HHsearch results for GI: 254780128 and protein with PDBid: 2vld_A

>2vld_A NUCS, UPF0286 protein pyrab01260; endonuclease, hydrolase; 2.60A {Pyrococcus abyssi}
Probab=90.76  E-value=0.42  Score=27.33  Aligned_cols=90  Identities=19%  Similarity=0.231  Sum_probs=57.4

Q ss_pred             CCHHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCEEEEECCCCCEEEEEEECCCCCCC-HHH-HHHHHHHHH-CCCEE-
Q ss_conf             89999999999999978--9899998118889874399990698299999976898868-899-999999997-89889-
Q gi|254780128|r    9 QTEKDVEKRLVTGAKKL--DCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLS-HQQ-MSEIEELRR-RGQRV-   82 (103)
Q Consensus         9 ~~E~~ie~~l~~~lk~~--G~~~~K~~~~g~~GvPDli~~~~~g~~~fIEvK~~~gkls-~~Q-~~~~~~l~~-~G~~~-   82 (103)
                      .+|+++|..|......+  |.....-..+-..|.-|++..-++|+++-||+|+.++.+. -.| ..+.+.+++ .+..+ 
T Consensus       125 G~E~dLq~~L~~n~~~i~~G~~~v~rE~~t~~G~iDll~~D~~g~~VvIElKr~~~~~~~V~QL~rYv~~lr~~~~~~Vr  204 (251)
T 2vld_A          125 GSEAEMANLIFENPRVIEEGFKPIYREKPIRHGIVDVMGVDKDGNIVVLELKRRKADLHAVSQMKRYVDSLKEEYGENVR  204 (251)
T ss_dssp             -CHHHHHHHHHHCGGGTCTTCEEEEEEEEETTEEEEEEEECTTSCEEEEEECSSCBCHHHHHHHHHHHHHHHHHHCSCEE
T ss_pred             ECHHHHHHHHHHCHHHHCCCCEEEEEEEECCCCCEEEEEEECCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCE
T ss_conf             40999999998699986789789999884288965589990799999999970479860799999999998740699826


Q ss_pred             --EEECC-HHHHHHHHHHH
Q ss_conf             --99859-89999999999
Q gi|254780128|r   83 --KVLVS-MEEVDNFLEEL   98 (103)
Q Consensus        83 --~Vv~s-~edv~~~l~~l   98 (103)
                        .|+.+ -+++.+++++.
T Consensus       205 GIlvA~~it~~a~~ll~~~  223 (251)
T 2vld_A          205 GILVAPSLTEGAKKLLEKE  223 (251)
T ss_dssp             EEEEESCBCHHHHHHHHHH
T ss_pred             EEEECCCCCHHHHHHHHHC
T ss_conf             9998686998999999978