HHsearch alignment of GI: 254780128 and MMDB domain: 1gef_A_

>1gef_A (A:) Holliday junction resolvase; HJC, hydrolase; 2.00A {Pyrococcus furiosus}
Probab=97.57  E-value=0.00063  Score=45.32  Aligned_cols=73  Identities=19%  Similarity=0.146  Sum_probs=58.2

Q ss_pred             CCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEEEEECCCCCEEEEEEECCCCC---CCHHHHHHHHHH-HHCCCEEEE
Q ss_conf             8999999999999997898999981188898743999906982999999768988---688999999999-978988999
Q gi|254780128|r    9 QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGR---LSHQQMSEIEEL-RRRGQRVKV   84 (103)
Q Consensus         9 ~~E~~ie~~l~~~lk~~G~~~~K~~~~g~~GvPDli~~~~~g~~~fIEvK~~~gk---ls~~Q~~~~~~l-~~~G~~~~V   84 (103)
                      ++=+..|+.+++.+...|+.+++..+   +|-||++.. +++.++.||||+..+.   ++..|..-+..+ +..|+..++
T Consensus         3 ~kG~~~EReL~~~L~~~Gfav~R~pg---Sg~pDiiA~-~~~~~~~iEvKst~k~~iyi~~eqiekL~~f~~~fg~~p~i   78 (123)
T 1gef_A            3 RKGAQAERELIKLLEKHGFAVVRSAG---SKKVDLVAG-NGKKYLCIEVKVTKKDHLYVGKRDMGRLIEFSRRFGGIPVL   78 (123)
T ss_dssp             HHHHHHHHHHHHHHHHTTCEEEEBGG---GSSCSEEEE-CSSCEEEEEEEEESSSCEEECHHHHHHHHHHHHHHTCEEEE
T ss_pred             CCCCHHHHHHHHHHHHHCEEEEEECC---CCCCCEEEC-CCEEEEEEEEEECCCCCEEECHHHHHHHHHHHHHCCCCEEE
T ss_conf             44106799999999972716999548---999766605-74068999999816875662588889999999861972689


Q ss_pred             E
Q ss_conf             8
Q gi|254780128|r   85 L   85 (103)
Q Consensus        85 v   85 (103)
                      +
T Consensus        79 a   79 (123)
T 1gef_A           79 A   79 (123)
T ss_dssp             E
T ss_pred             E
T ss_conf             9