEYRGLAKLKSTYTDKLPRMINPTTGRVHTSYSQAVA-VTGRLSSSDPNLQNIP--- 670

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   +A  G  +V AD + IE R++A ++ 
Sbjct: 671 ---------------------VRTAEGRRIREAFVAPAGGHIVSADYSQIELRIMAHLSQ 709

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +D  + AFA GEDI+  T A+ F    D VS EQR   KV+   L Y             
Sbjct: 710 DDGLLTAFAAGEDIHRATAAEIFGVERDAVSSEQRRYAKVINFGLIYGMS-----AFGLA 764

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
             L +++ +        F  +     +    +++       +   G    +         
Sbjct: 765 QNLGIERQAAQNYIERYFTRYPGVRDYMQNTRERAKAQGYVETFFGRRLWV--------- 815

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
             +         G                                               
Sbjct: 816 PEINSPNGMRRAGAERAAINAPMQGT---------------------------------- 841

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                                KL    VQ             + K    +++ VHDE+V 
Sbjct: 842 ----------------AADLIKLAMIAVQG---------WLESEKLATKLIMQVHDELVL 876

Query: 635 ETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           E PD     V   L  LM         +PL AE      +
Sbjct: 877 EVPDNELALVKEKLPQLMQDVAK--LDVPLLAEVGVGSNW 914


>gi|73540576|ref|YP_295096.1| DNA polymerase I [Ralstonia eutropha JMP134]
 gi|72117989|gb|AAZ60252.1| DNA polymerase I [Ralstonia eutropha JMP134]
          Length = 941

 Score =  411 bits (1056), Expect = e-112,   Method: Composition-based stats.
 Identities = 107/704 (15%), Positives = 193/704 (27%), Gaps = 163/704 (23%)

Query: 5   FIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ-------------- 50
            ID ET S  P+           A +   + + +           +              
Sbjct: 362 AIDTETTSLDPML----------AQLVGISLSVEPGEACYIPVGHRGPDVAGMENNGQLS 411

Query: 51  -SAMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--S 107
              + + +  +L D++   +  N  ++  +F    G+ +       T + +         
Sbjct: 412 RDTVLARMRAWLEDDSKPKLGQNIKYDIHVFANH-GVTLCGVA-QDTMLESYVLASHRNH 469

Query: 108 SLKNACLAL-NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRD 166
            + +    L N      +   GK                               EY   D
Sbjct: 470 GMDSLAERLLNLKTITYEEVCGKGASQIG---------------FDQIDLARATEYAAED 514

Query: 167 VEATRELFKRLIP-----------LSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQ 215
            + T  L +++ P             + E  + ++ Q I   G  ID + +      + Q
Sbjct: 515 ADVTLRLHRKMFPQVSAAAGLRRVYEEIEIPVSVVLQKIERNGVLIDAERLAAQSAELGQ 574

Query: 216 ERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNIT 271
               L++           +      +   LF    + +V  +      T + +L      
Sbjct: 575 RMLSLEQAAYDAAGQPF-NLGSPKQIGEILFNQMKLPVVKKTASGAPSTDEEVLQKLAED 633

Query: 272 QLAKDLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNL 330
                L+L+    +       + L + V+ + GR+  +     A  TGR +      QN+
Sbjct: 634 YPLPKLLLDYRGLAKLKSTYTDKLPKMVNPNTGRVHTSYGQATA-VTGRLASTEPNLQNI 692

Query: 331 PRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
           P                                +R   IAS G  +V AD + IE R++A
Sbjct: 693 P------------------------VRTEEGRRIREAFIASPGSVIVSADYSQIELRIMA 728

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKT 450
            I+G++  ++AFANGEDI+  T ++ F    + VS EQR   KV+   L Y         
Sbjct: 729 HISGDENLLRAFANGEDIHRATASEIFGVDREAVSSEQRRYAKVINFGLIYGMS-----A 783

Query: 451 MASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
                 L +++ +        F  +     +    +    E    + + G    L     
Sbjct: 784 FGLASNLGIEREAAKHYIDRYFMRYPGVAQYMEDTRQTAREQGYVETVFGRRLWL----- 838

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
                 +        +                                            
Sbjct: 839 ----PDINGGSGPRRQAAERAAINAPMQGT------------------------------ 864

Query: 571 SDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHD 630
                                    KL+   VQ               K     ++ VHD
Sbjct: 865 --------------------AADLIKLSMIAVQG---------WLERDKLQTRQIMQVHD 895

Query: 631 EIVSETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           E+V E P      V   L  LM         +PL AE      +
Sbjct: 896 ELVLEVPQDELDVVKTRLPELMCSVAQ--LRVPLVAEVGSGANW 937


>gi|89092190|ref|ZP_01165144.1| DNA polymerase I [Oceanospirillum sp. MED92]
 gi|89083278|gb|EAR62496.1| DNA polymerase I [Oceanospirillum sp. MED92]
          Length = 922

 Score =  411 bits (1056), Expect = e-112,   Method: Composition-based stats.
 Identities = 103/707 (14%), Positives = 191/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +          +A +   ++A +                        +
Sbjct: 346 FAFDTETTSLNYM----------EAELVGVSFAIEPGKAAYVPVAHDYMGAPEQITRETL 395

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
              +   L       V  +  ++  +  +  GI++    +  T + +           + 
Sbjct: 396 LEKMKPLLESSDHKKVGQHLKYDMNVLARY-GIELTGIEF-DTMLESYVLNSTATRHDMD 453

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +    +    Y   D + 
Sbjct: 454 SLADRYLGLKTIKFEDIAGKGKKQL---------------TFNQIELEQAAPYAAEDADI 498

Query: 170 TRELFKRLIPLS-----------DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + +               D ER L  +   I   G  +D  ++ +    +A+   
Sbjct: 499 TLRLHQAINAQLSKDETLTSVFNDIERPLIPVLSHIERNGALVDASMLGEQSIELAERMV 558

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
           +L+     +      +      L+  LF    I         +  T + +L    +    
Sbjct: 559 ELERQAYDIAGKEF-NLASPKQLQQILFEELSIPVIKKTPKGAPSTAEEVLQELALDYPL 617

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             LIL   + S       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 618 PKLILEHRSLSKLKSTYTDKLPLMINPGTGRIHTSYHQAV-TATGRLSSTDPNLQNIP-- 674

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA  G K+V AD + IE R++A ++
Sbjct: 675 ----------------------VRTQEGRRIRHAFIAPEGYKVVAADYSQIELRIMAHLS 712

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AF+ G DI+  T A+ F   +D+VS +QR   K +                  
Sbjct: 713 QDQGLLDAFSKGADIHRATAAEVFKVELDQVSDDQRRSAKAINF--------------GL 758

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +         + +   
Sbjct: 759 IYGMS------------------------------AFGLAKQLGIARKDAAQYIEHYFET 788

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GV     D+                                   +     RRL   ++
Sbjct: 789 YPGVQHYMDDIRAKAQEQGY--------------------------VETLFGRRLYLPEI 822

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN------GYDIVLT 627
           K   +    A     R            +Q  + DI+   M    K          +++ 
Sbjct: 823 KARNAMRRQAA---ERTAINAP------MQGTAADIIKRAMVTVDKWLAESDFDVRMIMQ 873

Query: 628 VHDEIVSETPDTPYFS-VGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E  DT   S V  +   M         +PL  E    + +
Sbjct: 874 VHDELVFEVRDTQVDSFVEAVKDKMATAAD--LDVPLLVEAGVGENW 918


>gi|313200166|ref|YP_004038824.1| DNA polymerase i [Methylovorus sp. MP688]
 gi|312439482|gb|ADQ83588.1| DNA polymerase I [Methylovorus sp. MP688]
          Length = 918

 Score =  411 bits (1056), Expect = e-112,   Method: Composition-based stats.
 Identities = 111/700 (15%), Positives = 191/700 (27%), Gaps = 158/700 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSA----------M 53
           +  D ET S  PL           A +   +++           T               
Sbjct: 343 VCFDTETTSLDPLT----------AKLVGMSFSIKAGEAAYLPLTHDYPGAPDQLPFAAT 392

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSLKN 111
            + +   L +  +  V  N  +++ +     GI +       T + +          + +
Sbjct: 393 LARIKPLLENPAIKKVGQNLKYDKHVLANH-GIVLNGIA-HDTLLQSYVLESHRTHGMDD 450

Query: 112 AC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEAT 170
                L       +   GK                    +    A +   EY   D + T
Sbjct: 451 LAMRHLGVQTITYEQVAGKGAKQ---------------VSFSQVALEQASEYAAEDADVT 495

Query: 171 RELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKK 219
            +L + L P               E  +  +  TI   G  ID D++ +    I Q+   
Sbjct: 496 LQLHENLYPQVAEDAKLEFVYRQIEMPVLDILFTIERNGVLIDNDMLNRQSHEIGQKLMA 555

Query: 220 LDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLAK 275
           L++   +L      +      L+  LF   GI         +  T + +L    +     
Sbjct: 556 LEQQAYELAGQPF-NLGSPKQLQEILFGKLGIKPLKKTPSGTPSTDEDVLQELALDYPLP 614

Query: 276 DLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
            ++L     +       + L   ++   GR+  +     A  TGR S      QN+P   
Sbjct: 615 KVLLEYRGLAKLKSTYTDKLPRMINPTTGRVHTSYSQAVA-VTGRLSSSDPNLQNIP--- 670

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   +A  G  +V AD + IE R++A ++ 
Sbjct: 671 ---------------------VRTAEGRRIREAFVAPAGGHIVSADYSQIELRIMAHLSQ 709

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +D  + AFA GEDI+  T A+ F    D VS EQR   KV+   L Y             
Sbjct: 710 DDGLLTAFAAGEDIHRATAAEIFGVERDAVSSEQRRYAKVINFGLIYGMS-----AFGLA 764

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
             L +++ +        F  +     +    +++       +   G    +         
Sbjct: 765 QNLGIERQAAQNYIERYFTRYPGVRDYMQNTRERAKAQGYVETFFGRRLWV--------- 815

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
             +         G                                               
Sbjct: 816 PEINSPNGMRRAGAERAAINAPMQGT---------------------------------- 841

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                                KL    VQ             + K    +++ VHDE+V 
Sbjct: 842 ----------------AADLIKLAMIAVQG---------WLESEKLATKLIMQVHDELVL 876

Query: 635 ETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           E PD     V   L  LM         +PL AE      +
Sbjct: 877 EVPDNELALVKEKLPQLMQDVAK--LDVPLLAEVGVGSNW 914


>gi|53803295|ref|YP_114980.1| DNA polymerase I [Methylococcus capsulatus str. Bath]
 gi|53757056|gb|AAU91347.1| DNA polymerase I [Methylococcus capsulatus str. Bath]
          Length = 906

 Score =  411 bits (1056), Expect = e-112,   Method: Composition-based stats.
 Identities = 99/707 (14%), Positives = 191/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSA----------M 53
              D ET S   +           A +   ++A +                        +
Sbjct: 330 FAFDTETSSLDYMR----------AEVIGLSFAVEPGAAAYVPLAHDYPGAPPQLDRAMV 379

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
              L   L D     +  +  ++  +     GI +   R   T + +           + 
Sbjct: 380 LERLRPLLEDPGKAKLGQHLKYDANVLLNH-GIMLRGIR-HDTMLESYVLNSTATRHDMD 437

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L+      +   GK                         + +    Y   D + 
Sbjct: 438 SLAERYLDRKTLHYEDVAGKGAKQ---------------IPFARVSVEDACRYAAEDADV 482

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P  +            E  L  +   I   G  +D+  + +    + +   
Sbjct: 483 TLCLHRALWPRLESIPSLRAVYETIEIPLVPVLSRIERAGVLVDVYKLAEQSRELERRMA 542

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
           +++ +   +  G   +      ++  L+   G+            T +S+L     T   
Sbjct: 543 EVEAEARAVA-GETFNLGSPKQIQTILYDKLGLPVIKKTPTGQPSTDESVLQDLAETFEL 601

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             LIL   + S       + L   V+   GR+  +     A  TGR S      QN+P  
Sbjct: 602 PRLILEYRSLSKLKSTYTDKLPHQVNPVSGRVHTSYHQAVA-ATGRLSSSDPNLQNIP-- 658

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   +A  G KL+ AD + IE R++A ++
Sbjct: 659 ----------------------VRTEEGRRIRQAFVAPPGHKLLAADYSQIELRIMAHLS 696

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
           G+   + AFA   D++  T A+ F   +++V+  QR   K +                  
Sbjct: 697 GDANLLAAFAEDADVHRATAAEVFGVALEEVTSSQRRSAKAIN--------------FGL 742

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     + A+
Sbjct: 743 IYGMS------------------------------AFGLAKQLGIQQKLAQGYIDLYFAR 772

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GV        E    +                            +     RRL   D+
Sbjct: 773 YPGVRAYMDRTRESARELGY--------------------------VETLFGRRLHVPDI 806

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           +              R            +Q  + DI+   M               +++ 
Sbjct: 807 QSRNGQRRQYA---ERTAINAP------MQGTAADIIKRAMIALDAWIESSGAPLRMIMQ 857

Query: 628 VHDEIVSETPDTPY-FSVGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E  +     +  T+   M++    A  +PL  +      +
Sbjct: 858 VHDELVFEVAEDFVSEATATVREHMSRAAELA--VPLMVDIGTGDNW 902


>gi|332088561|gb|EGI93675.1| DNA polymerase I domain protein [Shigella boydii 3594-74]
          Length = 605

 Score =  411 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 29  FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 78

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 79  LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMD 136

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 137 SLAERWLKHKTITFEEIAGKGKNPL---------------TFNQIALEEAGRYAAEDADV 181

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 182 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 241

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 242 ELEKKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 300

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 301 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 357

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 358 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 395

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 396 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 441

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 442 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 471

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 472 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDI 505

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 506 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 556

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 557 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 601


>gi|296105444|ref|YP_003615590.1| DNA polymerase I [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295059903|gb|ADF64641.1| DNA polymerase I [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 930

 Score =  411 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 200/707 (28%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                        +
Sbjct: 354 FAFDTETDSLDNIT----------ANMVGLSFATEPGIAAYVPVAHDYLDAPEQLSRERV 403

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L D+  + V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 404 LELLKPILEDDNALKVGQNLKYDRGILQNY-GIELRGIAF-DTMLESYILDSVAGRHDMD 461

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 462 SLSDRWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 506

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++      +AQ   
Sbjct: 507 TLQLHLKMWPKLQKHEGPLNVFQNIEMPLVPVLSRIERNGVKIDPTVLHNHSGELAQRLT 566

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   +L      +      L+  LF   GI  +  +      T + +L    +    
Sbjct: 567 ELEQKAHELAGEPF-NLSSPKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 625

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +     A  TGR S      QN+P  
Sbjct: 626 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVA-ATGRLSSTDPNLQNIP-- 682

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA +   +V AD + IE R++A ++
Sbjct: 683 ----------------------VRNEEGRRIRQAFIAPDDYLIVSADYSQIELRIMAHLS 720

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 721 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTNEQRRSAKAINF--------------GL 766

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 767 IYGMS------------------------------AFGLSRQLNIPRKESQKYMDLYFER 796

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 797 YPGVLEYMERTRAQAKEKGY--------------------------VETLDGRRLYLPDI 830

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT------KNGYDIVLT 627
           K   +       +               +Q  + DI+   M          K    +++ 
Sbjct: 831 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLEKEKPRVKMIMQ 881

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       SV   +  LM  +      +PL  E    + +
Sbjct: 882 VHDELVFEVHKDDLDSVSKTIHELMENSMK--LDVPLLVEVGSGENW 926


>gi|82778962|ref|YP_405311.1| DNA polymerase I [Shigella dysenteriae Sd197]
 gi|309783771|ref|ZP_07678417.1| DNA polymerase I [Shigella dysenteriae 1617]
 gi|81243110|gb|ABB63820.1| PolA [Shigella dysenteriae Sd197]
 gi|308928354|gb|EFP73815.1| DNA polymerase I [Shigella dysenteriae 1617]
          Length = 928

 Score =  410 bits (1054), Expect = e-112,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 195/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTRLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLAERWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++    E +     
Sbjct: 505 TLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L+    ++      +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELERKAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLARQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL  SD+
Sbjct: 795 YPGVLEYMERTRAQAKEQGY--------------------------VETLDGRRLYLSDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K        A  +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNGARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 924


>gi|300113291|ref|YP_003759866.1| DNA polymerase I [Nitrosococcus watsonii C-113]
 gi|299539228|gb|ADJ27545.1| DNA polymerase I [Nitrosococcus watsonii C-113]
          Length = 901

 Score =  410 bits (1054), Expect = e-112,   Method: Composition-based stats.
 Identities = 107/698 (15%), Positives = 206/698 (29%), Gaps = 153/698 (21%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
              D+ET S   +          +A I   ++A                       +  +
Sbjct: 325 FAFDLETNSLDYM----------EAEIVGLSFAIQPHEAMYIPLGHEDATAPPQLPREQV 374

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
            + L   L D     V  N  F+R +     GI++       + + +          ++ 
Sbjct: 375 LARLKPLLEDPRHGKVGQNLKFDRNVLANY-GIELQGIH-HDSMLESYVLDSTATRHNMD 432

Query: 111 NAC-LALNFSEHLTKMEEGKALIA--RFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           +     L  +    +M  GK              + PY    A+       +     +  
Sbjct: 433 SLALKYLQRTTITYEMVAGKGSKQLPFNQVTIEKAAPYAAEDADISLQLHRYFWPRIQQE 492

Query: 168 EATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
           E+ R L++ L      E  L  +   +   G ++D   +    + +A   KKL+++   L
Sbjct: 493 ESLRRLYQEL------EIPLIPVLSRMERNGVQVDTTQLKTQSDELAARLKKLEQEAFDL 546

Query: 228 TDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLAKDLILNRLA 283
             G   +      ++  L+    +            T +++L    +       +L    
Sbjct: 547 A-GESFNLASPKQIQAILYEKLKLPVTRKTPTGQPSTAETVLQELALDYPLPQRLLQYRT 605

Query: 284 SSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQ 342
            S       + L   V+   GR+  +      + TGR S      QN+P           
Sbjct: 606 LSKLKSTYTDRLPLQVNPHTGRVHTSYHQAV-TATGRLSSSDPNLQNIP----------- 653

Query: 343 TIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAF 402
                                +R   IA  G +LV AD + IE R++A ++ ++  + AF
Sbjct: 654 -------------IRTAEGRRIRQTFIAPPGYRLVAADYSQIELRIMAHLSEDEGLLAAF 700

Query: 403 ANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQF 462
              EDI+  T  + F TP+++V+ EQR   K +                    G+     
Sbjct: 701 EAEEDIHQRTATEVFRTPLEEVTPEQRRSAKAINF--------------GLIYGMS---- 742

Query: 463 SQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWK 522
                                           +  +  TA +   + +  ++ GV     
Sbjct: 743 --------------------------AHGLGRQLGINRTAAQHYIERYFQRYPGVKAYMD 776

Query: 523 DLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNT 582
           ++ +                                 +     RRL   D+    +    
Sbjct: 777 NICQQARQKGY--------------------------VETLFGRRLYLPDIHSRQT---Q 807

Query: 583 ATSQLMRERTYGGKLTENIVQAISRDILCEGMKN----ATKN--GYDIVLTVHDEIVSET 636
             +Q  R            +Q  + DI+   M +      KN     +++ VHDE+V E 
Sbjct: 808 RRNQAERTAINAP------MQGSAADIIKRAMIHTDGWLQKNSDNARMIMQVHDELVFEV 861

Query: 637 PDTPYF-SVGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            +     ++  +   MT        +PL  E      +
Sbjct: 862 AEDKLEITMRAIRENMTAAAQ--LKIPLIVEIGSGANW 897


>gi|224823577|ref|ZP_03696686.1| DNA polymerase I [Lutiella nitroferrum 2002]
 gi|224604032|gb|EEG10206.1| DNA polymerase I [Lutiella nitroferrum 2002]
          Length = 887

 Score =  410 bits (1053), Expect = e-112,   Method: Composition-based stats.
 Identities = 107/706 (15%), Positives = 198/706 (28%), Gaps = 170/706 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE-----QSAM----- 53
           + +D ET S   +          +A +   +++  +                  +     
Sbjct: 312 VSLDTETTSLDQM----------EARLVGISFSVTEGEAAYLPLAHHYAGVPEQLDLAAT 361

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNG--LPSSLKN 111
            + L  +L +     +  N  ++R +     GI +       T + +      L  ++ +
Sbjct: 362 LARLKPWLENPARKKLGQNLKYDRHVLANH-GIALAGVA-DDTLLASYVIESHLTHNMDD 419

Query: 112 ACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEAT 170
                L  S    +   GK                            +   Y   D + T
Sbjct: 420 LARRHLGESTVSYEEICGKGAKQIG---------------FAEVDIAVASNYAAEDADIT 464

Query: 171 RELFKRLIPLSDG---------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
             L + L    +G         E  +  +   +   G  ID   + +    +  +  +L+
Sbjct: 465 LRLNRALAGKLEGRLASVYRDIELPVAEVLFAMERNGVLIDRQRLAEQSHQLGSQMLQLE 524

Query: 222 EDIVKLTDGIIRSSRQTYALRMYLFLITGI------DLVDMSEGTLKSILSHSNITQLAK 275
           ++  +       +      L+  LF   GI              T +S+L    +     
Sbjct: 525 QEAYQQAGQPF-NLNSPKQLQEILFGKLGIDTKGVKKTPSGGFSTDESVLEQLALDHPLP 583

Query: 276 DLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
            LIL     +       + L   +  D GR+        A  TGR S      QN+P   
Sbjct: 584 KLILQYRGLAKLKSTYTDKLPSLIRPDTGRVHTNYAQAVA-ITGRLSSSDPNLQNIP--- 639

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        VR   IA  G ++V AD + IE R++A ++ 
Sbjct: 640 ---------------------VRTAEGRRVREAFIAPPGHRIVSADYSQIELRIMAHLSD 678

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +   + AFA+GEDI+ TT A+ F    ++V+ EQR   K +   L               
Sbjct: 679 DANMLAAFASGEDIHKTTAAEVFGVTREQVTSEQRRAAKAINFGLI-------------- 724

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            G+     +  +                                   A +     +  + 
Sbjct: 725 YGMSAFGLAAQLDIE------------------------------RNAAQQYIDRYFMRF 754

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            GV    +   E                                       RRL   +++
Sbjct: 755 PGVADYMQRTREMAREQGYVETVF--------------------------GRRLYLPEIR 788

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLTV 628
                  +      R            +Q  + D++   M    +       G  +++ V
Sbjct: 789 ASNPGRRSGA---ERAAINAP------MQGTAADLIKLAMIAVQRWLVAEGLGSKLIMQV 839

Query: 629 HDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           HDE+V E P+     V   L  +M         +PL AE    + +
Sbjct: 840 HDELVLEVPEAELARVKERLPQIMAGVAE--LKVPLLAEVGAGESW 883


>gi|194290334|ref|YP_002006241.1| DNA polymerase I [Cupriavidus taiwanensis LMG 19424]
 gi|193224169|emb|CAQ70178.1| DNA polymerase A; 5'->3' exonuclease ; 3'->5' polymerase ; 3'->5'
           exonuclease [Cupriavidus taiwanensis LMG 19424]
          Length = 939

 Score =  410 bits (1053), Expect = e-112,   Method: Composition-based stats.
 Identities = 110/711 (15%), Positives = 194/711 (27%), Gaps = 175/711 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ------------- 50
           + ID ET S  P+          QA +   + +             +             
Sbjct: 359 VAIDTETTSLDPM----------QAQLVGISLSAAPGEACYIPVAHRGPDVAGLPEHGQL 408

Query: 51  --SAMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP-- 106
               +   +  +L D +   +  N  ++  +F    GI +       T + +        
Sbjct: 409 SREFVLERMRAWLEDASRPKLGQNLKYDIHVFANH-GIKLRGVA-HDTMLQSYVLASHRN 466

Query: 107 SSLKNACLAL-NFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKR 165
             + +    L +      +   GK                               EY   
Sbjct: 467 HGMDSLAERLLSLKTITYEEVCGKGASQIG---------------FDQIDLARATEYAAE 511

Query: 166 DVEATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIA 214
           D + T  L +R+ P  +            E  + ++ Q +   G  ID + +      + 
Sbjct: 512 DADVTLRLHRRMFPQVEAAAGLRRVYEEIEMPVSVVLQKVERNGVLIDAERLAAQSAELG 571

Query: 215 QERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNI 270
           Q    L++   +       +      +   LF    + +V  +      T + +L     
Sbjct: 572 QRMLALEQSAYEAAGQPF-NLGSPKQIGEILFNQMKLPVVKKTASGAPSTDEEVLQKLAE 630

Query: 271 TQLAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQN 329
                 L+L+    S       + L + V+   GR+  +     A  TGR +      QN
Sbjct: 631 DYPLPKLLLDYRGLSKLKSTYTDKLPKMVNPRTGRVHTSYGQATA-VTGRLASTEPNLQN 689

Query: 330 LPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVL 389
           +P                                +R   IA  G  +V AD + IE R++
Sbjct: 690 IP------------------------VRTDEGRRIREAFIAEPGSVIVSADYSQIELRIM 725

Query: 390 AWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFK 449
           A I+G++  ++AFANGEDI+  T A+ F    D VS EQ                     
Sbjct: 726 AHISGDENLLRAFANGEDIHRATAAEIFGVERDAVSSEQ--------------------- 764

Query: 450 TMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKA 509
                                    + +  +  L         A    +   A       
Sbjct: 765 -----------------------RRYAKVINFGLIYGMSAFGLASNLGIERDAARHYIDR 801

Query: 510 WRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLV 569
           +  ++ GV    ++  +                                       RRL 
Sbjct: 802 YFMRYPGVAHYMEETRQTAREQGYVETVF--------------------------GRRLW 835

Query: 570 YSDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYD 623
             D+ G       A     R            +Q  + D++   M               
Sbjct: 836 LPDINGGSGPRRQAA---ERAAINAP------MQGTAADLIKLSMIAVQDWLERDGLQTR 886

Query: 624 IVLTVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            ++ VHDE+V E P+     V   L  LM         +PL AE      +
Sbjct: 887 QIMQVHDELVLEVPEHELELVKARLPELMCTVAE--LRVPLVAEVGSGANW 935


>gi|197286655|ref|YP_002152527.1| DNA polymerase I [Proteus mirabilis HI4320]
 gi|194684142|emb|CAR45571.1| DNA polymerase I [Proteus mirabilis HI4320]
          Length = 932

 Score =  410 bits (1053), Expect = e-112,   Method: Composition-based stats.
 Identities = 109/707 (15%), Positives = 208/707 (29%), Gaps = 170/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                        +
Sbjct: 355 FAFDTETDSLNNI----------DARLIGLSFAVEPGKAAYIPLRHDYLDAPEQLPVDEV 404

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
            + L   L D+T++ +  N  F+R + +   GI++    +  T + +           + 
Sbjct: 405 LTALKPILEDKTILKIGQNLKFDRGIMEN-EGIELNGI-YFDTMLESYVLNSVSSRHDMD 462

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 LN      +   GK                      +    +    Y   D + 
Sbjct: 463 TLAEKHLNHKTTTFEEIAGKGKGQL---------------TFNQIEVEQATLYAAEDADI 507

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P  +            E  L  +   +  +G  ID  ++    + I Q   
Sbjct: 508 TLLLHQALYPQIEAIAPLKHVYHDIEMPLVPVLSRMERKGVLIDAQVLAMQSQEITQRLA 567

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
           +++++   L      +      L+  LF    + +       +  T + +L     +   
Sbjct: 568 EIEKETFALAGQEF-NLSSPKQLQEILFEKLNLPIIKKTPKGAPSTNEEVLEALAHSHEL 626

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
             LIL     +       + L   V+S  +   T      + TGR S      QN+P   
Sbjct: 627 PRLILEHRGLAKLKSTYTDKLPLMVNSKTKRVHTSYHQAVTATGRLSSRDPNLQNIP--- 683

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   IA +G K+V AD + IE R++A ++ 
Sbjct: 684 ---------------------VRNEEGRRIRQAFIARDGFKIVAADYSQIELRIMAHLSQ 722

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +   + AFA G+DI+  T ++ F  P+D+V+ EQR   K +                   
Sbjct: 723 DKGLLDAFAQGKDIHRATASEVFGIPLDEVTSEQRRSAKAINFG--------------LI 768

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            G+     SQ +                               +     +     +  ++
Sbjct: 769 YGMSAFGLSQQI------------------------------GVERKEAQRYMDLYFERY 798

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            GVL   +   +  +                              +     RRL   ++ 
Sbjct: 799 PGVLDYMERTRKQASQQGY--------------------------VETLDGRRLYLPEIN 832

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK-------NGYDIVLT 627
              +    A+    RE           +Q  + DI+ + M            +   +++ 
Sbjct: 833 SKNAIRRKAS---EREAINAP------MQGTAADIIKKAMIAVDNWICHECPDDVHMIMQ 883

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E  ++        +  LM  +   A  +PLK E      +
Sbjct: 884 VHDELVFEVRESYLEKANAMIHKLMESSMELA--IPLKVEVGVGNNW 928


>gi|145301031|ref|YP_001143872.1| DNA polymerase I [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853803|gb|ABO92124.1| DNA polymerase I [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 918

 Score =  409 bits (1052), Expect = e-112,   Method: Composition-based stats.
 Identities = 107/708 (15%), Positives = 193/708 (27%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQS----------AM 53
              D ET S   +          +A I   ++A +                        +
Sbjct: 341 FAFDTETTSLDYM----------EARIVGVSFAVEAGKAAYVPFGHDYLGAPVQLTEAVV 390

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
              L   L D T + V  N  ++R +      ID+    +  T + +           + 
Sbjct: 391 LGKLKPLLEDPTRLKVGQNLKYDRNVLLNH-DIDLQGIAY-DTMLESYVLNSTASRHDMD 448

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK +                    +    +    Y   D + 
Sbjct: 449 SLAKRYLGVETTSFEDIAGKGVKQL---------------TFNQIELEQAAPYAAEDADI 493

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L    +            E  L  +   +   G  ID  L+ +  + I     
Sbjct: 494 TLRLHQTLWGQLEAVPGLCQVFSEIELPLLPVLARMELLGTTIDPKLLHQQSQEIELRLA 553

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
           +L+    +L      +      L   LF   G+ +       +  T + +L+    T   
Sbjct: 554 ELERQAHELAGQEF-NLSSPKQLGEILFTKLGLPIIKKTPKGAPSTAEEVLAELAETYEL 612

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             L++     +       + L   +    GR+  +     A  TGR S      QN+P  
Sbjct: 613 PRLLMEHRTLAKLKSTYTDKLPLMIKPQTGRVHTSYHQAVA-ATGRLSSSDPNLQNIP-- 669

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   I S G KLV AD + IE R++A ++
Sbjct: 670 ----------------------VRNEQGRRIRQAFIPSAGYKLVAADYSQIELRIMAHLS 707

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
           G+   + AFA G+DI+  T A+ F   +D V+ + R   K +                  
Sbjct: 708 GDKGLLTAFAEGKDIHKATAAEVFGVALDAVTTDMRRSAKAIN--------------FGL 753

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 754 IYGMS------------------------------AFGLAKQLGIGRAEAQKYMDLYFER 783

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +   +                                 +     RRL   D+
Sbjct: 784 YPGVLEYMERTRQQAEAQGY--------------------------VETLFGRRLYLPDI 817

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKN-------ATKNGYDIVL 626
           K   + L        R            +Q  + DI+   M N              +++
Sbjct: 818 KSRNAGLR---KGAERAAINAP------MQGTAADIIKRAMINVDGWIRGIEDESIRMLM 868

Query: 627 TVHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  +         +   M+        +PL  E      +
Sbjct: 869 QVHDELVFEIREEKLEEYTAIIKEKMSAAAE--LHVPLLVEAGTGDNW 914


>gi|330431802|gb|AEC16861.1| DNA polymerase I [Gallibacterium anatis UMN179]
          Length = 925

 Score =  409 bits (1052), Expect = e-112,   Method: Composition-based stats.
 Identities = 107/705 (15%), Positives = 206/705 (29%), Gaps = 169/705 (23%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
             ID ET S   +          QA +   ++A ++                       +
Sbjct: 351 FAIDTETNSLNYM----------QAKLVGLSFALENGEAAYLPLQHHYLDCPQQLSWKTV 400

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSLKN 111
            + L   L D  +  V  N  ++  +  +  G+++       T + + T       ++ +
Sbjct: 401 LAALKTVLEDPNIKKVGQNLKYDLTILARH-GVELQGV-VYDTMLESYTLDSTGRHNMDD 458

Query: 112 ACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEAT 170
                L+      +   GK                               EY   D + T
Sbjct: 459 LAKRFLHHDTIHFEDLAGKGKGQL---------------TFDQIEIDKAAEYAAEDADVT 503

Query: 171 RELFKRLIPLS-----------DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKK 219
            +L + L P             + E  L  +   +   G  ID DL+ +  + I     +
Sbjct: 504 FKLHQVLWPQLNQTPSLVKLFTEVELPLSQVLARMERNGVLIDSDLLYQQSQEINARLIQ 563

Query: 220 LDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLAK 275
           L++   +L      +   T  L+  LF   G+         +  T + +L          
Sbjct: 564 LEQQAHQLAGQAF-NLASTKQLQEILFGKLGLPVLKKTPKGAPSTNEEVLEELAYEHELP 622

Query: 276 DLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
            L++     S       + L + +  + GR+  +      + TGR S      QN+P   
Sbjct: 623 KLLVEHRGFSKLKSTYTDKLPQMIDPNTGRVHTSYHQAV-TITGRLSSSDPNLQNIP--- 678

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   IA  G K+V AD + IE R++A ++ 
Sbjct: 679 ---------------------TRSEEGRKIRQAFIAPQGFKVVAADYSQIELRIMAHLSA 717

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +     AF++G D++ +T A+ F+ P+++V+ +QR   K +                   
Sbjct: 718 DAGLAYAFSHGLDVHRSTAAEVFDVPLEQVTSQQRYRAKAIN--------------FGLI 763

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            G+                                   A + ++     +     +  ++
Sbjct: 764 YGMS------------------------------AFGLARQLQIPRNEAQTYIDRYFHRY 793

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            GV Q   D+ E           +                           RRL   ++K
Sbjct: 794 PGVKQFMNDIQEKAKQQGYVETLL--------------------------GRRLYLPELK 827

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT-----KNGYDIVLTVH 629
                         R            +Q  + DI+ + M +       KN   +++ VH
Sbjct: 828 SSNGMRR---KAAERVAINAP------MQGTAADIIKKAMIDIDRFIADKNDIRMIMQVH 878

Query: 630 DEIVSETPDTPYFSVGTLCS-LMTKNPSWAKGLPLKAEGYEAKRY 673
           DE+V E  +        +   +M         +PL  E      +
Sbjct: 879 DELVFEVKEDKVEYYEKIIKDMMENAVK--LSVPLIVEVNFGDNW 921


>gi|145636579|ref|ZP_01792246.1| DNA polymerase I [Haemophilus influenzae PittHH]
 gi|145270105|gb|EDK10041.1| DNA polymerase I [Haemophilus influenzae PittHH]
          Length = 930

 Score =  409 bits (1051), Expect = e-112,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 202/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDR----------TEQS 51
             + +D ET S   +           A +   ++A ++                   E+S
Sbjct: 354 KLIAVDTETDSLDYI----------SANLVGISFALENGEAAYLPLQLDYLDAPKTLEKS 403

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + +   L +  +  +  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 404 TALAAIKPILENPNIHKIGQNIKFDESIFARH-GIELQGVEF-DTMLLSYTLNSTGRHNM 461

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +   EY   D +
Sbjct: 462 DDLAKRYLGHETIAFESIAGKGKSQL---------------TFNQIPLEQATEYAAEDAD 506

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L      E             L  +   +   G  ID D +      IA   
Sbjct: 507 VTMKLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSDALFMQSNEIASRL 566

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L++    L      +   T  L+  LF   G+         +  T + +L     +  
Sbjct: 567 TALEKQAYALAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELAYSHE 625

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+S  GR+  +      + TGR S      QN+P 
Sbjct: 626 LPKILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 683

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA  G  +V AD + IE R++A +
Sbjct: 684 -----------------------IRNEEGRRIRQAFIAREGYSIVAADYSQIELRIMAHL 720

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+   I AF+ G+DI+ +T A+ F   +D+V+ EQR   K +                 
Sbjct: 721 SGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------G 766

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   + +  +     +     +  
Sbjct: 767 LIYGMS------------------------------AFGLSRQLGISRPDAQKYMDLYFQ 796

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V Q   D+ E                                 +     RRL   D
Sbjct: 797 RYPSVQQFMTDIREKAKAQGY--------------------------VETLFGRRLYLPD 830

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +        ++++ 
Sbjct: 831 INSSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKLDEVIRHDPNIEMIMQ 881

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  E    + +
Sbjct: 882 VHDELVFEVRSEKVAFFREQIKQHMEAAAELV--VPLIVEVGVGQNW 926


>gi|300714614|ref|YP_003739417.1| DNA polymerase I [Erwinia billingiae Eb661]
 gi|299060450|emb|CAX57557.1| DNA polymerase I [Erwinia billingiae Eb661]
          Length = 928

 Score =  409 bits (1051), Expect = e-112,   Method: Composition-based stats.
 Identities = 107/708 (15%), Positives = 203/708 (28%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D+ET S   L           A I   ++A +                      +++
Sbjct: 351 FAFDLETDSLDTL----------SANIVGISFAIEPGKAAYLPVAHDYLDAPAQLDRNSV 400

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTN---GLPSSLK 110
              L   L D  ++ V  N  ++R + K    I++   ++  T + +      G    + 
Sbjct: 401 LERLKPLLEDPALLKVGQNLKYDRGVLKNY-DIELQGIKF-DTMLESYALSSVGSRHDMD 458

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 LN      +   GK                      +    +    Y   D + 
Sbjct: 459 TLSSRWLNHKTVSFEEIAGKGKKQL---------------TFNQIDLEQAAHYAAEDADV 503

Query: 170 TRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P  + E             L  +   I   G  ID  ++    + +     
Sbjct: 504 TLQLHLKMWPELEKEQGPKEVFENIEMPLLTVISRIERNGVLIDQGILAAHSKELTIRLA 563

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   +L      +      L+  LF   GI     +      T + +L+   +    
Sbjct: 564 ELEQKAHELAGEPF-NLSSPKQLQTILFEKQGIKPTKKTPGGAPSTSEEVLAELALDYPL 622

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 623 PKVILENRGLAKLKSTYTDKLPLMINPITGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 679

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IAS G K+V AD + IE R++A ++
Sbjct: 680 ----------------------VRNEEGRRIRQAFIASKGHKIVAADYSQIELRIMAHLS 717

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G DI+  T A+ F   +DKV+ EQR   K +                  
Sbjct: 718 QDKGLLSAFAEGMDIHRATAAEVFGMALDKVTGEQRRSAKAINF--------------GL 763

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 764 IYGMS------------------------------AFGLSRQLNIGAGEAKKYMDLYFER 793

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +   +  A                              +     RRL   D+
Sbjct: 794 YPGVLEYMESTRQQAAEKGY--------------------------VSTLDGRRLYLPDI 827

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT-------KNGYDIVL 626
               +          R            +Q  + DI+ + M                +++
Sbjct: 828 NASNAMRR---KAAERAAINAP------MQGTAADIIKKAMIAVDGWLTPQSAPDVKMIM 878

Query: 627 TVHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E   +   +    +  LM  +      +PL+ +      +
Sbjct: 879 QVHDELVFEVKTSEVEAATAKIRDLMENSMK--LDVPLQVDVGVGDNW 924


>gi|95931003|ref|ZP_01313731.1| DNA polymerase I [Desulfuromonas acetoxidans DSM 684]
 gi|95132899|gb|EAT14570.1| DNA polymerase I [Desulfuromonas acetoxidans DSM 684]
          Length = 891

 Score =  409 bits (1050), Expect = e-111,   Method: Composition-based stats.
 Identities = 106/698 (15%), Positives = 197/698 (28%), Gaps = 154/698 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAM 53
           + +D ET S  PL           A +    +A +                     +  +
Sbjct: 318 ISVDTETTSLNPLL----------AEVVGFCFAVEPGHGWYVPVGHCGGGAEEQLPRDEV 367

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTN---GLPSSLK 110
            + +   L D T+  V  N  ++ ++ ++  GI +       T + +           L 
Sbjct: 368 VAQVQPLLEDATLAKVGQNLKYDALVLRRA-GIALRGV-VADTMLQSYLLYPAARSHGLD 425

Query: 111 NACL-ALNFSEHLTKMEEG--KALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
                 L +         G  K  I         +  Y    A+          Y + D 
Sbjct: 426 ALAADHLGYKMISYSEVAGTGKKQIGFDEVALDVATRYAAEDAD-----ITLQLYQRFDA 480

Query: 168 EATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKL 227
           E    L +    +   E  L  +   +   G R+D + +  L    +   K+L++ I +L
Sbjct: 481 ELDGTLRELFETV---EMPLLQVLIDMEWWGVRVDRERLDALSAGFSTSIKQLEQQIYEL 537

Query: 228 TDGIIRSSRQTYALRMYLFLITGIDLVDMSE---GTLKSILSHSNITQLAKDLILNRLAS 284
                 +      L + LF    +     ++    T   +L +         LIL   + 
Sbjct: 538 AGEEF-NINSPKQLGVILFEKLDLPHGKKTKTGWSTAVDVLKNLADKHDVVALILQYRSL 596

Query: 285 SGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQT 343
           +       + L   +  D GR+  +      + TGR S      QN+P            
Sbjct: 597 AKLKGTYTDALPLLIHPDSGRIHTSFNQAV-TATGRLSSSDPNLQNIP------------ 643

Query: 344 IQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFA 403
                               +R   +   G+ L+ AD + IE RV+A +A E    ++F 
Sbjct: 644 ------------IRSEEGRAIREAFVPDAGQVLLAADYSQIELRVMAHMADEPILQESFR 691

Query: 404 NGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
            GEDI+  T ++ F+   D V  E R   K +                    G+      
Sbjct: 692 QGEDIHQRTASEIFSVFPDMVDSEMRRRAKTINF--------------GVLYGMG----- 732

Query: 464 QNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKD 523
                                        A    +     +     +  ++  VL+  + 
Sbjct: 733 -------------------------AFSLAKDLGISNKEAKQYIDHYFERYPAVLEFIEQ 767

Query: 524 LTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTA 583
             +                               +++     RR   SD+      + + 
Sbjct: 768 QKQFGRE--------------------------HLYVETLLGRRCAVSDINSKNGQVRSY 801

Query: 584 TSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN------GYDIVLTVHDEIVSETP 637
             +               VQ  + DI+   M    +          +VL VHDE+V + P
Sbjct: 802 AERN---------AVNYPVQGSAADIIKVAMVRIHQRLQDLQLKTRMVLQVHDELVFDVP 852

Query: 638 DTPYFS-VGTLCSLMTKNPSWAKGLPLKAEGYEAKRYR 674
                  V  +   M +       +PL+        +R
Sbjct: 853 KDEVDDVVALVVQEMEQAVE--LRVPLEVSLGRGANWR 888


>gi|127514642|ref|YP_001095839.1| DNA polymerase I [Shewanella loihica PV-4]
 gi|126639937|gb|ABO25580.1| DNA polymerase I [Shewanella loihica PV-4]
          Length = 930

 Score =  409 bits (1050), Expect = e-111,   Method: Composition-based stats.
 Identities = 106/698 (15%), Positives = 198/698 (28%), Gaps = 158/698 (22%)

Query: 7   DIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAMPSD 56
           D ET S   +          +A +   ++A +                        + + 
Sbjct: 356 DTETTSLNYM----------EAKMVGLSFAIEPGKAAYLPLAHDYADAPEQLDSEQVLAK 405

Query: 57  LLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLKNAC 113
           L   L D +++ V  N  ++  +    +GI +    +  T + +          ++ +  
Sbjct: 406 LKPLLEDPSLLKVGQNLKYDMSILAN-VGIALKGVAF-DTMLESYVFNSVASKHNMDDLA 463

Query: 114 -LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRE 172
              L       +   GK +                    +    +    Y   D + T  
Sbjct: 464 LKYLGHKNISFEEIAGKGVKQL---------------TFNQIPLETAAPYAAEDADITLR 508

Query: 173 LFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLD 221
           L + L P               E  L  +   I  +G  ID  L+ +  + +A++  +L+
Sbjct: 509 LHQHLWPRLQKASELASVFTDIELPLVSILSQIERQGVLIDSMLLGQQSDELARKIDELE 568

Query: 222 EDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLAKDL 277
           +   ++      +   T  L+   F   G          +  T + +L    +      +
Sbjct: 569 QKAYEIAGEPF-NLGSTKQLQALFFEKLGYPVLKKTPKGAPSTAEEVLVELALDYPLPKI 627

Query: 278 ILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERS 336
           IL   + S       + L   V    GR+  +     A  TGR S      QN+P     
Sbjct: 628 ILEHRSLSKLKSTYTDKLPLMVDGKTGRVHTSYHQAIA-ATGRLSSSEPNLQNIP----- 681

Query: 337 EEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGED 396
                                      +R   +A  G+K++ AD + IE R++A ++ + 
Sbjct: 682 -------------------IRTEEGRRIRHAFVAPEGRKILAADYSQIELRIMAHLSQDK 722

Query: 397 WKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCG 456
             + AFA G+DI+  T A+ F+    +V+ EQR   K +   L Y               
Sbjct: 723 GLLSAFAEGKDIHRATAAEVFDVDFSEVTSEQRRRAKAVNFGLIYGMS-----AFGLARQ 777

Query: 457 LDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQG 516
           LD+ +          F+ +     +    +    E      L G    L           
Sbjct: 778 LDIPRHEAQQYIDIYFKRYPGVLKYMEDTRAAAAEQGYVSTLYGRRLYL---------PA 828

Query: 517 VLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGD 576
           +        +                                 I  P             
Sbjct: 829 IKDRNAMRRQAAERAA---------------------------INAPM------------ 849

Query: 577 CSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSET 636
                TA   + +      +  E   Q                    +++ VHDE+V E 
Sbjct: 850 ---QGTAADIIKKAMINIAQWIETETQG----------------EITMIMQVHDELVFEV 890

Query: 637 PDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
                 S+   +C LM +  S    + L AE      +
Sbjct: 891 DADKADSLKLKVCELMAQAAS--LDVELLAEAGIGDNW 926


>gi|119475294|ref|ZP_01615647.1| DNA polymerase I [marine gamma proteobacterium HTCC2143]
 gi|119451497|gb|EAW32730.1| DNA polymerase I [marine gamma proteobacterium HTCC2143]
          Length = 920

 Score =  409 bits (1050), Expect = e-111,   Method: Composition-based stats.
 Identities = 106/708 (14%), Positives = 206/708 (29%), Gaps = 171/708 (24%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SA 52
               D ET S   +          +A +   ++A +                        
Sbjct: 343 YFAFDTETTSLNYM----------EARVVGVSFAVEAGSAAYVPFGHDYVGVEQQLSEDW 392

Query: 53  MPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSL 109
           + + L   L D +   V  N  ++R +     GI++   ++  T + +           +
Sbjct: 393 VLAQLKPLLEDSSRAKVGQNLKYDRNVLANH-GIELNGIQF-DTMLESYVLNSTATRHDM 450

Query: 110 KNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L+      +   GK                      +    Q  G Y   D +
Sbjct: 451 DSLARKYLDVGTIKFEDIAGKGAKQL---------------TFNQIQLQQAGPYAAEDAD 495

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L P               E  L  +   I   G  +  DL+ K    +    
Sbjct: 496 ITLQLHEVLWPKLAAIDSLMSVFQTIELSLVPVLSRIERNGALVSRDLLNKQSAELGTRL 555

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
           ++L+++  +L  G   +      L   LF    +         +  T + +L+   +   
Sbjct: 556 QQLEKEAHELA-GEAFNLSSPKQLGHILFDKLELPVIKKTPKGAASTAEEVLAELALDYP 614

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + +S   GR+  +      + TGR S      QN+P 
Sbjct: 615 LPRILMEYRGLSKLKSTYTDKLPQMISEVTGRIHTSYHQAV-TATGRLSSSDPNLQNIP- 672

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          VR   +A +G K+V AD + IE R++A +
Sbjct: 673 -----------------------IRTEEGRKVRQAFVARDGYKIVAADYSQIELRIMAHL 709

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           + ++  +KAFA G+DI+  T A+ F   +++VS EQR   K +                 
Sbjct: 710 SQDNGLLKAFAEGKDIHQATAAEVFGLELEQVSTEQRRRAKAINF--------------G 755

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   A +  +     +     + +
Sbjct: 756 LIYGMS------------------------------AFGLAKQIDVGRHEAQEYIDTYFS 785

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++ GV     +     A                              +     RRL   +
Sbjct: 786 RYPGVRDYMDNTRADAAERGY--------------------------VETLYGRRLYLPE 819

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVL 626
           +         A     R            +Q  + DI+ + M +  +          +++
Sbjct: 820 INASNGMRRQAA---ERTAINAP------MQGTAADIIKKAMVDVDRWLLESDVDGQMIM 870

Query: 627 TVHDEIVSETPDTPYF-SVGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  +      V ++  LM+        +PL  +      +
Sbjct: 871 QVHDELVFEVAEPSLDYLVSSVNDLMSGAV--VLDVPLIVDVGIGSNW 916


>gi|226327657|ref|ZP_03803175.1| hypothetical protein PROPEN_01529 [Proteus penneri ATCC 35198]
 gi|225204183|gb|EEG86537.1| hypothetical protein PROPEN_01529 [Proteus penneri ATCC 35198]
          Length = 949

 Score =  408 bits (1049), Expect = e-111,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 206/707 (29%), Gaps = 170/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +           +          + +
Sbjct: 372 FAFDTETDSLNNI----------DARLIGMSFAIEPGKAAYIPLRHEYLDAPEQLPVNDV 421

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNG---LPSSLK 110
            + L   L D+ ++ +  N  F+R + +   GI++    +  T + +           + 
Sbjct: 422 LAALKPILEDKNILKIGQNLKFDRGIMEN-EGIELNGIHF-DTMLESYVLNSVSNRHDMD 479

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 LN      +   GK                      +    +    Y   D + 
Sbjct: 480 TLAEKHLNHKTTTFEEIAGKGKGQL---------------TFNQIEVEQATLYAAEDADI 524

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P  +            E  L  +   +  +G  ID  ++    + I Q   
Sbjct: 525 TLLLHQALYPQIEAIEPLKHVYRDIEMPLVPVLSRMERKGVLIDAQVLAVQSQEITQRLA 584

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
           +++++   L      +      L+  LF    +         +  T + +L     +   
Sbjct: 585 EIEKETFALAGQEF-NLSSPKQLQEILFDKLQLPVIKKTPKGAPSTNEEVLEELAHSHEL 643

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
             LIL     +       + L   V+S  +   T      + TGR S      QN+P   
Sbjct: 644 PRLILEHRGLAKLKSTYTDKLPLMVNSKTKRVHTSYHQAVTATGRLSSRDPNLQNIP--- 700

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   IA  G K+V AD + IE R++A ++ 
Sbjct: 701 ---------------------VRNEEGRRIRQAFIAREGFKIVAADYSQIELRIMAHLSQ 739

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +   + AFA G+DI+  T ++ F  P+++V+ EQR   K +                   
Sbjct: 740 DKGLLDAFAQGKDIHRATASEVFGIPLEEVTSEQRRSAKAINFG--------------LI 785

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            G+     SQ +                               +     +     +  ++
Sbjct: 786 YGMSAFGLSQQI------------------------------GVERREAQRYMDLYFERY 815

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            GVL   +   +  +                                    RRL   ++ 
Sbjct: 816 PGVLDYMERTRKQASEQGYVETLE--------------------------GRRLYLPEIN 849

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK-------NGYDIVLT 627
              +    A+    RE           +Q  + DI+ + M                +++ 
Sbjct: 850 SKNAIRRKAS---EREAINAP------MQGTAADIIKKAMIAVDNWICNECPADVHMIMQ 900

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E  ++   +    +  LM  +   A  +PLK E      +
Sbjct: 901 VHDELVFEVRESYLENANIMIHKLMESSMELA--IPLKVEVGVGNNW 945


>gi|168263110|ref|ZP_02685083.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|205348113|gb|EDZ34744.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
          Length = 928

 Score =  408 bits (1049), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|260581683|ref|ZP_05849480.1| DNA polymerase I [Haemophilus influenzae NT127]
 gi|260095276|gb|EEW79167.1| DNA polymerase I [Haemophilus influenzae NT127]
          Length = 930

 Score =  408 bits (1049), Expect = e-111,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 203/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDR----------TEQS 51
             + +D ET S   +           A +   ++A ++                   E+S
Sbjct: 354 KLIAVDTETDSLDYI----------SANLVGISFALENGEATYLPLQLDYLDAPKTLEKS 403

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + +   L +  +  +  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 404 TALAAIKPILENPNIHKIGQNIKFDESIFARH-GIELQGVEF-DTMLLSYTLNSTGRHNM 461

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +   EY   D +
Sbjct: 462 DDLAKRYLGHETIAFESLAGKGKSQL---------------TFNQIPLEQATEYAAEDAD 506

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L      E             L  +   +   G  ID D +      IA   
Sbjct: 507 VTMKLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSDALFIQSNEIATRL 566

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L++    L      +   T  L+  LF   G+         +  T + +L   + +  
Sbjct: 567 TALEKQAYALAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELSYSHE 625

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+S  GR+  +      + TGR S      QN+P 
Sbjct: 626 LPKILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 683

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA  G  +V AD + IE R++A +
Sbjct: 684 -----------------------IRNEEGRRIRQAFIAREGYSIVAADYSQIELRIMAHL 720

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+   I AF+ G+DI+ +T A+ F   +D+V+ EQR   K +                 
Sbjct: 721 SGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------G 766

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   + +  +     +     +  
Sbjct: 767 LIYGMS------------------------------AFGLSRQLGISRADAQKYMNLYFQ 796

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V Q   D+ E                                 +     RRL   D
Sbjct: 797 RYPSVQQFMTDIREKAKAQGY--------------------------VETLFGRRLYLPD 830

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +        ++++ 
Sbjct: 831 INSSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKLDEVIRHDPNIEMIMQ 881

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  E    + +
Sbjct: 882 VHDELVFEVRSEKVAFFREQIKQHMESAAELV--VPLIVEVGVGQNW 926


>gi|120596878|ref|YP_961452.1| DNA polymerase I [Shewanella sp. W3-18-1]
 gi|120556971|gb|ABM22898.1| DNA polymerase I [Shewanella sp. W3-18-1]
          Length = 922

 Score =  408 bits (1049), Expect = e-111,   Method: Composition-based stats.
 Identities = 109/701 (15%), Positives = 193/701 (27%), Gaps = 158/701 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
           + +D ET S   +           A +   ++A +                         
Sbjct: 345 IAVDTETTSLDYMV----------AELVGMSFAVEAGKAAYLPLAHDYVGAPQQLDKQFA 394

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L D+ V  V  N  ++  +     GI +       T + +           + 
Sbjct: 395 LEKLRPILEDDKVKKVGQNLKYDISVLANA-GIKLQGV-VFDTMLESYVFNSVASRHDMD 452

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 L       +   GK                      +    ++   Y   D + 
Sbjct: 453 GLALKYLGHKNIGFEDIAGKGAKQL---------------TFNQIPLEVAAPYAAEDADI 497

Query: 170 TRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P  + E             L  +   I  +G  ID  L+ +  + +A++  
Sbjct: 498 TLRLHQHLWPRLEKEPQLASVFTEIELPLIQVLSDIERQGVLIDSMLLGQQSDELARKID 557

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
            L+E   ++      +      L++  F   G  +       +  T + +L    +    
Sbjct: 558 TLEEKAYEIAGEKF-NLGSPKQLQVLFFEKLGYPITKKTPKGAPSTAEEVLVELALDFPL 616

Query: 275 KDLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL   + S       + L   V+   GR+  +     A  TGR S      QN+P  
Sbjct: 617 PKVILEHRSLSKLKSTYTDKLPLMVNAKTGRVHTSYHQANA-ATGRLSSSEPNLQNIP-- 673

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA  G+K++ AD + IE R++A ++
Sbjct: 674 ----------------------IRTEEGRRIRQAFIAPAGRKILAADYSQIELRIMAHLS 711

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   +KAFA G+DI+  T A+ F T  D V+ EQR   K +   L Y            
Sbjct: 712 QDAGLLKAFAEGKDIHRATAAEVFGTDFDAVTTEQRRRAKAVNFGLIYGMS-----AFGL 766

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              LD+ +        + F  +     +    +    E      L G    L        
Sbjct: 767 ARQLDIPRNEAQTYIDTYFARYPGVLRYMEETRAGAAELGYVSTLFGRRLYL-------- 818

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
              +        +G                     ++                       
Sbjct: 819 -PEIRDRNAMRRQGAERAAINAPMQGTAADIIKKAMI----------------------- 854

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                      +Q ++  T G                   M           + VHDE+V
Sbjct: 855 ---------NIAQWIKTETQGE----------------IAMI----------MQVHDELV 879

Query: 634 SETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            E       ++   +C LM K       + L AE      +
Sbjct: 880 FEVDADKAETLKQKVCELMAKAA--ILDVALLAEAGIGDNW 918


>gi|319424462|gb|ADV52536.1| DNA polymerase I [Shewanella putrefaciens 200]
          Length = 922

 Score =  408 bits (1049), Expect = e-111,   Method: Composition-based stats.
 Identities = 109/701 (15%), Positives = 193/701 (27%), Gaps = 158/701 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
           + +D ET S   +           A +   ++A +                         
Sbjct: 345 IAVDTETTSLDYMV----------AELVGMSFAVEAGKAAYLPLAHDYVGAPQQLDKQFA 394

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L D+ V  V  N  ++  +     GI +       T + +           + 
Sbjct: 395 LEKLRPILEDDKVKKVGQNLKYDISVLANA-GIKLQGV-VFDTMLESYVFNSVASRHDMD 452

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 L       +   GK                      +    ++   Y   D + 
Sbjct: 453 GLALKYLGHKNIGFEDIAGKGAKQL---------------TFNQIPLEVAAPYAAEDADI 497

Query: 170 TRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P  + E             L  +   I  +G  ID  L+ +  + +A++  
Sbjct: 498 TLRLHQHLWPRLEKEPQLASVFTEIELPLIQVLSDIERQGVLIDSMLLGQQSDELARKID 557

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
            L+E   ++      +      L++  F   G  +       +  T + +L    +    
Sbjct: 558 TLEEKAYEIAGEKF-NLGSPKQLQVLFFEKLGYPITKKTPKGAPSTAEEVLVELALDFPL 616

Query: 275 KDLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL   + S       + L   V+   GR+  +     A  TGR S      QN+P  
Sbjct: 617 PKVILEHRSLSKLKSTYTDKLPLMVNAKTGRVHTSYHQANA-ATGRLSSSEPNLQNIP-- 673

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA  G+K++ AD + IE R++A ++
Sbjct: 674 ----------------------IRTEEGRRIRQAFIAPAGRKILAADYSQIELRIMAHLS 711

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   +KAFA G+DI+  T A+ F T  D V+ EQR   K +   L Y            
Sbjct: 712 QDAGLLKAFAEGKDIHRATAAEVFGTDFDAVTTEQRRRAKAVNFGLIYGMS-----AFGL 766

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              LD+ +        + F  +     +    +    E      L G    L        
Sbjct: 767 ARQLDIPRNEAQTYIDTYFARYPGVLRYMEETRAGAAELGYVSTLFGRRLYL-------- 818

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
              +        +G                     ++                       
Sbjct: 819 -PEIRDRNAMRRQGAERAAINAPMQGTAADIIKKAMI----------------------- 854

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                      +Q ++  T G                   M           + VHDE+V
Sbjct: 855 ---------NIAQWIKTETQGE----------------IAMI----------MQVHDELV 879

Query: 634 SETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            E       ++   +C LM K       + L AE      +
Sbjct: 880 FEVDADKAETLKQKVCELMAKAA--ILDVALLAEAGIGDNW 918


>gi|16767264|ref|NP_462879.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56415846|ref|YP_152921.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62182461|ref|YP_218878.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161617122|ref|YP_001591087.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|168244255|ref|ZP_02669187.1| DNA polymerase I family protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194444061|ref|YP_002043223.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194448474|ref|YP_002048004.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|197364776|ref|YP_002144413.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|224585810|ref|YP_002639609.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|20141441|sp|Q9F173|DPO1_SALTY RecName: Full=DNA polymerase I; Short=POL I
 gi|16422560|gb|AAL22838.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56130103|gb|AAV79609.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62130094|gb|AAX67797.1| DNA polymerase I, 3' --> 5' polymerase, 5' --> 3' and 3' --> 5'
           exonuclease [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161366486|gb|ABX70254.1| hypothetical protein SPAB_04960 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402724|gb|ACF62946.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194406778|gb|ACF66997.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|197096253|emb|CAR61851.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|205336940|gb|EDZ23704.1| DNA polymerase I family protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|224470338|gb|ACN48168.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|261249116|emb|CBG26977.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267996282|gb|ACY91167.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301160508|emb|CBW20038.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312915113|dbj|BAJ39087.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321225284|gb|EFX50342.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322716955|gb|EFZ08526.1| putative acyltransferase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323132341|gb|ADX19771.1| putative xanthine/uracil permeases family protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
          Length = 928

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|168232922|ref|ZP_02657980.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168821669|ref|ZP_02833669.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194469064|ref|ZP_03075048.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194455428|gb|EDX44267.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|205332830|gb|EDZ19594.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205341832|gb|EDZ28596.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|320088405|emb|CBY98164.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 928

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|197247609|ref|YP_002148920.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197211312|gb|ACH48709.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
          Length = 928

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|262374856|ref|ZP_06068090.1| DNA polymerase I [Acinetobacter lwoffii SH145]
 gi|262309869|gb|EEY90998.1| DNA polymerase I [Acinetobacter lwoffii SH145]
          Length = 920

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 98/706 (13%), Positives = 195/706 (27%), Gaps = 169/706 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------S 51
            +   D ET S         +  A    I   + A+D +                     
Sbjct: 346 KRFAFDTETTSLD-------YRIA---QIVGFSVAFDAQNAYYVPLAHDYEGAPEQLNRE 395

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSS 108
            + + +   L DE+V  + H+  ++  + +   GI +    +  T + +           
Sbjct: 396 VILAQIKPILEDESVKKIGHHLKYDAHVLENH-GIHLAGW-YFDTMLASYVLNSVATRHG 453

Query: 109 LKNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           + +     L+      +   GK                   +  +    +    Y   D 
Sbjct: 454 MDDVARLYLSHLTTTYEQVAGKGAKQ---------------KTFNQIPLETAAHYAAEDA 498

Query: 168 EATRELFKRLIPLSDGERDLW-----------LLDQTINDRGYRIDLDLVLKLQELIAQE 216
             T  L++ L        +L             +   + + G  +DL  + +L    +  
Sbjct: 499 HVTYRLYEVLSSKLQAHPELVNILHNIEVPVARVLTQMEENGIELDLAFLDQLGGEFSNT 558

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMS----EGTLKSILSHSNITQ 272
            + L+  I+++  G   +      +   LF   G+     +      T +S+L       
Sbjct: 559 MQNLENQIMEIA-GESFNVSSPKQVGEVLFEKLGLKGGKKTTTGQYSTSESVLEKIEHP- 616

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
               LIL     S       + L +  + D     T      + TGR S      QN+P 
Sbjct: 617 -IAQLILEYRGLSKLKSTYTDGLCKQANPDTHRVHTSYHQALTATGRLSSTDPNLQNIP- 674

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   +A  G+ L+ AD + IE R++A +
Sbjct: 675 -----------------------IRAEIGRQIRKAFVAPEGRVLLAADYSQIELRLMAHL 711

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           + ++  + AF +G+D++  T A+     ++ V+ +QR   K +                 
Sbjct: 712 SQDEALLDAFIHGQDVHRRTAAEVLGIALEDVTNDQRRQAKAVN--------------FG 757

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                     +        +   K +  
Sbjct: 758 LLYGMSEF------------------------------GLIRQLGFTRQESQDYIKQYFH 787

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++ G+    +   +                                 +     RRL   D
Sbjct: 788 RYPGIYDYMQRTRQVALEQG--------------------------FVETLLGRRLYTPD 821

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN----GYDIVLTV 628
           +      +        R             Q  + DI+   M    K        ++L V
Sbjct: 822 IDARNMMVR---KAAERAAINAPL------QGSAADIIKMAMIEVDKMLPKDQAKMLLQV 872

Query: 629 HDEIVSETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           HDE+V E  +     +   L  +M         +PL  E  + K +
Sbjct: 873 HDELVFEVDEDIADELAPKLAEVMQSVLQ--ISVPLVVEVGKGKNW 916


>gi|168467328|ref|ZP_02701165.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|200387731|ref|ZP_03214343.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|195630257|gb|EDX48897.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|199604829|gb|EDZ03374.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|322613070|gb|EFY10020.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322619141|gb|EFY16024.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322626007|gb|EFY22819.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626535|gb|EFY23341.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322632354|gb|EFY29102.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322635166|gb|EFY31887.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322642757|gb|EFY39346.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322647922|gb|EFY44394.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322650672|gb|EFY47073.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322652855|gb|EFY49192.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322657170|gb|EFY53450.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662344|gb|EFY58559.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322666879|gb|EFY63055.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322672149|gb|EFY68264.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675871|gb|EFY71943.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681715|gb|EFY77741.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322684092|gb|EFY80101.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323193364|gb|EFZ78579.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323197721|gb|EFZ82854.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323200707|gb|EFZ85778.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207290|gb|EFZ92242.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323211491|gb|EFZ96332.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323218464|gb|EGA03172.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221056|gb|EGA05488.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323226031|gb|EGA10250.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231711|gb|EGA15823.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323236042|gb|EGA20120.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323239538|gb|EGA23587.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323243870|gb|EGA27881.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323249232|gb|EGA33149.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323250526|gb|EGA34409.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323258980|gb|EGA42632.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323260225|gb|EGA43848.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323265344|gb|EGA48841.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323270566|gb|EGA54012.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 928

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|85710997|ref|ZP_01042058.1| DNA polymerase I [Idiomarina baltica OS145]
 gi|85695401|gb|EAQ33338.1| DNA polymerase I [Idiomarina baltica OS145]
          Length = 924

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 105/710 (14%), Positives = 204/710 (28%), Gaps = 174/710 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
           +  D ET S   +          +A +   +++  +                       +
Sbjct: 345 IAFDTETTSLNYM----------EAQLVGVSFSIAEGEAVYIPVAHDYVGVEKQVDRDWL 394

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLART---NGLPSSLK 110
              L   L D ++  V  N  ++  + ++  GI +   +   T + +      G    + 
Sbjct: 395 LKVLKPLLEDSSIAKVGQNLKYDAHILRRY-GIKLRGIK-NDTMLASYVFNSVGSRHDMD 452

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 LN      +   GK                      +         Y   D + 
Sbjct: 453 TLSLQYLNHKPIKFEEIAGKGAKQL---------------TFNQIELAQAAPYAAEDADI 497

Query: 170 TRELFKRLIPL------------SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
           T  L   L               +D E  L  +   + + G ++D +++ K  E IA + 
Sbjct: 498 TLRLHHILWDKVHQTGEQLASVLTDIEVPLVSILTDMEEYGVKVDAEMLGKQSEEIANKL 557

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
            +L++   ++      +      L+  LF    +         +  T + +L        
Sbjct: 558 DELEQKAFEIAGEEF-NLGSPKQLQQILFEKLELPVIKKTPKGAPSTAEEVLQELAHDYP 616

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
             D+IL   + +       + L   ++ D GR+  + Q   A  TGR S      QN+P 
Sbjct: 617 LPDVILQHRSLAKLKSTYTDKLPRMINPDTGRVHTSYQQAVA-ATGRLSSTEPNLQNIP- 674

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          VR   +A  G  +V  D + IE R++A +
Sbjct: 675 -----------------------IRTPEGRRVRQAFVAEEGFTVVAIDYSQIELRIMAHL 711

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           + +   ++AFA G+DI+  T ++ F   +++V+ EQR   K +                 
Sbjct: 712 SQDASLLRAFAQGQDIHRATASEVFGCSLEEVTDEQRRRAKAVNF--------------G 757

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   + +  +     +     +  
Sbjct: 758 LIYGMS------------------------------AFGLSRQLDIPRHEAQAYMDKYFE 787

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           +  GVL+  ++  E                                 +     RRL   +
Sbjct: 788 RFPGVLEYMENTRETAKKQGY--------------------------VSTLFGRRLPLPE 821

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKN----ATKNGY----DI 624
           +K        A  +               +Q  + DI+   M        + G      +
Sbjct: 822 IKASNGARRKAAERAA---------INAPMQGTAADIIKRAMIKVGDWIDEKGCQSDVRM 872

Query: 625 VLTVHDEIVSETPDTPYFS-VGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           ++ VHDE+V E       S    L  +M +       +PL AE      +
Sbjct: 873 LMQVHDELVFEIRTEHAESYAKALADVMGEAAD--LDVPLLAEYGFGANW 920


>gi|146294987|ref|YP_001185411.1| DNA polymerase I [Shewanella putrefaciens CN-32]
 gi|145566677|gb|ABP77612.1| DNA polymerase I [Shewanella putrefaciens CN-32]
          Length = 922

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 111/701 (15%), Positives = 198/701 (28%), Gaps = 158/701 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
           + +D ET S   +           A +   ++A +                         
Sbjct: 345 IAVDTETTSLDYMV----------AELVGMSFAVEAGKAAYLPLAHDYVGAPQQLDKQFA 394

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L D+ V  V  N  ++  +     GI +       T + +           + 
Sbjct: 395 LEKLRPILEDDKVKKVGQNLKYDISVLANA-GIKLQGV-VFDTMLESYVFNSVASRHDMD 452

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 L       +   GK                      +    ++   Y   D + 
Sbjct: 453 GLAIKYLGHKNIGFEDIAGKGAKQL---------------TFNQIPLEVAAPYAAEDADI 497

Query: 170 TRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P  + E             L  +   I  +G  ID  L+ +  + +A++  
Sbjct: 498 TLRLHQHLWPRLEKEPQLASVFTEIELPLIQVLSDIERQGVLIDSMLLGQQSDELARKID 557

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
            L+E   ++      +      L++  F   G  +       +  T + +L    +    
Sbjct: 558 TLEEKAYEIAGEKF-NLGSPKQLQVLFFEKLGYPITKKTPKGAPSTAEEVLVELALDFPL 616

Query: 275 KDLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL   + S       + L   V+   GR+  +     A  TGR S      QN+P  
Sbjct: 617 PKVILEHRSLSKLKSTYTDKLPLMVNAKTGRVHTSYHQANA-ATGRLSSSEPNLQNIP-- 673

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA  G+K++ AD + IE R++A ++
Sbjct: 674 ----------------------IRTEEGRRIRQAFIAPAGRKILAADYSQIELRIMAHLS 711

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   +KAFA G+DI+  T A+ F T  D V+ EQR   K +   L Y            
Sbjct: 712 QDAGLLKAFAEGKDIHRATAAEVFGTDFDAVTTEQRRRAKAVNFGLIYGMS-----AFGL 766

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              LD+ +        + F  +     +    +    E      L G    L +   R  
Sbjct: 767 ARQLDIPRNEAQTYIDTYFARYPGVLRYMEETRAGAAELGYVSTLFGRRLYLPEIRDRNA 826

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
            +      +           +G +    + A +                           
Sbjct: 827 MRR-----QGAERAAINAPMQGTAADIIKKAMIN-------------------------- 855

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                      +Q ++  T G                   M           + VHDE+V
Sbjct: 856 ----------IAQWIKTETQGE----------------IAMI----------MQVHDELV 879

Query: 634 SETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            E       ++   +C LM K       + L AE      +
Sbjct: 880 FEVDADKAETLKQKVCELMAKAA--ILDVALLAEAGIGDNW 918


>gi|198245003|ref|YP_002217922.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|205354415|ref|YP_002228216.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207859193|ref|YP_002245844.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|238913940|ref|ZP_04657777.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|197939519|gb|ACH76852.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|205274196|emb|CAR39214.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|206710996|emb|CAR35364.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|326629546|gb|EGE35889.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 928

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|110835520|ref|YP_694379.1| DNA polymerase I [Alcanivorax borkumensis SK2]
 gi|110648631|emb|CAL18107.1| DNA polymerase I [Alcanivorax borkumensis SK2]
          Length = 956

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 98/708 (13%), Positives = 184/708 (25%), Gaps = 171/708 (24%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSA---------- 52
           +   D ET S   +           A +   A A  D                       
Sbjct: 379 EFAFDTETTSLNYM----------NAELVGFAVAVSD-KAAYIPFGHNYPGAPDQIDKQL 427

Query: 53  MPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSL 109
           +       L D+++  +  N  ++  +  +  GI +    +  T + +           +
Sbjct: 428 VIDKFKPLLEDDSLKKIGQNLKYDMSVLAEDAGITLRGVAF-DTMLESYVLDSVATRHDM 486

Query: 110 KNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L           GK                      +         Y   D +
Sbjct: 487 DSLALKYLGRKTISFTDIAGKGAKQL---------------TFNQIGLHEASPYAAEDAD 531

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T  L + L P  + E             L  +   I   G  +D  L+    + +A+  
Sbjct: 532 VTLRLHQTLWPKLEAEDRLPEVFRDIELPLVTVLSRIERNGTYVDATLLKHQSQFLAKRM 591

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
            +L E    +      +      L   L+    I         +  T +++L        
Sbjct: 592 AELQEKAFDIAGQEF-NLASPKQLGEILYEKLEIPVIKKTPKGAPSTAEAVLQELAHDYP 650

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +I++    +       + L E ++   GR+  +      + TGR S      QN+P 
Sbjct: 651 LPQVIMDYRGVAKLKNTYTDKLPELINQRTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 708

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   +A  GKK+V  D + IE R++A +
Sbjct: 709 -----------------------VRSEEGRKIRQAFLAPKGKKIVACDYSQIELRIMAHL 745

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+     AF  G DI+  T A+ +   +D+VS   R   K +                 
Sbjct: 746 SGDKGLTDAFEQGLDIHRATAAEVWGKTLDEVSDNDRRNAKAINF--------------G 791

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   A +  L     +     +  
Sbjct: 792 LIYGMS------------------------------AFGLAKQLGLPRKEAQEYIDLYFE 821

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++ GV +  +D                                          RRL   +
Sbjct: 822 RYPGVKKYMEDTRALAIDKGYVETVY--------------------------GRRLYLPE 855

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN------GYDIVL 626
           +               R            +Q  + DI+ + M               +++
Sbjct: 856 IHSKN---GQRRQGAERAAINAP------MQGTAADIIKKAMIKVHDWLETTHFDAKMIM 906

Query: 627 TVHDEIVSETPDTPYFS-VGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  D      V  + + M         +PL  +    + +
Sbjct: 907 QVHDELVFEVADDQVDDLVKEVKARMESAAE--LKVPLIVDAGAGENW 952


>gi|16762432|ref|NP_458049.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29143920|ref|NP_807262.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|213425460|ref|ZP_03358210.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|289829363|ref|ZP_06546975.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|25288536|pir||AH0950 DNA polymerase I [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16504737|emb|CAD03100.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29139556|gb|AAO71122.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
          Length = 928

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|168237613|ref|ZP_02662671.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194736970|ref|YP_002116921.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|204930172|ref|ZP_03221149.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|194712472|gb|ACF91693.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197289392|gb|EDY28757.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|204320576|gb|EDZ05778.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
          Length = 928

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDAVSKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|261342936|ref|ZP_05970794.1| hypothetical protein ENTCAN_09533 [Enterobacter cancerogenus ATCC
           35316]
 gi|288314684|gb|EFC53622.1| DNA polymerase I [Enterobacter cancerogenus ATCC 35316]
          Length = 930

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 200/707 (28%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A                          +
Sbjct: 354 FAFDTETDSLDNI----------SANMVGLSFATAPGVAAYVPVAHDYLDAPDQIPRDRV 403

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              +   L D+  + V  N  F+R + +   GI++    +  T + +           + 
Sbjct: 404 LELMKPVLEDDKALKVGQNLKFDRGILQNY-GIELRGIAF-DTMLESYILDSVAGRHDMD 461

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 462 SLSDRWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 506

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   I   G +ID  ++      +AQ   
Sbjct: 507 TLQLHLKMWPKLQKHEGPLNVFQHIEMPLVPVLSRIERNGVKIDPTVLHNHSGELAQRLT 566

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++   +L      +      L+  LF   GI  +  +      T + +L    +    
Sbjct: 567 ELEQKAHELAGEPF-NLSSPKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 625

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +     A  TGR S      QN+P  
Sbjct: 626 PKVILQYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVA-ATGRLSSTDPNLQNIP-- 682

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA +   +V AD + IE R++A ++
Sbjct: 683 ----------------------VRNEEGRRIRQAFIAPDDYLIVSADYSQIELRIMAHLS 720

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P++ V+ EQR   K +                  
Sbjct: 721 RDKGLLTAFAEGQDIHRATAAEVFGLPLESVTNEQRRSAKAINF--------------GL 766

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 767 IYGMS------------------------------AFGLSRQLNIPRKESQKYMDLYFER 796

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 797 YPGVLEYMERTRAQAKEKGY--------------------------VETLDGRRLYLPDI 830

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT------KNGYDIVLT 627
           K   +       +               +Q  + DI+   M          K    +++ 
Sbjct: 831 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLEKEKPRVKMIMQ 881

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM  + +    +PL  E    + +
Sbjct: 882 VHDELVFEVHKDDLEAVSRKIHELMENSMT--LDVPLLVEVGSGENW 926


>gi|87120949|ref|ZP_01076841.1| DNA polymerase I [Marinomonas sp. MED121]
 gi|86163787|gb|EAQ65060.1| DNA polymerase I [Marinomonas sp. MED121]
          Length = 925

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 98/706 (13%), Positives = 199/706 (28%), Gaps = 170/706 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSA----------M 53
              D ET S   +           A +   + + +                        +
Sbjct: 350 FAFDTETTSLNYMA----------AELVGFSVSVEAGKAAYIPVAHDYEGAPEQLDRDWV 399

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
              +   L D + + V  +  ++  +      I++    +  T + +           + 
Sbjct: 400 LEQIKPVLEDASQLKVGQHLKYDANVLANY-DIELKGIEF-DTMLESYIFNSTANRHDMD 457

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L+      +   GK                   +  +    +    Y   D + 
Sbjct: 458 SLAKKFLSHKSVSFEEIAGKGAKQ---------------KTFNQIELEQAAFYAAEDADI 502

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + +    +            E  L  +   +   G  ID DL+ +    IA   +
Sbjct: 503 TFRLHQAIWAKLEKTPELVSIFKEIELPLVPVLAKMEQTGALIDPDLLHEQSSEIATRLE 562

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
           +L+    ++      +      L+  LF+   + +          T + IL    +    
Sbjct: 563 ELEIKAHEMAGQAF-NLSSPKQLQEILFVKLELPILKKTPKGQPSTAEPILQELALDYEL 621

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
             +I+   + S       + L E +   GR+  +      + TGR S      QN+P   
Sbjct: 622 PRIIMEHRSLSKLKSTYTDKLPEMIQKTGRIHTSYHQAV-TATGRLSSTDPNLQNIP--- 677

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   IA  G KL+ AD + IE R+++ ++ 
Sbjct: 678 ---------------------IRTAEGRRIRQAFIAPEGYKLIAADYSQIELRIMSHLSQ 716

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +   ++AFAN +D++  T A+ F   +D+V+ EQR   K +                   
Sbjct: 717 DPGLLEAFANNKDVHKATAAEVFEVALDEVTGEQRRRAKAINF--------------GLI 762

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            G+                                   A +  +     +   + +  ++
Sbjct: 763 YGMS------------------------------AFGLAKQLGIGRPEAQKYIQRYFERY 792

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            GV    ++  E                                 +     RRL   D+K
Sbjct: 793 PGVRTYMENTREMAREKGY--------------------------VETLFGRRLYLPDIK 826

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT------KNGYDIVLTV 628
              + +  A     R            +Q  + DI+   M               ++L V
Sbjct: 827 ASNAMMRQAA---ERTAINAP------MQGTAADIIKRAMIEMHAWLKDTDLDIKMILQV 877

Query: 629 HDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           HDE++ E  ++   +    +  +M      A  +PL  E      +
Sbjct: 878 HDELIFEVKESDLSAAQEKILDIMENTS--AIDVPLLVEAGIGDTW 921


>gi|212637750|ref|YP_002314275.1| DNA polymerase A [Shewanella piezotolerans WP3]
 gi|212559234|gb|ACJ31688.1| DNA polymerase A [Shewanella piezotolerans WP3]
          Length = 916

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 102/701 (14%), Positives = 199/701 (28%), Gaps = 158/701 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ-----SAMPSDLL 58
           + ID ET S   +          +A +   ++A +         +         +   L+
Sbjct: 339 IAIDTETTSLNYM----------EAELVGISFAVEAGKAAYLPLSHDYVDAPEQLDKALV 388

Query: 59  -----QYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
                  L +E +  V  N  ++  +F    GI +   ++  T + +          ++ 
Sbjct: 389 FEKLTPLLENEAIKKVGQNLKYDISIFANA-GIKLKGVQF-DTMLESYVFNSVASKHNMD 446

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +    +    Y   D + 
Sbjct: 447 DLALKYLGHKNISFEEIAGKGAKQL---------------TFNQIPLETAAPYAAEDADI 491

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P  +            E  L  +  TI  +G  ID  L+ +  E +A++  
Sbjct: 492 TLRLHQHLWPRLEKLPQLASVFTDIELPLIDILSTIERQGVLIDSMLLGQQSEELARKID 551

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
            L     ++      +      L+   F   G  +       +  T + +L    +    
Sbjct: 552 DLQTKAHEIAGQPF-NLASPKQLQELFFEKLGYPIIKKTPKGAPSTAEEVLVELALDYPL 610

Query: 275 KDLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL   + +       + L   V+   GR+  +     A  TGR S      QN+P  
Sbjct: 611 PKIILEHRSLAKLKSTYTDKLPLMVNAKSGRVHTSYHQANA-ATGRLSSSEPNLQNIP-- 667

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA  G+K++ AD + IE R++A ++
Sbjct: 668 ----------------------IRTEEGRRIRHAFIAPEGRKILAADYSQIELRIMAHLS 705

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F+    +V+ +QR   K +   L Y            
Sbjct: 706 QDKGLLTAFAEGKDIHKATAAEVFDVDFSEVTSDQRRRAKAVNFGLIYGMS-----AFGL 760

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              LD+ +        + F+ +    ++    +    +      L G    L        
Sbjct: 761 AKQLDIPRAEAQRYIDTYFKRYPGVLNYMEETRAIATDLGYVSTLFGRRLYL-------- 812

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
              +        +                      ++                       
Sbjct: 813 -PAIKDRNAMRRQAAERAAINAPMQGTAADIIKKAMINV--------------------- 850

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                      ++ +   T G                             +++ VHDE+V
Sbjct: 851 -----------AKWIETETNGE--------------------------ITMIMQVHDELV 873

Query: 634 SETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            E       S+   +C LM    +    + L AE      +
Sbjct: 874 FEVDADKADSLQVKICELMAAAAT--LDVELLAEAGIGDNW 912


>gi|145628242|ref|ZP_01784043.1| DNA polymerase I [Haemophilus influenzae 22.1-21]
 gi|145638340|ref|ZP_01793950.1| DNA polymerase I [Haemophilus influenzae PittII]
 gi|144980017|gb|EDJ89676.1| DNA polymerase I [Haemophilus influenzae 22.1-21]
 gi|145272669|gb|EDK12576.1| DNA polymerase I [Haemophilus influenzae PittII]
 gi|309751482|gb|ADO81466.1| DNA polymerase I [Haemophilus influenzae R2866]
          Length = 935

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 203/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDR----------TEQS 51
             + +D ET S   +           A +   ++A ++                   E+S
Sbjct: 359 KLIAVDTETDSLDYM----------SANLVGISFALENGEAAYLPLQLDYLDAPKTLEKS 408

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + +   L +  +  +  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 409 TALAAIKPILENPNIHKIGQNIKFDESIFARH-GIELQGVEF-DTMLLSYTLNSTGRHNM 466

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +   EY   D +
Sbjct: 467 DDLAKRYLGHETIAFESIAGKGKSQL---------------TFNQIPLEQATEYAAEDAD 511

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L      E             L  +   +   G  ID + +      IA   
Sbjct: 512 VTMKLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSNALFMQSNEIATRL 571

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L+E    L      +   T  L+  LF   G+         +  T + +L   + +  
Sbjct: 572 TALEEQAYALAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELSYSHE 630

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+S  GR+  +      + TGR S      QN+P 
Sbjct: 631 LPKILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 688

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA  G  +V AD + IE R++A +
Sbjct: 689 -----------------------IRNEEGRRIRQAFIAREGYSIVAADYSQIELRIMAHL 725

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+   I AF+ G+DI+ +T A+ F   +D+++ EQR   K +                 
Sbjct: 726 SGDQGLINAFSQGKDIHRSTAAEIFGVSLDEITSEQRRNAKAINF--------------G 771

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   + +  +     +     +  
Sbjct: 772 LIYGMS------------------------------AFGLSRQLGISRADAQKYMDLYFQ 801

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V Q   D+ E                                 +     RRL   D
Sbjct: 802 RYPSVQQFMTDIREKAKAQGY--------------------------VETLFGRRLYLPD 835

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +        ++++ 
Sbjct: 836 INSSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKLDEVIRHDPDIEMIMQ 886

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  E    + +
Sbjct: 887 VHDELVFEVRSEKVAFFREQIKQHMEAAAELV--VPLIVEVGVGQNW 931


>gi|268592231|ref|ZP_06126452.1| DNA polymerase I [Providencia rettgeri DSM 1131]
 gi|291312280|gb|EFE52733.1| DNA polymerase I [Providencia rettgeri DSM 1131]
          Length = 930

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 99/702 (14%), Positives = 198/702 (28%), Gaps = 159/702 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S             ++A +   ++A +                        +
Sbjct: 352 FAFDTETDSLD----------TQEARLVGMSFAIEPGHAAYLPLGHDYLDAPVQLPLEEV 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL-----PSS 108
              +   L  E ++ +  N  ++  + +    I++    +  T + +             
Sbjct: 402 LELMKPILESENILKIGQNLKYDAEVLENY-DIELKGIGY-DTMLESYVLNSVAGMGRHD 459

Query: 109 LKNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           + +     LN      +   GK                      +  A +    Y   D 
Sbjct: 460 MDSLADRHLNHKTVSFEEIAGKGKKQL---------------TFNQIALEEAANYAAEDA 504

Query: 168 EATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
           + T  L + L P  + E             L  +   +  +G  ID +++    ++I   
Sbjct: 505 DVTLLLHQALYPQLEAEPKLNHIFQNIEMPLVPVLVRMERKGVLIDANVLAAQSKVITAR 564

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQ 272
             +L+++  +L      +      L+  LF    +         +  T + +L    +  
Sbjct: 565 LAELEKEAFELAGEEF-NLASPKQLQTILFEKLQLPVIKKTPSGAASTNEEVLEELALNH 623

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
               L+L   + +       + L   ++   +   T      + TGR S      QN+P 
Sbjct: 624 ALPKLLLEHRSLAKLKSTYTDKLPLMINPRTQRVHTSYHQAVTATGRLSSRDPNLQNIP- 682

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA  G K++ AD + IE R++A +
Sbjct: 683 -----------------------VRTEEGRRIRQAFIAREGYKVMAADYSQIELRIMAHL 719

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           + +   + AFA G+DI+  T A+ F  P+++V+ +QR   K +   L Y           
Sbjct: 720 SQDKGLLTAFAEGKDIHKATAAEVFGVPLEQVTSDQRRSAKAINFGLIYGMS-----AFG 774

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
               L + +          FE +     +    + Q  E    + L G    L       
Sbjct: 775 LARQLGIPRGEAQRYMDLYFERYPGVLRYMENTRLQASEQGYVETLEGRRLYLA------ 828

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
               +        +                 A++ +  M      +    P         
Sbjct: 829 ---DIKSSNGMRRKAAEREAINAPMQGTA--ADIIKKAMIAVDNWLQTEKPH-------- 875

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEI 632
                                              D+L               + VHDE+
Sbjct: 876 ----------------------------------ADML---------------MQVHDEL 886

Query: 633 VSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           V E  ++    V   + SLM ++      +PLK +      +
Sbjct: 887 VFEVKESELERVQAQVQSLMEQSMK--LDVPLKVDVGIGDNW 926


>gi|261866908|ref|YP_003254830.1| DNA polymerase I [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412240|gb|ACX81611.1| DNA polymerase I (POL I) [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 933

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 105/707 (14%), Positives = 198/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRT----------EQS 51
             + +D ET     +           A +   ++A ++                   E++
Sbjct: 357 KLIAVDTETDGLDYM----------SANLVGVSFALENGEAAYLPLHLDYLGAPKTLEKN 406

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              S L   L +  +  +  N  F+  +F +  GID+    +  T +L+ T       ++
Sbjct: 407 TALSALKPILENPNIGKIGQNLKFDMTIFARN-GIDLQGIEF-DTMLLSYTLDSTGRHNM 464

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +  GEY   D +
Sbjct: 465 DDLAKRYLGHQTISFEDIAGKGKNQL---------------TFNQIPLEQAGEYAAEDAD 509

Query: 169 ATRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L                 E  L  +   +   G  ID D +      I +  
Sbjct: 510 VTMKLQQVLWQKLQPQPGLVELYQSIELPLLGVLSRMERYGVLIDSDALFLQSNEITERL 569

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L+     L      +   T  L+  LF   G+            T + +L     +  
Sbjct: 570 TALEMQAHTLAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGVPSTNEEVLEELAYSHE 628

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+   GR+  +      + TGR S      QN+P 
Sbjct: 629 LPKVLVEHRGLSKLKSTYTDKLPQMVNPQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 686

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                      A   +R   IA +G K++ AD + IE R++A +
Sbjct: 687 -----------------------IRNEAGRRIRQAFIARDGYKIIAADYSQIELRIMAHL 723

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           + +   I AFA G+DI+ +T A+ F  P+++V+ EQR   K +   L Y        +  
Sbjct: 724 SNDQGLINAFAQGKDIHRSTAAEIFGLPLEQVTSEQRRNAKAINFGLIYG-----MSSFG 778

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
                                                     +  +     +     +  
Sbjct: 779 LS---------------------------------------RQLGISRADAQRYMDLYFQ 799

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V     D+ E                                 +     RRL   +
Sbjct: 800 RYPNVQTFIHDIREKAKAQGY--------------------------VETLFGRRLYLPE 833

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT-----KNGYDIVLT 627
           +    +          R            +Q  + D +   M              +++ 
Sbjct: 834 INSSNAMRR---KGAERVAINAP------MQGTAADTIKRAMIKLDGITRDDPDIHMIMQ 884

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  +    + +
Sbjct: 885 VHDELVFEVRSEKIAFFSDLIKQHMEAAAELV--VPLIVDVGVGENW 929


>gi|227355154|ref|ZP_03839565.1| DNA polymerase I [Proteus mirabilis ATCC 29906]
 gi|227164941|gb|EEI49788.1| DNA polymerase I [Proteus mirabilis ATCC 29906]
          Length = 949

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 207/707 (29%), Gaps = 170/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                        +
Sbjct: 372 FAFDTETDSLNNI----------DARLIGLSFAVEPGKAAYIPLRHDYLDAPEQLPVDEV 421

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
            + L   L D+T++ +  N  F+R + +   GI++    +  T + +           + 
Sbjct: 422 LTALKPILEDKTILKIGQNLKFDRGIMEN-EGIELNGI-YFDTMLESYVLNSVSSRHDMD 479

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 LN      +   GK                      +    +    Y   D + 
Sbjct: 480 TLAEKHLNHKTTTFEEIAGKGKGQL---------------TFNQIEVEQATLYAAEDADI 524

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P  +            E  L  +   +  +G  ID  ++    + I Q   
Sbjct: 525 TLLLHQALYPQIEAIAPLKHVYHDIEMPLVPVLSRMERKGVLIDAQVLAMQSQEITQRLA 584

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
           +++++   L      +      L+  LF    + +       +  T + +L     +   
Sbjct: 585 EIEKETFALAGQEF-NLSSPKQLQEILFEKLNLPIIKKTPKGAPSTNEEVLEALAHSHEL 643

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
             LIL     +       + L   V+S  +   T      + TGR S      QN+P   
Sbjct: 644 PRLILEHRGLAKLKSTYTDKLPLMVNSKTKRVHTSYHQAVTATGRLSSRDPNLQNIP--- 700

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   I  +G K+V AD + IE R++A ++ 
Sbjct: 701 ---------------------VRNEEGRRIRQAFIVRDGFKIVAADYSQIELRIMAHLSQ 739

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +   + AFA G+DI+  T ++ F  P+D+V+ EQR   K +                   
Sbjct: 740 DKGLLDAFAQGKDIHRATASEVFGIPLDEVTAEQRRSAKAINFG--------------LI 785

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
            G+     SQ +                               +     +     +  ++
Sbjct: 786 YGMSAFGLSQQI------------------------------GVERKEAQRYMDLYFERY 815

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
            GVL   +   +  +                              +     RRL   ++ 
Sbjct: 816 PGVLDYMERTRKQASQQGY--------------------------VETLDGRRLYLPEIN 849

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK-------NGYDIVLT 627
              +    A+    RE           +Q  + DI+ + M            +   +++ 
Sbjct: 850 SKNAIRRKAS---EREAINAP------MQGTAADIIKKAMIAVDNWICHECPDDVHMIMQ 900

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E  ++        +  LM  +   A  +PLK E      +
Sbjct: 901 VHDELVFEVRESYLEKANAMIHKLMESSMELA--IPLKVEVGVGNNW 945


>gi|167551523|ref|ZP_02345278.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205323683|gb|EDZ11522.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
          Length = 928

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKSGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|145630606|ref|ZP_01786386.1| DNA polymerase I [Haemophilus influenzae R3021]
 gi|144983996|gb|EDJ91438.1| DNA polymerase I [Haemophilus influenzae R3021]
          Length = 743

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 107/707 (15%), Positives = 202/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDR----------TEQS 51
             + +D ET S   +           A +   ++A ++                   E+S
Sbjct: 167 KLIAVDTETDSLDYM----------SANLVGISFALENGEAAYLPLQLDYLDAPKTLEKS 216

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + +   L +  +  +  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 217 TALAAIKPILENPNIHKIGQNIKFDESIFARH-GIELQGVEF-DTMLLSYTLNSTGRHNM 274

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +   EY   D +
Sbjct: 275 DDLAKRYLGHETIAFESLAGKGKSQL---------------TFNQIPLEQATEYAAEDAD 319

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L      E             L  +   +   G  ID D +      IA   
Sbjct: 320 VTMKLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSDALFIQSNEIATRL 379

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L++    L      +   T  L+  LF   G+         +  T + +L   + +  
Sbjct: 380 TALEKQAYALAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELSYSHE 438

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+S  GR+  +      + TGR S      QN+P 
Sbjct: 439 LPKILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 496

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA  G  +V AD + IE R++A +
Sbjct: 497 -----------------------IRNEEGRRIRQAFIAREGYSIVAADYSQIELRIMAHL 533

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+   I AF+ G+DI+ +T A+ F   +D+V+ EQR   K +                 
Sbjct: 534 SGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------G 579

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   + +  +     +     +  
Sbjct: 580 LIYGMS------------------------------AFGLSRQLGISRPDAQKYMDLYFQ 609

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V Q   D+                                   +     RRL   D
Sbjct: 610 RYPSVQQFMTDIRAKAKAQGY--------------------------VETLFGRRLYLPD 643

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +        ++++ 
Sbjct: 644 INSSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKIDEVIRHDPDIEMIMQ 694

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  E    K +
Sbjct: 695 VHDELVFEVRSEKVAFFREQIKQHMEAAAELV--VPLIVEVGVGKNW 739


>gi|229845908|ref|ZP_04466020.1| DNA polymerase I [Haemophilus influenzae 7P49H1]
 gi|229810912|gb|EEP46629.1| DNA polymerase I [Haemophilus influenzae 7P49H1]
 gi|309973653|gb|ADO96854.1| DNA polymerase I [Haemophilus influenzae R2846]
          Length = 930

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 202/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDR----------TEQS 51
             + +D ET S   +           A +   ++A ++                   E+S
Sbjct: 354 KLIAVDTETDSLDYI----------SANLVGISFALENGEATYLPLQLDYLDAPKTLEKS 403

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + +   L +  +  +  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 404 TALAAIKPILENPNIHKIGQNIKFDESIFARH-GIELQGVEF-DTMLLSYTLNSTGRHNM 461

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +   EY   D +
Sbjct: 462 DDLAKRYLGHETIAFESLAGKGKSQL---------------TFNQIPLEQATEYAAEDAD 506

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L      E             L  +   +   G  ID D +      IA   
Sbjct: 507 VTMKLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSDALFIQSNEIATRL 566

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L++    L      +   T  L+  LF   G+         +  T + +L   + +  
Sbjct: 567 TALEKQAYALAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELSYSHE 625

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+S  GR+  +      + TGR S      QN+P 
Sbjct: 626 LPKILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 683

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA  G  +V AD + IE R++A +
Sbjct: 684 -----------------------IRNEEGRRIRQAFIAHEGYSIVAADYSQIELRIMAHL 720

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+   I AF+ G+DI+ +T A+ F   +D+V+ EQR   K +                 
Sbjct: 721 SGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------G 766

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   + +  +     +     +  
Sbjct: 767 LIYGMS------------------------------AFGLSRQLGISRPDAQKYMDLYFQ 796

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V Q   D+                                   +     RRL   D
Sbjct: 797 RYPSVQQFMTDIRAKAKAQGY--------------------------VETLFGRRLYLPD 830

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +        ++++ 
Sbjct: 831 INSSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKIDEVIRHDPDIEMIMQ 881

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  E    + +
Sbjct: 882 VHDELVFEVRSEKVAFFREQIKQHMEAAAELV--VPLIVEVGVGQNW 926


>gi|261856277|ref|YP_003263560.1| DNA polymerase I [Halothiobacillus neapolitanus c2]
 gi|261836746|gb|ACX96513.1| DNA polymerase I [Halothiobacillus neapolitanus c2]
          Length = 940

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/709 (15%), Positives = 196/709 (27%), Gaps = 170/709 (23%)

Query: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------Q 50
           M  +  D ET S                 I   +++ +D                    +
Sbjct: 362 MDWVAFDTETDSLDLFA----------GRIVGVSFSIEDNRAAYVPLAHNYPGAPAQLDR 411

Query: 51  SAMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---S 107
             + +DL  +L D +   V  N+ F+  +     GI +       T + +          
Sbjct: 412 DTVLADLKPWLEDASRTKVMQNAKFDSHMLANH-GITLRGV-LFDTMLESYVLDSTATRH 469

Query: 108 SLKNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRD 166
            + +     L  S    +   GK                    +      +  G Y   D
Sbjct: 470 DMDSLAAKYLGRSTITFEDIAGKGAK---------------ALSFPEIHLEQAGPYAAED 514

Query: 167 VEATRELFKRLIPLSD-----------GERDLWLLDQTINDRGYRIDLDLVLKLQELIAQ 215
            + T +L + L P               E+ L  +   +   G R+D   +    + I +
Sbjct: 515 ADVTGQLQQCLWPKLSVEPDLRSVYETIEQPLIEVLVAMERAGVRVDRGELAIQGKAIGE 574

Query: 216 ERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLIT----GIDLVDMSEGTLKSILSHSNIT 271
               +++   K       +   T  L+  LF       G         T +  L     +
Sbjct: 575 RIAAVEQAAFKEAGREF-NLGSTKQLKELLFDELKLPVGKKTPKGEPSTDEEALGELVGS 633

Query: 272 QLAKDLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNL 330
                LIL+    S      ++ L E +    GR+         + TGR S      QN+
Sbjct: 634 HPLPALILDYRGLSKLKSTYIDRLPEDIHTHTGRVHSAFHQAV-TATGRLSSSNPNLQNI 692

Query: 331 PRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLA 390
           P                                +R   +A  G KL+ AD + IE R++A
Sbjct: 693 P------------------------IRSEEGRRIRQAFVADPGCKLISADYSQIELRIMA 728

Query: 391 WIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKT 450
            ++ ++    AFA GEDI+  T A+ F     +VS  QR   K +               
Sbjct: 729 HLSEDERLCAAFAAGEDIHRATAAEVFGVKEVEVSDNQRRAAKAINF------------- 775

Query: 451 MASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAW 510
                G+                                   A +  +     +     +
Sbjct: 776 -GLIYGMS------------------------------AFGLAKQLDVPRGEAQAYIDLY 804

Query: 511 RAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVY 570
            A++ GV +  + + +    +                                  RRL  
Sbjct: 805 FARYPGVAKYMERMRQQARQMGYVETVF--------------------------GRRLYL 838

Query: 571 SDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIV 625
            ++               R            +Q  + DI+   M    K         ++
Sbjct: 839 PEIHSRNGQRRQYA---ERTAINAP------MQGTAADIIKIAMIALHKLLVVPGRARMI 889

Query: 626 LTVHDEIVSETPDTPYFSVGTLCS-LMTKNPSWAKGLPLKAEGYEAKRY 673
           L VHDE++ E P++    +  +    MT        +PL+      + +
Sbjct: 890 LQVHDELIFEVPESDVAEIEPIIRAQMTGAAK--LNVPLEVGIGIGRSW 936


>gi|809180|pdb|1KLN|A Chain A, Dna Polymerase I Klenow Fragment (E.C.2.7.7.7) MutantDNA
           Complex
          Length = 605

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 105/703 (14%), Positives = 194/703 (27%), Gaps = 171/703 (24%)

Query: 8   IETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAMPSDL 57
            ET S   +           A +   ++A +                            L
Sbjct: 33  TETDSLDNI----------SANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERALELL 82

Query: 58  LQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLKNACL 114
              L DE  + V  N  ++R +     GI++    +  T + +           + +   
Sbjct: 83  KPLLEDEKALKVGQNLKYDRGILANY-GIELRGIAF-DTMLESYILNSVAGRHDMDSLAE 140

Query: 115 A-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATREL 173
             L       +   GK                      +  A +  G Y   D + T +L
Sbjct: 141 RWLKHKTITFEEIAGKGKNQL---------------TFNQIALEEAGRYAAEDADVTLQL 185

Query: 174 FKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDE 222
             ++ P               E  L  +   I   G +ID  ++    E +     +L++
Sbjct: 186 HLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEK 245

Query: 223 DIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLAKDLI 278
              ++      +   T  L+  LF   GI  +  +      T + +L    +      +I
Sbjct: 246 KAHEIAGEEF-NLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVI 304

Query: 279 LNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSE 337
           L     +       + L   ++   GR+  +      + TGR S      QN+P      
Sbjct: 305 LEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP------ 357

Query: 338 EILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDW 397
                                     +R   IA     +V AD + IE R++A ++ +  
Sbjct: 358 ------------------VRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKG 399

Query: 398 KIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGL 457
            + AFA G+DI+  T A+ F  P++ V+ EQR   K +                    G+
Sbjct: 400 LLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINF--------------GLIYGM 445

Query: 458 DLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGV 517
                                              A +  +     +     +  ++ GV
Sbjct: 446 S------------------------------AFGLARQLNIPRKEAQKYMDLYFERYPGV 475

Query: 518 LQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDC 577
           L+  +                                     +     RRL   D+K   
Sbjct: 476 LEYMERTRAQAKEQGY--------------------------VETLDGRRLYLPDIKSSN 509

Query: 578 SYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLTVHDE 631
                A  +               +Q  + DI+   M               +++ VHDE
Sbjct: 510 GARRAAAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHDE 560

Query: 632 IVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           +V E       +V   +  LM         +PL  E    + +
Sbjct: 561 LVFEVHKDDVDAVAKQIHQLMENCTR--LDVPLLVEVGSGENW 601


>gi|117618452|ref|YP_854729.1| DNA polymerase I [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117559859|gb|ABK36807.1| DNA polymerase I [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 917

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 103/708 (14%), Positives = 195/708 (27%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQS----------AM 53
              D ET S   +          +A +   ++A +                        +
Sbjct: 340 FAFDTETTSLDYM----------EARVVGVSFAIEPGKAAYVPFGHDYLGAPVQLTEAVV 389

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSLK 110
              L   L D   + V  N  ++R +     GI++    +  T + +           + 
Sbjct: 390 LGKLKPLLEDPARLKVGQNLKYDRNVLLNH-GIELQGIAY-DTMLESYVLNSTASRHDMD 447

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     LN      +   GK +                    +    +    Y   D + 
Sbjct: 448 SLARRYLNAETISFEEIAGKGVKQL---------------TFNQIELEQAAPYAAEDADI 492

Query: 170 TRELFKRLIPLS-----------DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L               + E  L  +   +   G  I+  L+ +  + I     
Sbjct: 493 TLRLHQALWGKLSAEPGLAKVFSEIELPLLPVLARMERLGTTIEPKLLHQQSQEIEVRLA 552

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
           +L++   +L      +      L   LF   G+ +       +  T + +L+    T   
Sbjct: 553 ELEKQAHELAGQEF-NLSSPKQLGEILFTKLGLPIIKKTPKGAPSTAEEVLAELAETYEL 611

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             L++     +       + L   +    GR+  +     A  TGR S      QN+P  
Sbjct: 612 PQLLMEHRGLAKLKSTYTDKLPLMIKPQTGRVHTSYHQAVA-ATGRLSSTDPNLQNIP-- 668

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   I   G KLV AD + IE R++A ++
Sbjct: 669 ----------------------VRNEQGRRIRQAFIPCAGYKLVAADYSQIELRIMAHLS 706

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
           G+   + AFA G+DI+  T A+ F   ++ V+ + R   K +                  
Sbjct: 707 GDKGLLTAFAEGKDIHKATAAEVFGVALEAVTSDMRRSAKAIN--------------FGL 752

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 753 IYGMS------------------------------AFGLAKQLGIGRAEAQKYMDLYFER 782

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +   +                                 +     RRL   D+
Sbjct: 783 YPGVLEYMERTRQQADAQGY--------------------------VETLFGRRLYLPDI 816

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKN-------ATKNGYDIVL 626
           K   + L        R            +Q  + DI+   M N              +++
Sbjct: 817 KSRNAGLR---KAAERAAINAP------MQGTAADIIKRAMINVDGWIRGIEDQSIRMLM 867

Query: 627 TVHDEIVSETPDTPYFS-VGTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  +      +  +   M+        +PL  E      +
Sbjct: 868 QVHDELVFEIREEKLEEYIAIIKEKMSAAAE--LDVPLVVEAGTGDNW 913


>gi|260775065|ref|ZP_05883964.1| DNA polymerase I [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608982|gb|EEX35142.1| DNA polymerase I [Vibrio coralliilyticus ATCC BAA-450]
          Length = 931

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 105/708 (14%), Positives = 198/708 (27%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A ++                       +
Sbjct: 354 FAFDTETDSLDYMV----------ANLVGVSFATEEGVAAYVPVAHDYLDAPEQLDRDWV 403

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L D+    V  N  ++  +  +  GI++   +   T + +           + 
Sbjct: 404 LEQLKPILEDDAQAKVGQNLKYDASVLARY-GIEMKGIK-HDTMLASYVYNSVGGKHDMD 461

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L  S    +   GK                      +    +    Y   D + 
Sbjct: 462 SLALRFLQHSCISFEQIAGKGKKQL---------------TFNQIELEQASPYAAEDADV 506

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L  RL+   +            E  L  +   I   G  ID   +    + IA    
Sbjct: 507 TLRLHNRLLANIEQDEKLKTIYEEVEVPLVPVLSRIERTGVLIDDMKLAAQSQEIALRLD 566

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
           +L++   ++ +    +      L+  LF   G+         +  T + +L    +    
Sbjct: 567 ELEQQAFEIAEQEF-NMNSPKQLQAILFEKMGLPVVKKTPSGTPSTNEEVLQELALDYPL 625

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             LIL     +       + L + ++   GR+  +      + TGR S      QN+P  
Sbjct: 626 PKLILEYRGLAKLKSTYTDKLPKMINPETGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 682

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA +G K++  D + IE R++A ++
Sbjct: 683 ----------------------IRNDEGRRIRQAFIAPHGYKIMAVDYSQIELRIMAHLS 720

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
           G+   + AF  G+DI+  T A+     I++VS EQR   K +                  
Sbjct: 721 GDKALLDAFQQGKDIHAATAAEIIGVDIEQVSAEQRRRAKAVN--------------FGL 766

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   A +  +     +     +  +
Sbjct: 767 IYGMS------------------------------AFGLAKQLGIPRGEAQQYMDTYFER 796

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GV+Q  +D     A                                    RRL   ++
Sbjct: 797 YPGVMQYMEDTRSAAAEQGYVETIF--------------------------GRRLHLPEI 830

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK-------NGYDIVL 626
           K              R            +Q  + DI+ + M    +           +++
Sbjct: 831 KSRNGMRR---KAAERAAINAP------MQGTAADIIKKAMLLVDEWIESQGQGRVKLLM 881

Query: 627 TVHDEIVSETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE+V E  ++    +   +  LM         +PL AE      +
Sbjct: 882 QVHDELVFEVQESALAEIESKVQELMESAAQ--LDVPLIAEAGHGDNW 927


>gi|148826499|ref|YP_001291252.1| DNA polymerase I [Haemophilus influenzae PittEE]
 gi|148716659|gb|ABQ98869.1| DNA polymerase I [Haemophilus influenzae PittEE]
          Length = 930

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 202/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDR----------TEQS 51
             + +D ET S   +           A +   ++A ++                   E+S
Sbjct: 354 KLIAVDTETDSLDYI----------SANLVGISFALENGEATYLPLQLDYLDAPKTLEKS 403

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + +   L +  +  +  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 404 TALAAIKPILENPNIHKIGQNIKFDESIFARH-GIELQGVEF-DTMLLSYTLNSTGRHNM 461

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +   EY   D +
Sbjct: 462 DDLAKRYLGHETIAFESLAGKGKSQL---------------TFNQIPLEQATEYAAEDAD 506

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L      E             L  +   +   G  ID D +      IA   
Sbjct: 507 VTMKLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSDALFIQSNEIATRL 566

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L++    L      +   T  L+  LF   G+         +  T + +L   + +  
Sbjct: 567 TALEKQAYALAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELSYSHE 625

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+S  GR+  +      + TGR S      QN+P 
Sbjct: 626 LPKILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 683

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA  G  +V AD + IE R++A +
Sbjct: 684 -----------------------IRNEEGRRIRQAFIAHEGYSIVAADYSQIELRIMAHL 720

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+   I AF+ G+DI+ +T A+ F   +D+V+ EQR   K +                 
Sbjct: 721 SGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------G 766

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   + +  +     +     +  
Sbjct: 767 LIYGMS------------------------------AFGLSRQLGISRLDAQKYMDLYFQ 796

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V Q   D+                                   +     RRL   D
Sbjct: 797 RYPSVQQFMTDIRAKAKAQGY--------------------------VETLFGRRLYLPD 830

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +        ++++ 
Sbjct: 831 INSSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKIDEVIRHDPDIEMIMQ 881

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  E    + +
Sbjct: 882 VHDELVFEVRSEKVAFFREQIKQHMEAAAELV--VPLIVEVGVGQNW 926


>gi|331006814|ref|ZP_08330074.1| DNA polymerase I [gamma proteobacterium IMCC1989]
 gi|330419366|gb|EGG93772.1| DNA polymerase I [gamma proteobacterium IMCC1989]
          Length = 782

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 99/702 (14%), Positives = 205/702 (29%), Gaps = 154/702 (21%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +          QA I   ++A +                        +
Sbjct: 199 FAFDTETTSLDYM----------QAKIVGVSFAVNAGEAAYVPCGHDYMGAPEQLSLECV 248

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
            + L   L +     V  N  +++ +      ID+    +  T + +           + 
Sbjct: 249 LAALKPLLENPNKHKVGQNLKYDKHVLLNH-DIDLQGIAY-DTMLESYVCNSVATRHDMD 306

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L+ S    +   GK    +                 +    ++   Y   D + 
Sbjct: 307 SLARFYLDRSTIHFEDVAGKKGAKQL--------------TFNQIDIEIAAPYAAEDADV 352

Query: 170 TRELFKRLIPLSDGER-----------DLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L + + P    E             L  +   I   G  +D  L+ +    + Q  K
Sbjct: 353 TLQLHQAIWPTLQQEPTLQHVLESIEIPLLPVISRIERNGALVDATLLGQQSIELEQRLK 412

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQLA 274
           +L+++   +      +      L + LF    + +       +  T + +L    +    
Sbjct: 413 ELEKEAFDIAGEEF-NLSSPKQLGVILFEKLELPIIKKTPKGAPSTAEEVLQELALDYPL 471

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +++     S       + L + ++   GR+  +      + TGR S      QN+P  
Sbjct: 472 PKVLIEHRGLSKLKSTYTDKLPQMINPATGRIHTSYHQAV-TATGRLSSSDPNLQNIP-- 528

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   +A  G K++ AD + IE R++A ++
Sbjct: 529 ----------------------IRNAEGRRIRQAFVAPKGYKILAADYSQIELRIMAHLS 566

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
           G++  ++AF  G+D++  T A+ F   +D+V++EQR   K +   L Y            
Sbjct: 567 GDEGLLEAFNQGKDVHSATAAEVFGVELDQVTQEQRRRAKAINFGLIYGMS-----AFGL 621

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              L + +          FE +   +S+   ++ Q       + L G    L        
Sbjct: 622 AKQLGVGRNDAQQYIDVYFERYPGVKSYMDGVRQQAAVDGYVETLEGRRLYL-------- 673

Query: 514 HQGVLQLWKDLTEGFAC-VVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
              +        +      +      +A  +     + + +              L  ++
Sbjct: 674 -PEINARNGMRRQAAERTAINAPMQGTAADIIKRAMIAVDQW-------------LCPTN 719

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEI 632
            K +                                     M           + VHDE+
Sbjct: 720 PKDE-------------------SAVNAK------------MI----------MQVHDEL 738

Query: 633 VSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           V E  ++   +V   L  +MT        +PL  +      +
Sbjct: 739 VLEVKESDLDAVREKLKRVMTTTVE--LSVPLIVDVGVGDNW 778


>gi|319943201|ref|ZP_08017484.1| DNA-directed DNA polymerase I [Lautropia mirabilis ATCC 51599]
 gi|319743743|gb|EFV96147.1| DNA-directed DNA polymerase I [Lautropia mirabilis ATCC 51599]
          Length = 977

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 113/701 (16%), Positives = 201/701 (28%), Gaps = 158/701 (22%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SA 52
           ++ ID ET S  P            A +   + A                          
Sbjct: 401 RVAIDTETTSKDP----------HAARLVGISLAVTPWQGCYIPVGHNYAGVPEQLPLDE 450

Query: 53  MPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSLK 110
           + + L  +L  +    V  N  ++  +     GI +       T + +          + 
Sbjct: 451 VLAVLKPWLESDAQQKVGQNIKYDMHVLANH-GITLRGV-VDDTMLESYVLEAHRTHGMD 508

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
                 LN +    +   GK                         A  +   Y   D + 
Sbjct: 509 ALAGRHLNRTTITYEEVAGKGAK---------------AIGFDQVALDVATPYAAEDADV 553

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L + L P  +            E     +   +   G  +D D +    + +A++ +
Sbjct: 554 TLQLHRTLWPAIEASERLRHIYRNIEMPTLQVLYDMERHGVLLDRDRLRAQSQQLAEQLQ 613

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L+    +L      +   T  L   LF   G+ +V  +      T +S+L    +    
Sbjct: 614 ELERQAHELAGQPF-NLGSTKQLGEILFERLGLPVVKKTPAGKPSTDESVLEKLALDYPL 672

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             ++L     +       + L E V    GR+  T     A  TGR +      QN+P  
Sbjct: 673 PKVLLQWRGLAKLKSTYTDKLPEMVDPKTGRVHTTYSQAVA-ITGRLASSDPNLQNIP-- 729

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA  G +++ AD + IE R++A I+
Sbjct: 730 ----------------------VRTPEGRRIREAFIAPPGHQMMSADYSQIELRIMAHIS 767

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   +KAFA+GED++  T ++ F  PI +V+ EQR   KV+   L Y            
Sbjct: 768 QDAGLLKAFADGEDVHRATASEVFGVPIAEVNSEQRRYAKVINFGLIYGMS-----AFGL 822

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              L +++ +        F  +    ++    + Q  E    + + G    L        
Sbjct: 823 AANLGIERGAAQAYIDRYFARYPGVAAYMERTRAQAREQGYVETVFGRRLWL-------- 874

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
              +        +                                        +L   DV
Sbjct: 875 -PEIGSSNMGRRQMAERAAINAPMQGTAADLI---------------------KLAMIDV 912

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                         +R    G +L    +Q                        VHDE+V
Sbjct: 913 HA-----------WLRRENLGARLV---MQ------------------------VHDELV 934

Query: 634 SETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            E PD     +   L + M         +PL AE    + +
Sbjct: 935 LEVPDAEVERLKTDLPARMAGVAQ--LSVPLLAEVGVGENW 973


>gi|12002056|gb|AAG43170.1|AF071212_1 DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Typhimurium]
          Length = 928

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V++EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTREQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +                Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPTQGTAADIIKRAMIAVDAWIQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|92112681|ref|YP_572609.1| DNA polymerase I [Chromohalobacter salexigens DSM 3043]
 gi|91795771|gb|ABE57910.1| DNA polymerase I [Chromohalobacter salexigens DSM 3043]
          Length = 928

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 101/707 (14%), Positives = 190/707 (26%), Gaps = 169/707 (23%)

Query: 3   KLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQS----------A 52
               D+ET S   +          +A I     + D           +           +
Sbjct: 351 IFCFDLETTSLNYM----------EADIVGIGLSLDAGEAAYIPVAHRYLDAPEQLDRAS 400

Query: 53  MPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP---SSL 109
           + + L     D     +  N  ++  +  +   I++   R   T + +           +
Sbjct: 401 VLAALKPLWEDPAKAKIGQNLKYDISVLARY-DIEVAG-RLEDTMLASYVLNATATRHDM 458

Query: 110 KNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                         A +    Y   DV+
Sbjct: 459 DSLALKYLGEKTISFEEIAGKGAKQL---------------TFDQIALEQAAPYACEDVD 503

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T  L + L P  DGE             L  +   +   G  +D + +      + +  
Sbjct: 504 ITLRLHRELRPRVDGEGRLAAVLDDIELPLVPVLSRMERNGVALDAERLHAQSRELEKRL 563

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
           ++L+    +L      +      L   LF    I         +  T +++L    +   
Sbjct: 564 RELETRAYELAGREF-NLGSPKQLGEILFDELKIPVIKKTPKGAPSTAEAVLEELALDYP 622

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
              +I+     +       + L + V++  R   T      + TGR S      QN+P  
Sbjct: 623 LPKVIIEHRGFAKLKSTYTDKLPQLVNATTRRLHTSYHQAVTATGRLSSSDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   +A  G ++V AD + IE R++A ++
Sbjct: 681 ----------------------IRTEEGRKIRQAFVARPGYRIVAADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
           G+   + AFA G DI+  T A+ F   +D VS EQR   K +                  
Sbjct: 719 GDKGLLDAFAEGRDIHTATAAEVFGVALDAVSGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                     +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AWGLGRQLHIERNQAQTYIDRYFDR 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GV +  + +    A                                    RRL   ++
Sbjct: 795 YPGVARFMERIRAQAADDGYVETVF--------------------------GRRLYLPEI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN------GYDIVLT 627
                    A     R            +Q  + DI+   M +  +          +V+ 
Sbjct: 829 NAQNRTRRQAA---ERTAINAP------MQGTAADIIKLAMIDVDRWLREGDFDAWMVMQ 879

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E  +    +    +   M         +PL  E      +
Sbjct: 880 VHDELVFEVKEAQVDAFTDAVRQRMEGAAK--LDVPLTVEANAGDNW 924


>gi|149378378|ref|ZP_01896080.1| DNA polymerase I [Marinobacter algicola DG893]
 gi|149357343|gb|EDM45863.1| DNA polymerase I [Marinobacter algicola DG893]
          Length = 911

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 106/708 (14%), Positives = 202/708 (28%), Gaps = 172/708 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S           Y   A +   ++A +                        +
Sbjct: 334 FAFDTETTSL---------RY-MDADVVGVSFAIEPGEAAYVPFGHDYMGAPEQLDRDTV 383

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
            S L   L D     +  N  +++ +     GI++       T + +           + 
Sbjct: 384 LSQLKPLLEDPKKAKLGQNLKYDKNVLANH-GINLNGIA-EDTMLESYVLNSVGSRHDMD 441

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +    +  G Y   D + 
Sbjct: 442 SLAMQYLGEQTITFESIAGKGAKQL---------------TFNQIELEQAGPYAAEDADI 486

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L P  +            +  L  +   +  RG  I    + K  + +A+   
Sbjct: 487 TLRLHQALRPQLEKTGRLQEVYEKIDLPLVPVLSRMEQRGAMISASTLRKHSQELAERMA 546

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
           +L+++  +   G   +      L+   +   G+         +  T + +L         
Sbjct: 547 ELEKEAHEEA-GESFNLGSPKQLQAIFYDKMGLPVVKKTPKGAPSTAEPVLQELAHEHTL 605

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             LIL   + S       +TL E +    GR+  +      + TGR S      QN+P  
Sbjct: 606 PRLILEHRSLSKLKSTYTDTLPELIHHRTGRIHTSYHQAV-TATGRLSSSEPNLQNIP-- 662

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   +A  G KLV AD + IE R++A ++
Sbjct: 663 ----------------------IRSEQGRRIRQAFVAPEGYKLVAADYSQIELRIMAHLS 700

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
           G+   + AF  GEDI+  T A+ F   +D VS +QR   K +                  
Sbjct: 701 GDKGLLTAFEKGEDIHRATAAEVFGVAVDDVSGDQRRSAKAINF--------------GL 746

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 747 IYGMS------------------------------AFGLSRQLDVGRHQAQEYIDRYFER 776

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           +  VL+   ++ +                              D ++     RRL   ++
Sbjct: 777 YPAVLKYMDNIRKQA--------------------------HDDGYVETFYGRRLYLPEI 810

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNA-------TKNGYDIVL 626
                 +  A     R            +Q  + DI+   M +         ++   ++L
Sbjct: 811 NARNKQMQQAA---ERTAINAP------MQGTAADIIKRAMVSVEDWLQEHHQDDARMIL 861

Query: 627 TVHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            VHDE++ E  ++   ++   L   M+   S    +PL  E      +
Sbjct: 862 QVHDELILEVRESAVDTIREGLEKRMSAAAS--LDVPLLVEAGVGNNW 907


>gi|261344431|ref|ZP_05972075.1| DNA polymerase I [Providencia rustigianii DSM 4541]
 gi|282567335|gb|EFB72870.1| DNA polymerase I [Providencia rustigianii DSM 4541]
          Length = 934

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 101/703 (14%), Positives = 196/703 (27%), Gaps = 161/703 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S             ++A +   ++A +                        +
Sbjct: 356 FAFDTETDSLD----------TQEARLVGMSFAIEAGHAAYLPIGHDYLDAPVQLSLDDV 405

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL-----PSS 108
            + +   L +E +  +  N  ++  + +   GI++    +  T + +             
Sbjct: 406 IAVMKPILENEKIGKIGQNLKYDAEVLENY-GIELKGIAF-DTMLESYVLNSVAGMGRHD 463

Query: 109 LKNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           + +     LN      +   GK                      +    +    Y   D 
Sbjct: 464 MDSLADRHLNHKTVSFEEIAGKGKKQL---------------TFNQIPLEQAANYAAEDA 508

Query: 168 EATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
           + T  L + L P  + E             L  +   +  +G  ID   +    ++I   
Sbjct: 509 DVTLLLHQALFPQLEEEPKLAHVFQNIEMPLVPVLVRMERKGVLIDAPTLAAQSKIITAR 568

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQ 272
             +L++   +L      +      L+  LF    +         +  T + +L    +  
Sbjct: 569 LAELEKQAFELAGEEF-NLASPKQLQTILFEKLQLPVIKKTPSGAASTNEEVLEELALNH 627

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               L+L   + +       + L   ++   GR+  +      + TGR S      QN+P
Sbjct: 628 ELPKLLLEHRSLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSRDPNLQNIP 686

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   IA  G K++ AD + IE R++A 
Sbjct: 687 ------------------------VRTEEGRRIRQAFIARKGYKVMAADYSQIELRIMAH 722

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           ++ +   + AFA G+DI+  T A+ F  P+D+V+ +QR   K +   L Y          
Sbjct: 723 LSQDKGLLTAFAEGKDIHKATAAEVFGVPLDQVTSDQRRSAKAINFGLIYGMS-----AF 777

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
                L + +          FE +     +    + Q  E    + L G    L      
Sbjct: 778 GLARQLGIPRGEAQRYMDLYFERYPGVLRYMENTRLQASEQGYVETLEGRRLYLA----- 832

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
                +        +                 A++ +  M      +    P        
Sbjct: 833 ----DIKSSNGMRRKAAEREAINAPMQGTA--ADIIKKAMIAVDHWLQTEKPE------- 879

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
                                               D+L                 VHDE
Sbjct: 880 -----------------------------------ADMLM---------------QVHDE 889

Query: 632 IVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           +V E  ++    V   +  LM ++      +PLK E      +
Sbjct: 890 LVFEVKESELEKVQAKVQELMEQSMK--LDVPLKVEVGVGMNW 930


>gi|70733594|ref|YP_257234.1| DNA polymerase I [Pseudomonas fluorescens Pf-5]
 gi|68347893|gb|AAY95499.1| DNA polymerase I [Pseudomonas fluorescens Pf-5]
          Length = 929

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 101/717 (14%), Positives = 197/717 (27%), Gaps = 178/717 (24%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QS 51
             +  D ET              A+QA +   +++           T           + 
Sbjct: 342 KLIAFDTETT----------GIDAQQAQLVGLSFSVKAGEAAYVPLTHSYMGAPAQLDRD 391

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTL-------GIDIPSKRWICTSVLARTNG 104
           ++   L   L D  ++ V  ++ F+  +            GI +    +  T + +    
Sbjct: 392 SVLLALKPLLEDPKLLKVGQHAKFDMNILANCAIGGDQANGITVRGVAF-DTMLESYVLN 450

Query: 105 LP---SSLKNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFG 160
                  + +     L+ S    +   GK                           +  G
Sbjct: 451 STATRHDMDSLAQKYLDHSTVSFQDIAGKGAKQL---------------TFDQIPLEQAG 495

Query: 161 EYCKRDVEATRELFKRLIPLS-----------DGERDLWLLDQTINDRGYRIDLDLVLKL 209
            Y   D + T  L + L               D E  L  +   I  +G  +D  L+   
Sbjct: 496 PYAAEDADVTLRLHQVLFDKLSAIPSLASVLTDIEMPLVPVLARIERQGALVDDKLLGVQ 555

Query: 210 QELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL-VDMSE---GTLKSIL 265
              +  +   L+ +  ++      +      L   L+   G+ +    ++    T + +L
Sbjct: 556 SIELGDKMVALEREAFEIAGEEF-NLGSPKQLGSILYDKLGLPVLKKTAKGQPSTAEEVL 614

Query: 266 SHS-NITQLAKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGC 323
           +           +++   + S       + L E ++   GR+  +     AS TGR S  
Sbjct: 615 AKLAEDDYPLPRVLMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVAS-TGRLSSS 673

Query: 324 VFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAG 383
               QN+P                                +R   IA  G KL+ AD + 
Sbjct: 674 DPNLQNIP------------------------VRTAEGRRIRQAFIAPPGYKLLAADYSQ 709

Query: 384 IEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQG 443
           IE R++A ++ ++  + AF N  D++  T A+ F   +  V+ +QR   K +        
Sbjct: 710 IELRIMAHLSRDEGLLNAFRNNLDVHTATAAEVFKVELKDVTSDQRRSAKAINF------ 763

Query: 444 GAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTAC 503
                       G+                                 +      +     
Sbjct: 764 --------GLIYGMG------------------------------AQKLGKDIGVDTKQA 785

Query: 504 ELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLP 563
           +     + A++ GV +         A                                  
Sbjct: 786 KAYIDTYFARYPGVREYMDRTRAQAADQGYVETIF------------------------- 820

Query: 564 SSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK---- 619
             RRL   ++    S      +   R            +Q  + DI+ + M         
Sbjct: 821 -GRRLYLPEI---NSNKPQERAGAERTAINAP------MQGTAADIIKKAMVAVDNWLAS 870

Query: 620 --NGYDIVLTVHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
                 ++L VHDE+V E  +     V   +   M+   +    +PL  E      +
Sbjct: 871 SGLDARVILQVHDELVLEVREDLVDQVREEIRGHMSGAAT--LDVPLLVEVGVGNNW 925


>gi|91794967|ref|YP_564618.1| DNA polymerase I [Shewanella denitrificans OS217]
 gi|91716969|gb|ABE56895.1| DNA polymerase I [Shewanella denitrificans OS217]
          Length = 921

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 104/703 (14%), Positives = 193/703 (27%), Gaps = 158/703 (22%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQS---------- 51
             + ID ET S   +           A +   ++A +                       
Sbjct: 342 KLIAIDTETTSLNYM----------DAKLVGISFAIEAGEAAYLPLAHDYLDAPSQIDMA 391

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSS 108
                L   L  +    V  N  ++  +F   +GI +    +  T + +           
Sbjct: 392 TALEKLRPLLESDNPAKVGQNLKYDISIFAN-VGIKLKGVHF-DTMLESYVFNSVASRHD 449

Query: 109 LKNAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDV 167
           +       L       +   GK                      +         Y   D 
Sbjct: 450 MDGLALKYLGHKNISFEDVAGKGAKQL---------------TFNQIDLDTAAPYAAEDA 494

Query: 168 EATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQE 216
           + T  L + L P  + E             L  +   I  +G  ID  L+ +  + +AQ+
Sbjct: 495 DITLRLHQHLWPRLEKEPELAQVFTELELPLIQVLSDIERQGVLIDPMLLSQQSDELAQK 554

Query: 217 RKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDL----VDMSEGTLKSILSHSNITQ 272
             KL+ +  ++      +      L++  F      +       +  T + +L    +  
Sbjct: 555 IDKLELEAYEIAGEKF-NLGSPKQLQVLFFEKLAYPIIKKTPKGAPSTAEEVLVELALDY 613

Query: 273 LAKDLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLP 331
               +IL   + +       + L   V+ + GR+  +     A  TGR S      QN+P
Sbjct: 614 PLPKIILAHRSLAKLKSTYTDKLPLMVNGTTGRVHTSYHQANA-ATGRLSSSDPNLQNIP 672

Query: 332 RQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAW 391
                                           +R   IA  G+K++ AD + IE R++A 
Sbjct: 673 ------------------------IRTEEGRRIRQAFIAPAGRKILAADYSQIELRIMAH 708

Query: 392 IAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTM 451
           ++ +   + AFA G+DI+  T A+ F    ++V+ EQR   K +   L Y          
Sbjct: 709 LSQDKGLLTAFAEGKDIHRATAAEVFGAHFEEVTTEQRRRAKAVNFGLIYGMS-----AF 763

Query: 452 ASHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWR 511
                LD+ +        + F  +     +    +    E      L G    L      
Sbjct: 764 GLAKQLDIPRNEAQTYIDTYFARYPGVLQYMEETRASAAELGYVSTLFGRRLYL------ 817

Query: 512 AKHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYS 571
                +        +                                 I  P        
Sbjct: 818 ---PEIRDRNAMRRQAAERAA---------------------------INAPM------- 840

Query: 572 DVKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDE 631
                     TA   + +         +   Q                    +++ VHDE
Sbjct: 841 --------QGTAADIIKKAMINIANWIKTETQG----------------EITMIMQVHDE 876

Query: 632 IVSETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           +V E  +    ++   +C LM +       + L AE      +
Sbjct: 877 LVFEVDEAQAETLKAKICLLMAQAAD--LDVTLLAEAGIGNNW 917


>gi|319897650|ref|YP_004135847.1| DNA polymerase i [Haemophilus influenzae F3031]
 gi|317433156|emb|CBY81530.1| DNA polymerase I [Haemophilus influenzae F3031]
          Length = 935

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 202/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDR----------TEQS 51
             + +D ET S   +           A +   ++A ++                   E+S
Sbjct: 359 KLIAVDTETDSLDYM----------SANLVGISFALENGEAAYLPLQLDYLDAPKTLEKS 408

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + +   L +  +  +  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 409 TALAAIKPILENPDIHKIGQNIKFDESIFARH-GIELQGVEF-DTMLLSYTLNSTGRHNM 466

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +   EY   D +
Sbjct: 467 DDLAKRYLGHETIAFESIAGKGKGQL---------------TFNQIPLEQATEYAAEDAD 511

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L      E             L  +   +   G  ID D +      IA   
Sbjct: 512 VTMKLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSDALFMQSNEIASRL 571

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L++    L      +   T  L+  LF   G+         +  T + +L   + +  
Sbjct: 572 TALEKQAYALAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELSYSHE 630

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+S  GR+  +      + TGR S      QN+P 
Sbjct: 631 LPKILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 688

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA  G  +V AD + IE R++A +
Sbjct: 689 -----------------------IRNEEGRRIRQAFIAREGYSIVAADYSQIELRIMAHL 725

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+   I AF+ G+DI+ +T A+ F   +D+V+ EQR   K +                 
Sbjct: 726 SGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------G 771

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   + +  +     +     +  
Sbjct: 772 LIYGMS------------------------------AFGLSRQLGISRADAQKYMNLYFQ 801

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V Q   D+                                   +     RRL   D
Sbjct: 802 RYPSVQQFMTDIRAKAKAQGY--------------------------VETLFGRRLYLPD 835

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +        ++++ 
Sbjct: 836 INSSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKIDEVIRHDPDIEMIMQ 886

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  E    + +
Sbjct: 887 VHDELVFEVRSEKVAFFREQIKQHMEAAAELV--VPLIVEVGVGQNW 931


>gi|197263783|ref|ZP_03163857.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197242038|gb|EDY24658.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
          Length = 928

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 352 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 401

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 402 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 459

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 460 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 504

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 505 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 564

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 565 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 623

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 624 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 680

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 681 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 718

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 719 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 764

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 765 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 794

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 795 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 828

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 829 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 879

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 880 VHDELVFEVHKDDLNAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 924


>gi|326625711|gb|EGE32056.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 884

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 197/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 308 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 357

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 358 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 415

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 416 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 460

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 461 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 520

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 521 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 579

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 580 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 636

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 637 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 674

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 675 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 720

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 721 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 750

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                     +     RRL   D+
Sbjct: 751 YPGVLEYMERTRAQAKEQGY--------------------------VETLEGRRLYLPDI 784

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 785 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 835

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 836 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 880


>gi|322835075|ref|YP_004215102.1| DNA polymerase I [Rahnella sp. Y9602]
 gi|321170276|gb|ADW75975.1| DNA polymerase I [Rahnella sp. Y9602]
          Length = 934

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/701 (15%), Positives = 200/701 (28%), Gaps = 158/701 (22%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET     L           A +   ++A +                        +
Sbjct: 357 FAFDTETDGLDTLT----------ANLIGLSFATEAGKAAYLPVAHDYLDAPVQLDRDEV 406

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE  + V  N  F+R +  +   I++    +  T + +           + 
Sbjct: 407 LKQLKPILEDEKQLKVGQNLKFDRGVLLRY-DIELKGIAF-DTMLESYVLDSVSGRHDMD 464

Query: 111 NAC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +    Y   D + 
Sbjct: 465 SLADRYLGHKTVSFEEIAGKGKNQL---------------TFNQIALEQAAPYAAEDADV 509

Query: 170 TRELFKRLIPLS-----------DGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L + L P             D E  L  +   I   G  ID +++    + +A    
Sbjct: 510 TLQLHQALWPRIAESESLKTVFTDIEMPLVPVLSHIERTGVLIDQNILAAHSKELAIRLN 569

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L+    +L +    +   T  L+  L+    + ++  +      T + +L+   +    
Sbjct: 570 ELENKAHELAEEPF-NLSSTKQLQAILYEKQKLPILKKTPGGAPSTNEEVLAELALDYPL 628

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 629 PKVILEYRGLAKLKSTYTDKLPLMINPQSGRVHTSYHQAV-TATGRLSSSDPNLQNIP-- 685

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     ++ AD + IE R++A ++
Sbjct: 686 ----------------------VRNDEGRRIRQAFIAPKDYIILAADYSQIELRIMAHLS 723

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            ++  +KAFA G+DI+  T A+ F TP++KVS EQR   K +   L Y            
Sbjct: 724 KDEGLLKAFAEGKDIHRATAAEVFGTPLEKVSGEQRRSAKAINFGLIYGMS-----AFGL 778

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
              L++ +          FE +     +    + Q  E    + L G    L        
Sbjct: 779 SRQLNIPRKESQRYMDLYFERYPGVLEYMERTRTQASEQGYVETLDGRRLYL-------- 830

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
              +        +G                     +          +  P + R      
Sbjct: 831 -PDIKSSNAMRRKGAERAAINAPMQGTAADI----IKRAMISVADWLKQPDAPR------ 879

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIV 633
                                           +R I+                 VHDE+V
Sbjct: 880 --------------------------------ARIIM----------------QVHDELV 891

Query: 634 SETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
            E            + +LM  + + A  +PLK +    + +
Sbjct: 892 FEVHKDDVEVASEKIRNLMEASMTLA--VPLKVDVGTGENW 930


>gi|213852345|ref|ZP_03381877.1| DNA polymerase I [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
          Length = 772

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 108/707 (15%), Positives = 196/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET S   +           A +   ++A +                         
Sbjct: 196 FAFDTETDSLDNIA----------ANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRA 245

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
              L   L DE V  V  N  ++R + +   GI++    +  T + +           + 
Sbjct: 246 LELLKPLLEDEKVRKVGQNLKYDRGVLQNY-GIELRGIAF-DTMLESYILNSVAGRHDMD 303

Query: 111 NACLA-LNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +  A +  G Y   D + 
Sbjct: 304 SLSDRWLKHKTITFEDIAGKGKNQL---------------TFNQIALEEAGRYAAEDADV 348

Query: 170 TRELFKRLIPLSDG-----------ERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T +L  ++ P               E  L  +   +   G +ID  ++ K  E I     
Sbjct: 349 TLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLA 408

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSE----GTLKSILSHSNITQLA 274
           +L++    +  G   +   T  L+  LF   GI  +  +      T + +L    +    
Sbjct: 409 ELEKKAHDIA-GEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPL 467

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             +IL     +       + L   ++   GR+  +      + TGR S      QN+P  
Sbjct: 468 PKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAV-TATGRLSSTDPNLQNIP-- 524

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA     +V AD + IE R++A ++
Sbjct: 525 ----------------------VRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLS 562

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   + AFA G+DI+  T A+ F  P+D V+ EQR   K +                  
Sbjct: 563 RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINF--------------GL 608

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 609 IYGMS------------------------------AFGLSRQLNIPRKEAQKYMDLYFER 638

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GVL+  +                                           RRL   D+
Sbjct: 639 YPGVLEYMERTRAQAKEQGYVETLE--------------------------GRRLYLPDI 672

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATK------NGYDIVLT 627
           K   +       +               +Q  + DI+   M               +++ 
Sbjct: 673 KSSNAARRAGAERAA---------INAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQ 723

Query: 628 VHDEIVSETPDTPYFSVGT-LCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E       +V   +  LM         +PL  E    + +
Sbjct: 724 VHDELVFEVHKDDLDAVAKRIHQLMENCTR--IDVPLLVEVGSGENW 768


>gi|271502639|ref|YP_003335665.1| DNA polymerase I [Dickeya dadantii Ech586]
 gi|270346194|gb|ACZ78959.1| DNA polymerase I [Dickeya dadantii Ech586]
          Length = 929

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 99/707 (14%), Positives = 197/707 (27%), Gaps = 171/707 (24%)

Query: 4   LFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAM 53
              D ET     L           A +   + A                          +
Sbjct: 353 FSFDTETDGLDTLT----------ANLVGISLAIKPGEAAYLPLGHDYLDAPTQLDRDTV 402

Query: 54  PSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLK 110
            + L   L +E +  +  N  F++ +  +  GID+       T + +           + 
Sbjct: 403 LAQLKPLLENEAIGKIGQNLKFDKGVMARY-GIDLRGI-VFDTMLESYVLDSVAGRHDMD 460

Query: 111 NACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEA 169
           +     L       +   GK                      +    +    Y   D + 
Sbjct: 461 SLSERYLQHKTITFEEIAGKGKNQL---------------TFNQIPLEQAAVYAAEDADV 505

Query: 170 TRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218
           T  L + L    + +             L  +   +   G  ID  ++ +  + + Q   
Sbjct: 506 TLRLHETLWAKLEPQQELCQVFKNIDMPLVPVLSRMERTGVLIDTTILAEHSQELTQRLA 565

Query: 219 KLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLA 274
           +L+    +L  G   +      L   L+    +         +  T + +L+   +    
Sbjct: 566 ELEVRAHELA-GEAFNLASPKQLGAILYEKLQLPVIKKTPKGAPSTNEEVLAELALDHPL 624

Query: 275 KDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQ 333
             LIL     +       + L + ++    R+  +      + TGR S      QN+P  
Sbjct: 625 PKLILEHRELAKLKSTYTDKLPQMINPLTKRVHTSYHQAV-TATGRLSSSDPNLQNIP-- 681

Query: 334 ERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIA 393
                                         +R   IA  G +++ AD + IE R++A ++
Sbjct: 682 ----------------------VRNEEGRRIRQAFIAPQGYQILAADYSQIELRIMAHLS 719

Query: 394 GEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMAS 453
            +   +KAF++G DI+  T A+ F  P+DKV+ EQR   K +                  
Sbjct: 720 RDAGLLKAFSDGLDIHRATAAEVFGLPLDKVTTEQRRSAKAINF--------------GL 765

Query: 454 HCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAK 513
             G+                                   + +  +     +     +  +
Sbjct: 766 IYGMS------------------------------AFGLSRQLGIARNEAQKYMNLYFER 795

Query: 514 HQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDV 573
           + GV +  +   +  A                              +     RRL   D+
Sbjct: 796 YPGVQEYMERTRQQAADQGY--------------------------VSTLDGRRLYLPDI 829

Query: 574 KGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNAT------KNGYDIVLT 627
               +    +     R            +Q  + DI+ + M          K    +++ 
Sbjct: 830 HSRNAM---SRKAAERAAINAP------MQGTAADIIKKAMIAIDDWLQQEKPLATMLMQ 880

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E   +    V   + +LM         +PL+ +      +
Sbjct: 881 VHDELVFEVHHSVLDEVSAKIRNLMEGCMQ--LDVPLQVDIGTGSNW 925


>gi|117922540|ref|YP_871732.1| DNA polymerase I [Shewanella sp. ANA-3]
 gi|117614872|gb|ABK50326.1| DNA polymerase I [Shewanella sp. ANA-3]
          Length = 922

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 104/700 (14%), Positives = 187/700 (26%), Gaps = 158/700 (22%)

Query: 5   FIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQ----------SAMP 54
            +D ET S   +           A +   ++A +                          
Sbjct: 346 AVDTETTSLDYMV----------AELVGLSFAVEAGKAAYLPLAHDYVGAPQQLDKQTAL 395

Query: 55  SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGL---PSSLKN 111
             L   L D  +  V  N  ++  +     GI +       T + +           +  
Sbjct: 396 EKLRPLLEDAKIKKVGQNLKYDISVLANA-GIKLQGV-VFDTMLESYVFNSIASRHDMDG 453

Query: 112 AC-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEAT 170
                L       +   GK                      +    +    Y   D + T
Sbjct: 454 LALKYLGHKNIAFEDIAGKGAKQL---------------TFNQIPLETAAPYAAEDADIT 498

Query: 171 RELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKK 219
             L + L P  + E             L  +   I  +G  ID  L+ +  + +A++  +
Sbjct: 499 LRLHQHLWPRLEKETELASVFTDIELPLIQILSDIERQGVFIDSMLLGQQSDELARKIDE 558

Query: 220 LDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQLAK 275
           L+     +      +      L++  F   G          +  T + +L    +     
Sbjct: 559 LETKAYDIAGEKF-NLSSPKQLQVLFFEKLGYPVIKKTPKGAPSTAEEVLVELALDFPLP 617

Query: 276 DLILNRLASSGSAILKLNTLSEAVS-SDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQE 334
            +IL   + +       + L   V+   GR+  +     A  TGR S      QN+P   
Sbjct: 618 KVILEHRSLTKLKSTYTDKLPLMVNAKTGRVHTSYHQANA-ATGRLSSSEPNLQNIP--- 673

Query: 335 RSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAG 394
                                        +R   IA  G+K++ AD + IE R++A ++ 
Sbjct: 674 ---------------------IRTEEGRRIRQAFIAPQGRKILAADYSQIELRIMAHLSQ 712

Query: 395 EDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASH 454
           +   +KAFA G+DI+  T A+ F T  D V+ EQR   K +   L Y             
Sbjct: 713 DAGLLKAFAEGKDIHRATAAEVFGTDFDSVTSEQRRRAKAVNFGLIYGMS-----AFGLA 767

Query: 455 CGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKH 514
             LD+ +        + F  +     +    +    E      L G    L         
Sbjct: 768 RQLDIPRNEAQTYIDTYFARYPGVLRYMEETRASAAELGYVSTLFGRRLYL--------- 818

Query: 515 QGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVK 574
             +        +                      ++                        
Sbjct: 819 PEIRDRNAMRRQAAERAAINAPMQGTAADIIKKAMIS----------------------- 855

Query: 575 GDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVS 634
                     +  ++  T G                   M           + VHDE+V 
Sbjct: 856 ---------IADWIKTDTQGE----------------IAMI----------MQVHDELVF 880

Query: 635 ETPDTPYFSVG-TLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           E       ++   +C LM K  +    + L AE      +
Sbjct: 881 EVDADKAETLKLKVCELMAKAAN--LDVELLAEAGIGDNW 918


>gi|148828039|ref|YP_001292792.1| DNA polymerase I [Haemophilus influenzae PittGG]
 gi|148719281|gb|ABR00409.1| DNA polymerase I [Haemophilus influenzae PittGG]
          Length = 930

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 106/707 (14%), Positives = 202/707 (28%), Gaps = 169/707 (23%)

Query: 2   SKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDR----------TEQS 51
             + +D ET S   +           A +   ++A ++                   E+S
Sbjct: 354 KLIAVDTETDSLDYM----------SANLVGISFALENGEAAYLPLQLDYLDAPKTLEKS 403

Query: 52  AMPSDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLP--SSL 109
              + +   L +  +  +  N  F+  +F +  GI++    +  T +L+ T       ++
Sbjct: 404 TALAAIKPILENPNIHKIGQNIKFDESIFARH-GIELQGVEF-DTMLLSYTLNSTGRHNM 461

Query: 110 KNACL-ALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVE 168
            +     L       +   GK                      +    +   EY   D +
Sbjct: 462 DDLAKRYLGHETIAFESLAGKGKSQL---------------TFNQIPLEQATEYAAEDAD 506

Query: 169 ATRELFKRLIPLSDGE-----------RDLWLLDQTINDRGYRIDLDLVLKLQELIAQER 217
            T +L + L      E             L  +   +   G  ID D +      IA   
Sbjct: 507 VTMKLQQALWLKLQEEPTLVELYKTMELPLLHVLSRMERTGVLIDSDALFMQSNEIASRL 566

Query: 218 KKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGID----LVDMSEGTLKSILSHSNITQL 273
             L++    L      +   T  L+  LF   G+         +  T + +L   + +  
Sbjct: 567 TALEKQAYALAGQPF-NLASTKQLQEILFDKLGLPVLQKTPKGAPSTNEEVLEELSYSHE 625

Query: 274 AKDLILNRLASSGSAILKLNTLSEAVSS-DGRLRGTLQFYGASRTGRWSGCVFQPQNLPR 332
              +++     S       + L + V+S  GR+  +      + TGR S      QN+P 
Sbjct: 626 LPKILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHTSYHQAV-TATGRLSSSDPNLQNIP- 683

Query: 333 QERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGIEARVLAWI 392
                                          +R   IA  G  +V AD + IE R++A +
Sbjct: 684 -----------------------IRNEEGRRIRQAFIARKGYSIVAADYSQIELRIMAHL 720

Query: 393 AGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMA 452
           +G+   I AF+ G+DI+ +T A+ F   +D+V+ EQR   K +                 
Sbjct: 721 SGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINF--------------G 766

Query: 453 SHCGLDLQQFSQNVKSTSTFEDWEQAESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRA 512
              G+                                   + +  +     +     +  
Sbjct: 767 LIYGMS------------------------------AFGLSRQLGISRADAQKYMNLYFQ 796

Query: 513 KHQGVLQLWKDLTEGFACVVQEGGSISARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSD 572
           ++  V Q   D+                                   +     RRL   D
Sbjct: 797 RYPSVQQFMTDIRAKAKAQGY--------------------------VETLFGRRLYLPD 830

Query: 573 VKGDCSYLNTATSQLMRERTYGGKLTENIVQAISRDILCEGMKNATKN-----GYDIVLT 627
           +    +          R            +Q  + DI+   M    +        ++++ 
Sbjct: 831 INSSNAMRR---KGAERVAINAP------MQGTAADIIKRAMIKIDEVIRHDPDIEMIMQ 881

Query: 628 VHDEIVSETPDTPYFSV-GTLCSLMTKNPSWAKGLPLKAEGYEAKRY 673
           VHDE+V E            +   M         +PL  E    + +
Sbjct: 882 VHDELVFEVRSEKVAFFREQIKQHMEAAAELV--VPLIVEVGVGQNW 926


>gi|71905805|ref|YP_283392.1| DNA polymerase A [Dechloromonas aromatica RCB]
 gi|71845426|gb|AAZ44922.1| DNA polymerase A [Dechloromonas aromatica RCB]
          Length = 906

 Score =  405 bits (1041), Expect = e-110,   Method: Composition-based stats.
 Identities = 109/705 (15%), Positives = 196/705 (27%), Gaps = 170/705 (24%)

Query: 5   FIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTE----------QSAMP 54
            +D ET S               A I   + +                       +  + 
Sbjct: 332 ALDTETTSLDSFA----------ARIVGISLSVTPGEACYIPLAHTAPGVADQLPREEVL 381

Query: 55  SDLLQYLRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTN--GLPSSLKNA 112
           + L  +L       V  N+ +++ +F    GI +       T + +          L   
Sbjct: 382 ARLKSWLESAAHKKVLQNAKYDQHVFANH-GIALSGIA-HDTMLQSYVIESDKGHDLGQL 439

Query: 113 C-LALNFSEHLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATR 171
           C   L  +    +   GK                           +    Y   D + T 
Sbjct: 440 CTRHLGLATIAYEDLCG