BLAST/PSIBLAST alignment of GI: 254780128 and GI: 255957592 at iteration 1
>gi|255957592|dbj|BAH96647.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103
 Score =  210 bits (534), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 101/103 (98%), Positives = 101/103 (98%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNG LWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGRLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT Y
Sbjct: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTSY 103