RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780127|ref|YP_003064540.1| putative DNA polymerase from
bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62]
         (675 letters)



>gnl|CDD|128758 smart00482, POLAc, DNA polymerase A domain. 
          Length = 206

 Score = 87.7 bits (218), Expect = 9e-18
 Identities = 32/83 (38%), Positives = 49/83 (59%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G  LV AD + IE R+LA ++G++  ++AF NG DI+  T A+ F  P ++
Sbjct: 4   IRRAFVAPPGYVLVSADYSQIELRILAHLSGDENLLEAFNNGGDIHSKTAAQVFGVPEEE 63

Query: 424 VSKEQRAIGKVMELALGYQGGAK 446
           V+KE R   K +   + Y  GAK
Sbjct: 64  VTKELRRAAKAINFGIIYGMGAK 86



 Score = 36.8 bits (86), Expect = 0.018
 Identities = 17/67 (25%), Positives = 27/67 (40%), Gaps = 7/67 (10%)

Query: 579 YLNTATSQLMRERTYGGKLTEN-IVQAISRDILCEGMKNATKNGY------DIVLTVHDE 631
           Y+    S+    R    +   N  +Q  + DIL   M    +          ++L VHDE
Sbjct: 139 YIPDIDSRNPVLRAAAERAAVNAPIQGSAADILKLAMIKMDEALKEKGLRARLLLQVHDE 198

Query: 632 IVSETPD 638
           +V E P+
Sbjct: 199 LVFEVPE 205


>gnl|CDD|184938 PRK14975, PRK14975, bifunctional 3'-5' exonuclease/DNA polymerase;
           Provisional.
          Length = 553

 Score = 81.2 bits (201), Expect = 8e-16
 Identities = 67/265 (25%), Positives = 103/265 (38%), Gaps = 55/265 (20%)

Query: 208 KLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEGTLKSILSH 267
           +L EL A+ R+ L           +        LR       GI+L    +  L+ I  H
Sbjct: 205 RLAELAAEIREALG-------RPRLNPDSPQQVLRALRRA--GIELPSTRKWELREI-DH 254

Query: 268 SNITQLAKDLILNRLASS-GSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCVFQ 326
             +  L +   L++L S+ G A L      +    DGR        G   TGRW+     
Sbjct: 255 PAVEPLLEYRKLSKLLSANGWAWL------DYWVRDGRFHPEYVPGGVV-TGRWAS--RG 305

Query: 327 P--QNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKLVVADLAGI 384
           P  Q +PR                               +RS  +A  G KLVVAD + I
Sbjct: 306 PNAQQIPRD------------------------------IRSAFVADPGWKLVVADASQI 335

Query: 385 EARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVMELALGYQGG 444
           E RVLA  +G++  I+AF  G D++  T +  F  P +   KE+RA+ K       Y   
Sbjct: 336 ELRVLAAYSGDERMIEAFRTGGDLHRLTASVGFGKPEE--EKEERALAKAANFGAIYGAT 393

Query: 445 AKVFKTMASHCGLDLQQFSQNVKST 469
           +K  +  A + G +  +  + ++  
Sbjct: 394 SKGLQEYAKNYG-EAARLLERLRRA 417


>gnl|CDD|161944 TIGR00593, pola, DNA polymerase I.  This family is based on the
           phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis,
           Stanford University).
          Length = 887

 Score = 75.5 bits (186), Expect = 4e-14
 Identities = 82/305 (26%), Positives = 127/305 (41%), Gaps = 58/305 (19%)

Query: 160 GEYCKRDVEATRELFKRLIPLSDGERDLWLLDQT----------INDRGYRIDLDLVLKL 209
            EY  R   AT+ L + L+   D  + L L  +           +   G ++D D + +L
Sbjct: 456 TEYLARRAAATKRLAEELLKELDENKLLSLYREIELPLSKVLAEMEKTGIKVDADYLQEL 515

Query: 210 QELIAQERKKLDEDIVKL--TDGIIRSSRQTYALRMYLFLITGIDLVD-------MSEGT 260
            +   +E   L+E+I +L   +  I S +Q   L   LF   G+ +              
Sbjct: 516 SQEFGEEIADLEEEIYELAGEEFNINSPKQ---LGEVLFEKLGLPVGKKTKTGYSTDADV 572

Query: 261 LKSILSHSNITQLAKDLI---LNRLASSGSAILKLNTLSEAVSSD-GRLRGTLQFYGASR 316
           L+ +     I  +A  L    L +L S+      ++ L E V+ D GR+  T    G + 
Sbjct: 573 LEKLREKHPI--IALILEYRQLTKLKST-----YVDGLPELVNPDTGRIHTTFNQTGTA- 624

Query: 317 TGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETIADPLGLASDCVRSCIIASNGKKL 376
           TGR S      QN+P   RSEE           G  I           R   +A  G  L
Sbjct: 625 TGRLSSSNPNLQNIPI--RSEE-----------GRKI-----------RKAFVAEKGWLL 660

Query: 377 VVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDKVSKEQRAIGKVME 436
           + AD + IE RVLA ++ ++  I+AF NGEDI+  T ++ F   I+ V+   R I K + 
Sbjct: 661 ISADYSQIELRVLAHLSQDENLIEAFQNGEDIHTETASRLFGVEIEDVTPNMRRIAKTIN 720

Query: 437 LALGY 441
             + Y
Sbjct: 721 FGVVY 725


>gnl|CDD|180237 PRK05755, PRK05755, DNA polymerase I; Provisional.
          Length = 880

 Score = 69.7 bits (172), Expect = 2e-12
 Identities = 29/72 (40%), Positives = 47/72 (65%)

Query: 364 VRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFNTPIDK 423
           +R   +A  G KL+ AD + IE R+LA ++G++  I+AFA GEDI+  T ++ F  P+++
Sbjct: 641 IRKAFVAPEGYKLLSADYSQIELRILAHLSGDEGLIEAFAEGEDIHTATASEVFGVPLEE 700

Query: 424 VSKEQRAIGKVM 435
           V+ EQR   K +
Sbjct: 701 VTSEQRRRAKAI 712


>gnl|CDD|180459 PRK06195, PRK06195, DNA polymerase III subunit epsilon; Validated.
          Length = 309

 Score = 31.3 bits (71), Expect = 0.86
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 5/45 (11%)

Query: 60  YLRDETVMCVAHNSLFERILFKKTL---GIDIPSKRWICTSVLAR 101
           Y  +  V  +AHN+ F+  + +KTL    I +PS  +ICT  LA+
Sbjct: 77  YFNNNLV--IAHNASFDISVLRKTLELYNIPMPSFEYICTMKLAK 119


>gnl|CDD|181157 PRK07883, PRK07883, hypothetical protein; Validated.
          Length = 557

 Score = 30.7 bits (70), Expect = 1.3
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 8/59 (13%)

Query: 48  TEQSAMPSDLLQYLRDETVMCVAHNSLFERILFKK----TLGIDIPSKRWICTSVLART 102
             +  +P+  L++ R   V+ VAHN+ F+ I F +      G   P    +CT  LAR 
Sbjct: 81  PIEEVLPA-FLEFARG-AVL-VAHNAPFD-IGFLRAAAARCGYPWPGPPVLCTVRLARR 135


>gnl|CDD|139997 PRK13938, PRK13938, phosphoheptose isomerase; Provisional.
          Length = 196

 Score = 30.1 bits (67), Expect = 2.2
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 3/70 (4%)

Query: 405 GEDIYVTTYAKAFNTPIDKVSKEQ-RAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFS 463
            E+I+V T A       D+V  E  RAIG    L  GY+ GA+VF         D Q F+
Sbjct: 7   AEEIFVETIAVKTRILNDRVLLEAARAIGD--RLIAGYRAGARVFMCGNGGSAADAQHFA 64

Query: 464 QNVKSTSTFE 473
             +     F+
Sbjct: 65  AELTGHLIFD 74


>gnl|CDD|163170 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide
           oxidoreductase family protein.  Members of this protein
           family include N-terminal sequence regions of (probable)
           bifunctional proteins whose C-terminal sequences are
           SelD, or selenide,water dikinase, the selenium donor
           protein necessary for selenium incorporation into
           protein (as selenocysteine), tRNA (as 2-selenouridine),
           or both. However, some members of this family occur in
           species that do not show selenium incorporation, and the
           function of this protein family is unknown.
          Length = 364

 Score = 29.6 bits (67), Expect = 3.1
 Identities = 7/17 (41%), Positives = 9/17 (52%)

Query: 7   DIETRSPQPLPKVGVWA 23
           D    +  P PK GV+A
Sbjct: 279 DCAVITDAPRPKAGVYA 295


>gnl|CDD|178473 PLN02885, PLN02885, nicotinate phosphoribosyltransferase.
          Length = 545

 Score = 28.9 bits (65), Expect = 4.1
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 203 LDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYALRMYLFLITGIDLVDMSEG 259
           L  V KL E+  Q R KL ED+ K+T   I   ++ Y     L+   G  LVD+  G
Sbjct: 390 LGCVYKLVEINGQPRIKLSEDVEKVT---IPCKKRCYR----LYGKEGYPLVDLMTG 439


>gnl|CDD|181186 PRK07983, PRK07983, exodeoxyribonuclease X; Provisional.
          Length = 219

 Score = 28.5 bits (64), Expect = 5.6
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 6/33 (18%)

Query: 69  VAHNSLFERILFKKTLGIDIPSKRWICTSVLAR 101
           VAHN+ F+R +  +  G       WICT  LAR
Sbjct: 78  VAHNASFDRRVLPEMPG------EWICTMKLAR 104


>gnl|CDD|178257 PLN02651, PLN02651, cysteine desulfurase.
          Length = 364

 Score = 28.5 bits (64), Expect = 5.7
 Identities = 14/51 (27%), Positives = 17/51 (33%), Gaps = 4/51 (7%)

Query: 499 IGTACELVKKAWRA--KHQGVLQ--LWKDLTEGFACVVQEGGSISARRVAN 545
           +G ACEL  K      KH   L+  L   L      V   G     +R   
Sbjct: 246 LGAACELAMKEMDYDEKHMKALRERLLNGLRAKLGGVRVNGPRDPEKRYPG 296


>gnl|CDD|180377 PRK06063, PRK06063, DNA polymerase III subunit epsilon;
           Provisional.
          Length = 313

 Score = 28.5 bits (64), Expect = 5.7
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 18/73 (24%)

Query: 56  DLLQYLRDETVMCVAHNSLF---------ERILFKKTLGIDIPSKRWICTSVLARTNGLP 106
           ++ + LR  T+  VAHN  F         ER       G ++P  + +CT  LAR  GL 
Sbjct: 87  EVAELLRGRTL--VAHNVAFDYSFLAAEAERA------GAELPVDQVMCTVELARRLGLG 138

Query: 107 -SSLKNACLALNF 118
             +L+   LA ++
Sbjct: 139 LPNLRLETLAAHW 151


>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein.  Function of MutS2 is
           unknown. It should not be considered a DNA mismatch
           repair protein. It is likely a DNA mismatch binding
           protein of unknown cellular function.
          Length = 771

 Score = 28.6 bits (64), Expect = 6.0
 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 5/76 (6%)

Query: 166 DVEATRELFKRLIPLSDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIV 225
           D+E    L   LI L   E D   +   I+D G     D   +  + I +  K L+E++V
Sbjct: 109 DLEILFHLRLNLITLPPLEND---IIACIDDDGK--VKDGASEELDAIRESLKALEEEVV 163

Query: 226 KLTDGIIRSSRQTYAL 241
           K    IIRS      L
Sbjct: 164 KRLHKIIRSKELAKYL 179


>gnl|CDD|184079 PRK13482, PRK13482, DNA integrity scanning protein DisA;
           Provisional.
          Length = 352

 Score = 27.8 bits (63), Expect = 9.0
 Identities = 15/54 (27%), Positives = 21/54 (38%), Gaps = 14/54 (25%)

Query: 162 YCKRDVEATRELFKRLIPLSDGE-RDL-------------WLLDQTINDRGYRI 201
           Y +   E   E+ + L  LS  E  DL               LD  ++ RGYR+
Sbjct: 235 YSQEKDEDPEEILEELQELSSEELLDLSAIARLLGYPGGSEALDTPVSPRGYRL 288


>gnl|CDD|180308 PRK05896, PRK05896, DNA polymerase III subunits gamma and tau;
           Validated.
          Length = 605

 Score = 27.9 bits (62), Expect = 9.4
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 164 KRDVEATRELFKRLIPLSDGE-RD-LWLLDQTINDRGYRIDLDLVLKLQELIAQERK 218