BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780128|ref|YP_003064541.1| VRR-NUC domain-containing
protein [Candidatus Liberibacter asiaticus str. psy62]
         (103 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780128|ref|YP_003064541.1| VRR-NUC domain-containing protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039805|gb|ACT56601.1| VRR-NUC domain-containing protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120699|gb|ADV02522.1| endonuclease [Liberibacter phage SC1]
 gi|317120843|gb|ADV02664.1| endonuclease [Liberibacter phage SC1]
          Length = 103

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY
Sbjct: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103


>gi|255957557|dbj|BAH96619.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|317120742|gb|ADV02564.1| endonuclease [Liberibacter phage SC2]
 gi|317120803|gb|ADV02624.1| endonuclease [Liberibacter phage SC2]
          Length = 103

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 102/103 (99%), Positives = 103/103 (100%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEELRRRGQRVKVL+SMEEVDNFLEELACTLY
Sbjct: 61  TGRLSHQQMSEIEELRRRGQRVKVLISMEEVDNFLEELACTLY 103


>gi|255957592|dbj|BAH96647.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
          Length = 103

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 101/103 (98%), Positives = 101/103 (98%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNG LWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGRLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT Y
Sbjct: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTSY 103


>gi|255957617|dbj|BAH96667.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957627|dbj|BAH96675.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
          Length = 103

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 102/103 (99%), Positives = 102/103 (99%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT Y
Sbjct: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTSY 103


>gi|268610657|ref|ZP_06144384.1| VRR_NUC domain-containing protein [Ruminococcus flavefaciens FD-1]
          Length = 93

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 45/93 (48%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E ++E +LV   K       K    G  G PDR+++  +G + ++EVK P  +    Q
Sbjct: 1   MRENEIETKLVKAVKARGGVCWKFVSPGTAGVPDRIVLMQSGRIAFVEVKAPGEKPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
              I+ LRR G +V VL   E++   ++E+   
Sbjct: 61  RVRIKLLRRLGFKVYVLDGAEQIGGIIDEIQSA 93


>gi|255957612|dbj|BAH96663.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
          Length = 103

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 101/103 (98%), Positives = 102/103 (99%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEELRRRGQRVKVL+SMEEVDNFLEELACT Y
Sbjct: 61  TGRLSHQQMSEIEELRRRGQRVKVLISMEEVDNFLEELACTSY 103


>gi|255957602|dbj|BAH96655.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957632|dbj|BAH96679.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957637|dbj|BAH96683.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957642|dbj|BAH96687.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957647|dbj|BAH96691.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957677|dbj|BAH96715.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957682|dbj|BAH96719.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957687|dbj|BAH96723.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
          Length = 103

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 100/103 (97%), Positives = 102/103 (99%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEELRRRGQRVKVL+S+EEVDNFLEELACT Y
Sbjct: 61  TGRLSHQQMSEIEELRRRGQRVKVLISIEEVDNFLEELACTSY 103


>gi|255957622|dbj|BAH96671.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957652|dbj|BAH96695.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957657|dbj|BAH96699.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957672|dbj|BAH96711.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
          Length = 103

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 101/103 (98%), Positives = 102/103 (99%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGA+KLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAEKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT Y
Sbjct: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTSY 103


>gi|255957662|dbj|BAH96703.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957667|dbj|BAH96707.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
          Length = 103

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 100/103 (97%), Positives = 102/103 (99%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGA+KLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAEKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEELRRRGQRVKVLVS+EEVDNFLEELACT Y
Sbjct: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSIEEVDNFLEELACTSY 103


>gi|255957562|dbj|BAH96623.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957567|dbj|BAH96627.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957572|dbj|BAH96631.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957577|dbj|BAH96635.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957582|dbj|BAH96639.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957587|dbj|BAH96643.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957597|dbj|BAH96651.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
 gi|255957607|dbj|BAH96659.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus]
          Length = 103

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 100/103 (97%), Positives = 101/103 (98%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGA+KLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAEKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEEL RRGQRVKVLVSMEEVDNFLEELACT Y
Sbjct: 61  TGRLSHQQMSEIEELLRRGQRVKVLVSMEEVDNFLEELACTSY 103


>gi|302876788|ref|YP_003845421.1| VRR-NUC domain-containing protein [Clostridium cellulovorans
          743B]
 gi|307687469|ref|ZP_07629915.1| VRR-NUC domain-containing protein [Clostridium cellulovorans
          743B]
 gi|302579645|gb|ADL53657.1| VRR-NUC domain-containing protein [Clostridium cellulovorans
          743B]
          Length = 92

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 33/90 (36%), Positives = 48/90 (53%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            EK +EK+L+T  KK      K    G  G PDR+++ P G   ++EVK P  +    Q
Sbjct: 1  MREKQIEKKLITEVKKRGGICPKWVSPGFDGVPDRIVLLPGGKFAFVEVKAPGEKPRPLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
          +S  + LRR G RV VL  M ++   L+E+
Sbjct: 61 VSRHKLLRRLGFRVYVLDDMSQIGGILDEI 90


>gi|293401138|ref|ZP_06645282.1| hypothetical protein HMPREF0863_01422 [Erysipelotrichaceae
           bacterium 5_2_54FAA]
 gi|291305264|gb|EFE46509.1| hypothetical protein HMPREF0863_01422 [Erysipelotrichaceae
           bacterium 5_2_54FAA]
          Length = 95

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 46/93 (49%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK++E +L T  +K      K      RG PDRL++ P+G   ++E+K P       Q
Sbjct: 3   MLEKNIENKLTTAVEKAGGIAPKFVSPSLRGMPDRLVLLPDGVFAFVELKAPGESPRPLQ 62

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
            +   +LR  G +V V+ S++ +   L EL  T
Sbjct: 63  RARHRKLRSLGFKVYVIDSIDGIGGMLHELLST 95


>gi|167746057|ref|ZP_02418184.1| hypothetical protein ANACAC_00752 [Anaerostipes caccae DSM 14662]
 gi|167654572|gb|EDR98701.1| hypothetical protein ANACAC_00752 [Anaerostipes caccae DSM 14662]
          Length = 93

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 45/93 (48%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK++EKRLV   KK      K    G  G PDR+I+ P G + + E+K P  +    Q
Sbjct: 1   MREKEIEKRLVAEVKKNGGICPKFVSPGYAGMPDRIILLPKGKIAFAELKAPGQKPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
            +  + L   G RV V+   E++   + E+  T
Sbjct: 61  AARHKILMGLGFRVYVIDGTEQIGGVIREIQST 93


>gi|323693307|ref|ZP_08107525.1| VRR-NUC domain-containing protein [Clostridium symbiosum WAL-14673]
 gi|323502790|gb|EGB18634.1| VRR-NUC domain-containing protein [Clostridium symbiosum WAL-14673]
          Length = 93

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 45/93 (48%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +EK+L T  KK      K       G PDR+I+ P+G   + E+K P       Q
Sbjct: 1   MLEKTIEKKLTTAVKKAGGIAPKFVSPSFAGMPDRIILLPDGKFAFAELKAPGESPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
            +    LR  G RV V+ S+E++   ++EL  +
Sbjct: 61  KARHRLLRSLGFRVYVIDSIEQIGGMIDELRTS 93


>gi|167757892|ref|ZP_02430019.1| hypothetical protein CLOSCI_00223 [Clostridium scindens ATCC 35704]
 gi|167664546|gb|EDS08676.1| hypothetical protein CLOSCI_00223 [Clostridium scindens ATCC 35704]
          Length = 120

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 48/90 (53%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E++LV   +K      K +  G  G PDRL++ P+G + + E+K P  R    Q
Sbjct: 26  MREKQIEQKLVREVRKRGGICPKFTSPGFAGMPDRLLLLPHGRMAFAELKAPGCRPRPLQ 85

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
            +  + L R G RV V+ S E+++  + E+
Sbjct: 86  EARHKLLARLGFRVYVIDSPEQIEKIMAEM 115


>gi|218133419|ref|ZP_03462223.1| hypothetical protein BACPEC_01284 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990794|gb|EEC56800.1| hypothetical protein BACPEC_01284 [Bacteroides pectinophilus ATCC
           43243]
          Length = 93

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 46/93 (49%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  VE+ L   AKK      K    G  G PDR+++ P+G + ++E+K P  +    Q
Sbjct: 1   MLESTVERHLREEAKKRKGMALKFVSPGMNGVPDRIVLMPDGKMAFVELKAPGKKPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +     L R G  V V+ ++E++   L+E+  T
Sbjct: 61  LKRKRMLERLGFPVYVVDNIEQIGGILDEIQST 93


>gi|313898077|ref|ZP_07831616.1| VRR-NUC domain protein [Clostridium sp. HGF2]
 gi|312957105|gb|EFR38734.1| VRR-NUC domain protein [Clostridium sp. HGF2]
          Length = 93

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 44/93 (47%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +EK+L T  KK      K       G PDRLI+ P+G   + E+K P       Q
Sbjct: 1   MLEKTIEKKLTTAVKKAGGIAPKFVSPSFAGMPDRLILLPDGKFAFAELKAPGESPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
            +    L   G RV V+ S+E++   ++EL  +
Sbjct: 61  KARHRLLHSLGFRVYVIDSVEQIGGMIDELRTS 93


>gi|154504836|ref|ZP_02041574.1| hypothetical protein RUMGNA_02346 [Ruminococcus gnavus ATCC 29149]
 gi|153794719|gb|EDN77139.1| hypothetical protein RUMGNA_02346 [Ruminococcus gnavus ATCC 29149]
          Length = 93

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 46/93 (49%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  VE+ L   A+K      K    G  G PDR+++ P+G + ++E+K P  +    Q
Sbjct: 1   MLESTVERHLREEARKRKGMALKFVSPGMNGVPDRIVLMPDGKMAFVELKAPGKKPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +     L R G  V V+ ++E++   L+E+  T
Sbjct: 61  LKRKRMLERLGFPVYVVDNIEQIGGILDEIQST 93


>gi|77412070|ref|ZP_00788396.1| P44 [Streptococcus agalactiae CJB111]
 gi|77161875|gb|EAO72860.1| P44 [Streptococcus agalactiae CJB111]
          Length = 109

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 46/93 (49%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK VE++LV+  KK      K       G PDRL+  P G    +EVK P G+    Q
Sbjct: 17  MREKIVEQKLVSEVKKRGGVCPKWVSPSFGGVPDRLVFLPKGKFGMVEVKAPGGKPRLLQ 76

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           ++  +     G +V VL S+E++   L+E+  T
Sbjct: 77  VTRHKMFDGLGFKVHVLDSVEKIGEVLDEIEFT 109


>gi|256617083|ref|ZP_05473929.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|257088354|ref|ZP_05582715.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|256596610|gb|EEU15786.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256996384|gb|EEU83686.1| conserved hypothetical protein [Enterococcus faecalis D6]
          Length = 95

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 45/90 (50%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            EK VE+ LV   K       K    G  G PDRL++ PNG + ++EVK P  +    Q
Sbjct: 1  MREKQVEQALVKAVKARGGICPKFVSPGLSGVPDRLVLMPNGKIAFVEVKAPKKKPRALQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
          +  +++L   G +  VL  +E++   + E+
Sbjct: 61 LYRMKQLTDLGFKCFVLDEVEQIPALIGEI 90


>gi|317501094|ref|ZP_07959300.1| VRR-NUC domain-containing protein [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|316897481|gb|EFV19546.1| VRR-NUC domain-containing protein [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 93

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 43/93 (46%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E +L    KK      K       G PDRLI+ P+G + + E+K P  +    Q
Sbjct: 1   MIEKQIENKLTMAVKKNGGIALKLVCPSFAGMPDRLILLPDGHIGFAELKAPGKKPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +S    LR  G RV V+   E++   + EL  T
Sbjct: 61  LSRHRLLRELGYRVYVIDDPEQIGGMINELQST 93


>gi|225405818|ref|ZP_03761007.1| hypothetical protein CLOSTASPAR_05039 [Clostridium asparagiforme
          DSM 15981]
 gi|225042658|gb|EEG52904.1| hypothetical protein CLOSTASPAR_05039 [Clostridium asparagiforme
          DSM 15981]
          Length = 96

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 50/89 (56%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            EKD+E++LV G K+L     K +  G  G PDR++  P      +E+K  TG+LS  Q
Sbjct: 1  MREKDIEQKLVQGVKRLGGRAFKWTSPGNDGVPDRIVFLPGRPPVLVELKTDTGKLSALQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
            +I  LR  GQ V+VL  +++V  FL E
Sbjct: 61 RIQIGRLRDLGQDVRVLYGLDQVLEFLNE 89


>gi|256847829|ref|ZP_05553274.1| phage associated protein [Lactobacillus coleohominis 101-4-CHN]
 gi|256715518|gb|EEU30494.1| phage associated protein [Lactobacillus coleohominis 101-4-CHN]
          Length = 93

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 42/93 (45%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E   V    +      K +     G PDRL++ P+G + ++E+K P       Q
Sbjct: 1   MLEKRIETAFVKATHQRGGLCLKFTSPSMAGVPDRLVLLPDGHMGFVEMKAPGKHPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +  I +L+R G +V V    +++   L+ +   
Sbjct: 61  VQRINQLKRLGYQVFVCDQFDQIGGMLDAIQAA 93


>gi|323484111|ref|ZP_08089481.1| hypothetical protein HMPREF9474_01232 [Clostridium symbiosum
           WAL-14163]
 gi|323402553|gb|EGA94881.1| hypothetical protein HMPREF9474_01232 [Clostridium symbiosum
           WAL-14163]
          Length = 93

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 44/93 (47%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +E++L    KK+     K    G  G PDR+++ P+  + ++E+K P  +L   Q
Sbjct: 1   MRENAIERQLAMAVKKMGGMAVKFVSPGLDGVPDRIVLLPDKKMAFVELKAPGKKLRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
                +L   G  V V+   E++   L+E+  T
Sbjct: 61  EKRRWQLEALGFPVYVIDGAEQIGGVLDEICST 93


>gi|227544669|ref|ZP_03974718.1| phage associated protein [Lactobacillus reuteri CF48-3A]
 gi|300909416|ref|ZP_07126877.1| VRR-NUC domain protein [Lactobacillus reuteri SD2112]
 gi|227185351|gb|EEI65422.1| phage associated protein [Lactobacillus reuteri CF48-3A]
 gi|300893281|gb|EFK86640.1| VRR-NUC domain protein [Lactobacillus reuteri SD2112]
          Length = 148

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 42/91 (46%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E   V    +      K +     G PDRL++ P+G + ++E+K P       Q
Sbjct: 56  MLEKQIETTFVKATHQRGGLCLKFTSPSMAGVPDRLVLLPDGHMGFVEMKAPGKHPRPLQ 115

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           +  + +L++ G +V V    +++   L+ + 
Sbjct: 116 VQRLNQLKQLGYQVFVCDQFDQIGGMLDAIQ 146


>gi|227544672|ref|ZP_03974721.1| phage associated protein [Lactobacillus reuteri CF48-3A]
 gi|300909461|ref|ZP_07126922.1| VRR-NUC domain protein [Lactobacillus reuteri SD2112]
 gi|227185348|gb|EEI65419.1| phage associated protein [Lactobacillus reuteri CF48-3A]
 gi|300893326|gb|EFK86685.1| VRR-NUC domain protein [Lactobacillus reuteri SD2112]
          Length = 148

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 41/91 (45%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E   V    +      K       G PDRL++ P+G + ++E+K P  R    Q
Sbjct: 56  MLEKQIETAFVKATHQRGGLCLKFISPSMAGVPDRLVLLPDGHMGFVEMKAPGKRPRPLQ 115

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           +  + +L++ G +V V     ++   L+ + 
Sbjct: 116 VQRLSQLKQLGYQVFVCDQFGQIGGMLDAIQ 146


>gi|259502600|ref|ZP_05745502.1| hypothetical protein HMPREF0494_0896 [Lactobacillus antri DSM
          16041]
 gi|259169415|gb|EEW53910.1| hypothetical protein HMPREF0494_0896 [Lactobacillus antri DSM
          16041]
          Length = 93

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 42/91 (46%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            EK +E   V    +      K       G PDRL++ P+G + ++E+K P       Q
Sbjct: 1  MLEKQIETAFVKATHQRGGLCLKFISPSMAGVPDRLVLLPDGHMGFVEMKAPGKHPRPLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          +  + +L++ G +V V   ++++   L+ + 
Sbjct: 61 VQRLNQLKQLGFQVFVCDQLDQIGGMLDAIQ 91


>gi|227530257|ref|ZP_03960306.1| VRR_NUC domain protein [Lactobacillus vaginalis ATCC 49540]
 gi|227349830|gb|EEJ40121.1| VRR_NUC domain protein [Lactobacillus vaginalis ATCC 49540]
          Length = 93

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 42/91 (46%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            EK +E   V    +      K +     G PDRL++ P+G + ++E+K P  R    Q
Sbjct: 1  MLEKRIETAFVKATHQRGGLCLKFTSPSMAGVPDRLVLLPDGHMGFVEMKAPGKRPRPLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          +  + +L++ G +V V     ++   L+ + 
Sbjct: 61 VQRLSQLKQLGYQVFVCDQFGQIGGMLDAIQ 91


>gi|219855698|ref|YP_002472820.1| hypothetical protein CKR_2355 [Clostridium kluyveri NBRC 12016]
 gi|219569422|dbj|BAH07406.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 106

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 51/94 (54%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
           +  EK +EK+LV   KK+     K    G  G PDRL++ P+G + ++E+K P  +    
Sbjct: 13  FMLEKYIEKKLVAEVKKMGGIAAKFVSPGLDGMPDRLVLLPHGKMAFVELKAPGKKPRLL 72

Query: 68  QMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           Q+  I++L++ G    V+  ++++   L E+  +
Sbjct: 73  QIRRIKQLQKLGFACYVIDDVKQIGGILGEIQSS 106


>gi|150391740|ref|YP_001321789.1| VRR_NUC domain-containing protein [Alkaliphilus metalliredigens
          QYMF]
 gi|149951602|gb|ABR50130.1| VRR_NUC domain protein [Alkaliphilus metalliredigens QYMF]
          Length = 94

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 46/91 (50%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
           TEK +E++LV   K+      K    G  G PDR+++ P G + ++E+K P  ++   Q
Sbjct: 1  MTEKYIEQKLVKAVKERGGIAPKFVSPGLDGVPDRIVLLPMGRMAFVELKAPGNKMRPLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          +    +L   G  V  +  +E++   L+E+ 
Sbjct: 61 VKRKTQLEALGFLVYCIDGVEQIGGVLDEIK 91


>gi|57234141|ref|YP_181812.1| hypothetical protein DET1097 [Dehalococcoides ethenogenes 195]
 gi|57224589|gb|AAW39646.1| conserved hypothetical protein [Dehalococcoides ethenogenes 195]
          Length = 95

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 46/91 (50%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
           EK +EK+L+   K +     K    G  G PDRL++ P G + + E+K P  +    Q++
Sbjct: 5   EKTIEKKLINAVKSMGGIAPKFVSPGFDGMPDRLVLLPGGVMAFAELKAPGKKPRPLQLA 64

Query: 71  EIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
               LR  G +V V+  + ++   L+EL  T
Sbjct: 65  RHRLLRELGFKVYVIDDISQIGGMLDELHAT 95


>gi|298346381|ref|YP_003719068.1| VRR-NUC domain-containing protein [Mobiluncus curtisii ATCC 43063]
 gi|298236442|gb|ADI67574.1| VRR-NUC domain protein [Mobiluncus curtisii ATCC 43063]
          Length = 93

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 44/93 (47%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+ +E+ LV   + L     K    G  G PDR+++ P+G + ++EVK P G++   Q
Sbjct: 1   MKEQHLEQALVKTVEALGGVCWKLVSPGTAGVPDRIVLLPDGHVGFVEVKAPGGKVRAIQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
              + +L+  G    VL + +++      +   
Sbjct: 61  KHRLRQLKHLGFTALVLNNPDDIKKVCHAIQAA 93


>gi|227498326|ref|ZP_03928476.1| diacylglycerol kinase [Acidaminococcus sp. D21]
 gi|226903788|gb|EEH89706.1| diacylglycerol kinase [Acidaminococcus sp. D21]
          Length = 102

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 47/93 (50%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK++E  LV   +K      K       G PDRL++  +G + ++EVK P  +    Q
Sbjct: 1   MREKEIEHNLVMETRKAGGMAVKFVSPSFSGMPDRLVLLGDGKIGFVEVKAPGQKPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +     LRR G +V VL +ME++   L+ +A T
Sbjct: 61  LKRHAMLRRLGYQVFVLDAMEDIPAVLKAIAHT 93


>gi|291556510|emb|CBL33627.1| VRR-NUC domain [Eubacterium siraeum V10Sc8a]
          Length = 93

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 45/91 (49%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            EK VE+ LV   K       K    G  G PDRL++ P G + ++EVK P       Q
Sbjct: 1  MREKIVEQHLVKAVKSSGGIAPKLVSPGFDGMPDRLVLLPGGKIGFVEVKAPGKEPRPLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          ++    LRR G +V +L  +E++   L+E+ 
Sbjct: 61 VARHGLLRRLGFKVYILDDLEQIGGILDEIR 91


>gi|300764699|ref|ZP_07074690.1| conserved hypothetical protein [Listeria monocytogenes FSL
          N1-017]
 gi|300514585|gb|EFK41641.1| conserved hypothetical protein [Listeria monocytogenes FSL
          N1-017]
          Length = 94

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 48/90 (53%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            EK VE+ LV   K++     K +  G  G PDRL++ PNG L ++EVK P  +    Q
Sbjct: 1  MREKQVEQALVKAVKRVGGICPKFTSPGLAGVPDRLVLMPNGKLGFVEVKAPGKKPRSLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
          +  +++L   G +  VL  ++++   LE +
Sbjct: 61 LFRMKQLTDLGFQCFVLDEIDQIPELLERI 90


>gi|220930419|ref|YP_002507328.1| VRR-NUC domain protein [Clostridium cellulolyticum H10]
 gi|220000747|gb|ACL77348.1| VRR-NUC domain protein [Clostridium cellulolyticum H10]
          Length = 86

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 35/86 (40%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  +EK L    +       K    G  G PDR+ + P G + ++E K P  +    Q
Sbjct: 1  MRESKIEKTLKKSVEAKGGKCLKFVSPGMSGVPDRICLYPGGKIIFVETKAPNKKPRPLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNF 94
               ELR  G  V+V+ S  E +  
Sbjct: 61 EKRHNELRSLGFEVRVIDSEAEANEI 86


>gi|238854133|ref|ZP_04644480.1| phage associated protein [Lactobacillus gasseri 202-4]
 gi|238833209|gb|EEQ25499.1| phage associated protein [Lactobacillus gasseri 202-4]
          Length = 93

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 42/93 (45%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E   V   ++      K +     G PDRL++ P G + ++E+K P       Q
Sbjct: 1   MLEKRIESAFVKATQQRGGLCLKFTSPSMTGVPDRLVLLPEGHMGFVEMKSPGKHPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +  + +L++ G +V V    E++   L+ +   
Sbjct: 61  IQRLSQLKQLGYQVFVCDQFEQIGGMLDAIQAA 93


>gi|225573261|ref|ZP_03782016.1| hypothetical protein RUMHYD_01452 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039393|gb|EEG49639.1| hypothetical protein RUMHYD_01452 [Blautia hydrogenotrophica DSM
           10507]
          Length = 104

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 44/94 (46%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
           +  EK +E++     +       K    G  G PDRL + P G + ++EVK P  +    
Sbjct: 11  FVKEKIIEQKFRAAVRTAGGVAVKFVSPGLDGMPDRLALLPGGRMAFVEVKAPGKKPRPL 70

Query: 68  QMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           Q +    LRR G +V VL   +++   ++E+  T
Sbjct: 71  QEARHRMLRRLGFQVYVLDDEKQIGGIIDEIQST 104


>gi|315654959|ref|ZP_07907864.1| VRR-NUC domain protein [Mobiluncus curtisii ATCC 51333]
 gi|315490920|gb|EFU80540.1| VRR-NUC domain protein [Mobiluncus curtisii ATCC 51333]
          Length = 93

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 44/93 (47%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+ +E+ LV   + L     K    G  G PDR+++ P+G + ++EVK P G++   Q
Sbjct: 1   MKEQHLEQALVKTIEALGGVCWKLVSPGTAGVPDRIVLLPDGHVGFVEVKAPGGKVRAIQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
              + +L+  G    VL + +++      +   
Sbjct: 61  KHRLRQLKHLGFTALVLNNPDDIKKVCHAIQAA 93


>gi|304406780|ref|ZP_07388435.1| VRR-NUC domain protein [Paenibacillus curdlanolyticus YK9]
 gi|304344313|gb|EFM10152.1| VRR-NUC domain protein [Paenibacillus curdlanolyticus YK9]
          Length = 102

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 42/93 (45%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+D+E  L    +       K +  G  G PDR+++ P G + ++E+K P  + +  Q
Sbjct: 1   MRERDIETYLREKVRAAGGKAYKWTSPGNAGVPDRIVMLPGGRVAFVELKAPGKKATPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +++   +   G  V V+ S    D F+  +   
Sbjct: 61  VNQQRTISNLGLPVTVIDSKAGADAFISRMQAA 93


>gi|50914496|ref|YP_060468.1| hypothetical protein M6_Spy1150 [Streptococcus pyogenes MGAS10394]
 gi|40218554|gb|AAR83208.1| hypothetical protein [Streptococcus pyogenes]
 gi|50261599|gb|AAT72367.1| unknown [Streptococcus pyogenes]
 gi|50903570|gb|AAT87285.1| Phage-related protein [Streptococcus pyogenes MGAS10394]
          Length = 100

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 42/96 (43%)

Query: 6   FHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
           F    EK VE+ LV   K       K       G PDRL+  P G    +EVK P  +  
Sbjct: 5   FRTMREKYVEQALVKSVKARGGICPKWVSPSFSGVPDRLVFLPKGKFGLVEVKAPDQKPR 64

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
             Q+S  +   R G +V V+  +E +   L+E+  T
Sbjct: 65  KLQVSRHKLFERLGFKVYVIDRIEMIGEVLDEIDIT 100


>gi|42779466|ref|NP_976713.1| phage protein, putative [Bacillus cereus ATCC 10987]
 gi|42735382|gb|AAS39321.1| phage protein, putative [Bacillus cereus ATCC 10987]
          Length = 93

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 50/93 (53%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +EK+LV   KK++    K    G  G PDR+++ P+G + +IE+K P  +    Q
Sbjct: 1   MLEKYIEKKLVAEVKKMEGIAAKFVSPGLDGMPDRIVLLPHGKMAFIELKAPGKKPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +  I +L++ G    V+  ++++   L E+  +
Sbjct: 61  IRRIRQLQKLGFTCYVIDDVKQIGGVLGEIQSS 93


>gi|167630963|ref|YP_001681462.1| hypothetical protein HM1_2942 [Heliobacterium modesticaldum Ice1]
 gi|167593703|gb|ABZ85451.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 93

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 40/93 (43%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E +L    K +     K    G  G PDRL++ P+G L +IE+K    R    Q
Sbjct: 1   MREKTIEIKLKNTVKSMGGIALKLISPGFDGVPDRLVLLPHGKLAFIELKASGKRPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
                +L   G  V  +    ++   L+E+  +
Sbjct: 61  EKRKRQLEALGFLVFCIDGAGQIGGILDEIQSS 93


>gi|317132763|ref|YP_004092077.1| VRR-NUC domain-containing protein [Ethanoligenens harbinense
           YUAN-3]
 gi|315470742|gb|ADU27346.1| VRR-NUC domain-containing protein [Ethanoligenens harbinense
           YUAN-3]
          Length = 95

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 49/94 (52%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
           ++EK +E++L +  K+      K    G  G PDR+I+ P   + + E+K P  +    Q
Sbjct: 2   RSEKQIEQKLASEVKRRGGIAPKFVSPGFDGMPDRIILLPGARIAFAELKAPGKKPRRLQ 61

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
            +    LR+ G RV V+ + E++   ++E+  +L
Sbjct: 62  YARHRLLRKLGFRVYVIDNPEQIGGVIDEIENSL 95


>gi|325478671|gb|EGC81782.1| VRR-NUC domain protein [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 93

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 42/90 (46%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E ++EK LV   K       K +     G PDR+I+ P G + ++E K+P G     Q
Sbjct: 1  MLENEIEKALVDKVKPHGGLCLKFTSPSMTGIPDRIILLPKGKIGFVETKRPGGEPRPIQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
             I + +  G +V VL S E +D  +  +
Sbjct: 61 KRRIRQFKNLGFKVYVLDSKENIDEIINRI 90


>gi|220930214|ref|YP_002507123.1| VRR-NUC domain protein [Clostridium cellulolyticum H10]
 gi|220000542|gb|ACL77143.1| VRR-NUC domain protein [Clostridium cellulolyticum H10]
          Length = 93

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 50/93 (53%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +EK+LV   KK+     K    G  G PDRL++ P+G + ++E+K P  +    Q
Sbjct: 1   MLEKYIEKKLVAEVKKMGGIAAKFVSPGLDGMPDRLVLLPHGKMAFVELKAPGKKPRLLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +  I++L++ G    V+  ++++   L E+  +
Sbjct: 61  IRRIKQLQKLGFTCYVIDDVKQIGGVLGEIQSS 93


>gi|153955275|ref|YP_001396040.1| hypothetical protein CKL_2657 [Clostridium kluyveri DSM 555]
 gi|146348133|gb|EDK34669.1| Phage-related protein [Clostridium kluyveri DSM 555]
          Length = 93

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 50/93 (53%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +EK+LV   KK+     K    G  G PDRL++ P+G + ++E+K P  +    Q
Sbjct: 1   MLEKYIEKKLVAEVKKMGGIAAKFVSPGLDGMPDRLVLLPHGKMAFVELKAPGKKPRLLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +  I++L++ G    V+  ++++   L E+  +
Sbjct: 61  IRRIKQLQKLGFACYVIDDVKQIGGILGEIQSS 93


>gi|300853543|ref|YP_003778527.1| phage-like protein [Clostridium ljungdahlii DSM 13528]
 gi|300433658|gb|ADK13425.1| phage-related protein [Clostridium ljungdahlii DSM 13528]
          Length = 93

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 44/93 (47%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E +LVT  KK+     K    G  G PDRL+  P+G   ++E+K    ++   Q
Sbjct: 1   MLEKYIENKLVTAVKKMGGICPKFVSPGFDGVPDRLVFLPHGKFAFVELKAKGKKMRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           ++   +L + G  V  +    ++   L E+  +
Sbjct: 61  VNRKMQLEQLGFLVYCIDDASKIGGILNEIQSS 93


>gi|116630099|ref|YP_815271.1| Phage associated protein [Lactobacillus gasseri ATCC 33323]
 gi|116095681|gb|ABJ60833.1| Phage associated protein [Lactobacillus gasseri ATCC 33323]
          Length = 103

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 42/93 (45%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E   V   ++      K +     G PDRL++ P G + ++E+K P       Q
Sbjct: 11  MLEKRIESAFVKATQQRGGLCLKFTSPSMTGVPDRLVLLPEGHMGFVEMKSPGKHPRPLQ 70

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +  + +L++ G +V V    E++   L+ +   
Sbjct: 71  IQRLSQLKQLGYQVFVCDQFEQIGGMLDAIQAA 103


>gi|297583089|ref|YP_003698869.1| VRR-NUC domain-containing protein [Bacillus selenitireducens
          MLS10]
 gi|297141546|gb|ADH98303.1| VRR-NUC domain protein [Bacillus selenitireducens MLS10]
          Length = 96

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 43/91 (47%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
           TEKD+EK+LV   +       K    G  G PDRLI+ P G + ++EVK P  RL   Q
Sbjct: 1  MTEKDIEKQLVVSTRTAGGMAPKLVSPGFDGIPDRLILMPGGRIGFVEVKAPGKRLRPLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
               +L   G    VL  +E++   L  + 
Sbjct: 61 EKRKRQLEALGFSAFVLDGVEQIPEILTAIQ 91


>gi|319757799|gb|ADV69741.1| hypothetical protein SSUJS14_0650 [Streptococcus suis JS14]
          Length = 93

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 41/93 (44%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK VE+ LV   K       K       G PDRL+  PNG    +EVK P  +    Q
Sbjct: 1   MREKYVEQALVKSVKARGGICPKWVSPSFSGVPDRLVFLPNGKFGLVEVKAPDQKPRMLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +S  +   + G  V V+  +E +   L+E+  T
Sbjct: 61  VSRHKLFEQLGFTVYVIDRIEMIGEVLDEIDIT 93


>gi|331090253|ref|ZP_08339140.1| hypothetical protein HMPREF1025_02723 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330401872|gb|EGG81447.1| hypothetical protein HMPREF1025_02723 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 108

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 41/94 (43%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
              E  +EK LV  AK       K    G  G PDRL++ P G   ++E+K P  +L   
Sbjct: 15  VLRESVIEKALVKEAKSRGGMAVKFVSPGFDGVPDRLVLLPGGKCAFVELKAPGKKLRPL 74

Query: 68  QMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +     +L   G  V V+  +E++   L  +  T
Sbjct: 75  KEKRKHQLEALGFSVYVIDGLEQIGGVLHGIQTT 108


>gi|168179445|ref|ZP_02614109.1| phage associated protein [Clostridium botulinum NCTC 2916]
 gi|182669696|gb|EDT81672.1| phage associated protein [Clostridium botulinum NCTC 2916]
          Length = 91

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 49/91 (53%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  +EKRL    +KL     K    G  G PDR+++ P G + ++E+K P  +    Q
Sbjct: 1  MLESSIEKRLKKEIEKLSGKALKFVSPGVSGVPDRIVLLPQGRIIFVELKAPGKKPRPIQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
             I+EL   G RV+++ S+E ++NF+ E+ 
Sbjct: 61 KYRIKELTALGFRVEIIDSIEGINNFIREIK 91


>gi|284048431|ref|YP_003398770.1| VRR-NUC domain protein [Acidaminococcus fermentans DSM 20731]
 gi|283952652|gb|ADB47455.1| VRR-NUC domain protein [Acidaminococcus fermentans DSM 20731]
          Length = 100

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 45/93 (48%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
          ++  EK +E  LVT  +K      K       G PDRL++ P+G + ++EVK P  +   
Sbjct: 2  NFLREKQIEHSLVTAVRKQGGLALKFVSPSYAGMPDRLVLLPDGKMAFVEVKAPGKKPRV 61

Query: 67 QQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           Q  +   LR  G +V VL     +   L+++A
Sbjct: 62 LQEKQHRMLRALGFQVFVLDDASAIPGLLKKIA 94


>gi|76787039|ref|YP_329360.1| hypothetical protein SAK_0732 [Streptococcus agalactiae A909]
 gi|76562096|gb|ABA44680.1| conserved hypothetical protein [Streptococcus agalactiae A909]
          Length = 93

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 44/93 (47%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK VE++LV+  +       K       G PDRL+  P+G    +EVK P  +    Q
Sbjct: 1   MREKVVERKLVSEVRNRGGICPKWVSPSFAGVPDRLVFLPSGKFGLVEVKAPGEKPRLLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +S      R G +V VL  ++++   L+E+  T
Sbjct: 61  VSRHRLFERLGFKVHVLDRVDKIGEVLDEIETT 93


>gi|313618478|gb|EFR90481.1| putative protein p44 [Listeria innocua FSL S4-378]
          Length = 93

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 43/93 (46%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E++LV   K +     K    G  G PDR+++ P G + ++E K    ++   Q
Sbjct: 1   MQEKYIEQKLVATVKSMGGMAPKFVSPGIDGMPDRIVLLPMGRIAFVECKATGKKMRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
               ++L   G  V  L  +E++   L E+  T
Sbjct: 61  NKRKKQLEALGFLVYCLDDIEQIGGILSEIQAT 93


>gi|153940485|ref|YP_001391669.1| VRR-NUC domain-containing protein [Clostridium botulinum F str.
          Langeland]
 gi|152936381|gb|ABS41879.1| VRR-NUC domain protein [Clostridium botulinum F str. Langeland]
          Length = 93

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 50/91 (54%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  +EKRL    +KL     K    G  G PDR+++ P G + ++E+K P  +    Q
Sbjct: 1  MEESRIEKRLKKEIEKLGGKALKFVSPGVSGVPDRIVLLPEGRIIFVELKAPGKKPRPIQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
             I+ELR  G RV+++ S+E ++NF+E + 
Sbjct: 61 KYRIKELRSLGFRVEIIDSIERINNFVEGIK 91


>gi|167039883|ref|YP_001662868.1| hypothetical protein Teth514_1238 [Thermoanaerobacter sp. X514]
 gi|300915370|ref|ZP_07132684.1| VRR-NUC domain protein [Thermoanaerobacter sp. X561]
 gi|307724793|ref|YP_003904544.1| VRR-NUC domain-containing protein [Thermoanaerobacter sp. X513]
 gi|166854123|gb|ABY92532.1| hypothetical protein Teth514_1238 [Thermoanaerobacter sp. X514]
 gi|300888646|gb|EFK83794.1| VRR-NUC domain protein [Thermoanaerobacter sp. X561]
 gi|307581854|gb|ADN55253.1| VRR-NUC domain-containing protein [Thermoanaerobacter sp. X513]
          Length = 93

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 44/93 (47%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK +E++LV   K +     K +  G  G PDRLI+ PN  L ++EVK P   L   Q
Sbjct: 1   MREKKIEQQLVKEVKDIGGIALKIASPGFDGMPDRLILLPNRKLAFVEVKAPGKTLRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
                +L   G  V  L  ++++   L E+  +
Sbjct: 61  EKRKRQLEALGFLVFCLDHIDQIGGILHEIQAS 93


>gi|313813467|gb|EFS51181.1| VRR-NUC domain protein [Propionibacterium acnes HL025PA1]
 gi|315106938|gb|EFT78914.1| VRR-NUC domain protein [Propionibacterium acnes HL030PA1]
          Length = 92

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 37/93 (39%), Gaps = 1/93 (1%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +E +L    +       K    G  G PDRL +   G + ++EVK P  +    Q
Sbjct: 1   MNEHHIEAQLKKAVEASGGLCWKLVCPGTTGVPDRLCLM-GGQVVFVEVKAPGKKPRPIQ 59

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
              + +L   G    V+ S++ +   L+ L   
Sbjct: 60  RRRMSQLAAHGFTALVVDSVDGIKEVLDALPAA 92


>gi|262113724|emb|CAR95391.1| hypothetical protein [Streptococcus phage phi-m46.1]
          Length = 93

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 40/93 (43%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK VE+ LV   K       K       G PDRL+  PNG     EVK P  +    Q
Sbjct: 1   MREKYVEQALVKSVKARGGICPKWVSPSFSGVPDRLVFLPNGKFGLAEVKAPDQKPRKLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
            S  +   R G +V V+  +E +   L+E+  T
Sbjct: 61  GSRHKLFERLGFKVYVIDRIEMIGEVLDEIDIT 93


>gi|50843065|ref|YP_056292.1| hypothetical protein PPA1595 [Propionibacterium acnes KPA171202]
 gi|50840667|gb|AAT83334.1| phage-related protein [Propionibacterium acnes KPA171202]
          Length = 92

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 37/93 (39%), Gaps = 1/93 (1%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +E +L    +       K    G  G PDRL +   G + ++EVK P  +    Q
Sbjct: 1   MNEHHIEAQLKKAVEASGGLCWKLVCPGTTGVPDRLCLM-GGQVVFVEVKAPGKKPRPIQ 59

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
              + +L   G    V+ S++ +   L+ L   
Sbjct: 60  RRRMSQLAAHGFTALVVDSVDGIKKVLDALPAA 92


>gi|325690427|gb|EGD32430.1| VRR-NUC domain protein [Streptococcus sanguinis SK115]
          Length = 103

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 50/93 (53%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+++E++L   +KK      K    G  G PDR+++ P G L ++E+K P  R    Q
Sbjct: 1   MREREIEEKLRVESKKRGGLAMKFVSPGLVGVPDRIVVLPQGRLGFVELKAPGERPRRIQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +  +E+LR+ G  V VL   E++   L+++  T
Sbjct: 61  VRRMEQLRKLGFLVYVLDDKEKIGEILDDIQGT 93


>gi|302873664|ref|YP_003842297.1| VRR-NUC domain-containing protein [Clostridium cellulovorans
          743B]
 gi|307686612|ref|ZP_07629058.1| VRR-NUC domain-containing protein [Clostridium cellulovorans
          743B]
 gi|302576521|gb|ADL50533.1| VRR-NUC domain-containing protein [Clostridium cellulovorans
          743B]
          Length = 92

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 46/90 (51%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  +EK L    KK      K    G  G PDRL++ PNG + ++E+K P   + H Q
Sbjct: 1  MRESKIEKALTIELKKRGGMALKFVSPGMAGVPDRLVLIPNGEVIFVELKAPGKTMRHLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
          +    +L   G RV V+ S+  VD+F+ E+
Sbjct: 61 LKRKSQLENLGFRVYVIDSLGGVDSFVREV 90


>gi|331648303|ref|ZP_08349392.1| putative protein p44 [Escherichia coli M605]
 gi|331042852|gb|EGI14993.1| putative protein p44 [Escherichia coli M605]
          Length = 98

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 39/80 (48%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y+ E  +EK LV   KK      K    GRR  PDR+++ P G + ++E K P       
Sbjct: 4  YERESLIEKHLVAEVKKAGGVAFKFVSPGRRSVPDRIVLLPGGRIVFVECKAPGKPPRPD 63

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q+ E E LR  G  V VL S
Sbjct: 64 QLREHERLRALGFTVVVLDS 83


>gi|313895645|ref|ZP_07829201.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975771|gb|EFR41230.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 122

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 42/90 (46%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E D+EK      K       K    G  G PDRL++ P G + ++E+K P  +    Q
Sbjct: 33  MRESDLEKFTRLYIKLHGGLALKFISPGCAGVPDRLVLMPGGKMCFMELKAPGRKPRPLQ 92

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
           +  IE+LR  G +V V+   EE+   +  L
Sbjct: 93  VRRIEQLRALGFKVYVVDGKEEIGGIINAL 122


>gi|260579062|ref|ZP_05846961.1| conserved hypothetical protein [Corynebacterium jeikeium ATCC
           43734]
 gi|258602813|gb|EEW16091.1| conserved hypothetical protein [Corynebacterium jeikeium ATCC
           43734]
          Length = 92

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 38/93 (40%), Gaps = 1/93 (1%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +E+ L    K +     K +  G  G PDR+ I   G + ++E+K P       Q
Sbjct: 1   MNEHAIEQHLKQAVKAIGGLCWKFTSPGTAGVPDRICIHR-GRVIFVELKAPGRLPRPIQ 59

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
              I++L   G  V V+ S+E      + L   
Sbjct: 60  RRRIQQLTDHGMDVVVVDSVEGTKEVADALRAA 92


>gi|300933381|ref|ZP_07148637.1| hypothetical protein CresD4_04880 [Corynebacterium resistens DSM
           45100]
          Length = 92

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 36/93 (38%), Gaps = 1/93 (1%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+ +E+ L    + +     K +  G  G PDR+ I   G + ++E+K P       Q
Sbjct: 1   MNEQAIEQHLKKAVEAIGGLCWKFTSPGTAGVPDRICIHR-GRVIFVELKAPGRLPRPIQ 59

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
              I +L   G    V+ S+       + L   
Sbjct: 60  RRRIHQLTDHGVDAVVVDSLTGAQGVADALRAA 92


>gi|227496459|ref|ZP_03926743.1| VRR-NUC domain protein [Actinomyces urogenitalis DSM 15434]
 gi|226834015|gb|EEH66398.1| VRR-NUC domain protein [Actinomyces urogenitalis DSM 15434]
          Length = 93

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 38/93 (40%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+ VE  LV   +       K    G  G PDRL++ P G +  +EVK P  R    Q
Sbjct: 1   MRERAVEAALVREVRARGGLCWKLVSPGTVGVPDRLVLLPAGHVGLVEVKAPGERPRAVQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
              I+++R  G    VL    +V    + +   
Sbjct: 61  RVRIDQVRALGTPCLVLDDPAKVGEVCDAICSA 93


>gi|197303502|ref|ZP_03168541.1| hypothetical protein RUMLAC_02224 [Ruminococcus lactaris ATCC
          29176]
 gi|197297500|gb|EDY32061.1| hypothetical protein RUMLAC_02224 [Ruminococcus lactaris ATCC
          29176]
          Length = 92

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            EK +E++LV   KK      K +  G  G PDR+++ P+G + ++EVK P  +    Q
Sbjct: 1  MREKYIEQKLVREVKKRGGLCEKWNS-GSSGWPDRIVLLPDGKIGFVEVKAPGEKSRKLQ 59

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          +   ++LR  G +V VL  M ++   ++ + 
Sbjct: 60 VHRHDQLRALGYKVFVLDDMGQIGGIIDAIQ 90


>gi|70726781|ref|YP_253695.1| hypothetical protein SH1780 [Staphylococcus haemolyticus
          JCSC1435]
 gi|68447505|dbj|BAE05089.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 92

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 49/90 (54%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  +E  LV   KKL     K    G RG PDR++I P G  +++E+K+P GR+   Q
Sbjct: 1  MRESKIESYLVREVKKLKGLCLKWVSPGTRGVPDRIVIMPKGKTYYVEMKQPNGRVDPLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
              ++L  R  +V  L + E+V+ F++++
Sbjct: 61 QYMHKQLTNRDHQVFTLWTKEQVNEFIKKV 90


>gi|66395482|ref|YP_239851.1| ORF037 [Staphylococcus phage 2638A]
 gi|62635909|gb|AAX91020.1| ORF037 [Staphylococcus phage 2638A]
          Length = 98

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 49/93 (52%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E ++EK LV   KK      K    G RG PDR++I P G  +++E+K+P GR    Q
Sbjct: 1   MRESNIEKYLVKEVKKKKGLCLKWVAPGTRGVPDRIVIMPKGKTYYVEMKQPKGRTDPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
               ++L  RG +V  L   ++VD F++++   
Sbjct: 61  KYMHKQLEDRGHQVFTLWDKKQVDEFIKKVGAK 93


>gi|191174025|ref|ZP_03035542.1| VRR_NUC domain protein [Escherichia coli F11]
 gi|190905716|gb|EDV65338.1| VRR_NUC domain protein [Escherichia coli F11]
 gi|324014346|gb|EGB83565.1| VRR-NUC domain protein [Escherichia coli MS 60-1]
          Length = 98

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 40/80 (50%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y+ E  +EK LV   KK      K    GRR  PDR+++ P G + ++E K P+      
Sbjct: 4  YERESLIEKHLVAEVKKAGGVAFKFVSPGRRSVPDRIVLLPGGRIVFVECKAPSKPPRPD 63

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q+ E E LR  G  V VL S
Sbjct: 64 QLREHERLRALGFTVVVLDS 83


>gi|134299060|ref|YP_001112556.1| hypothetical protein Dred_1197 [Desulfotomaculum reducens MI-1]
 gi|134051760|gb|ABO49731.1| conserved hypothetical protein [Desulfotomaculum reducens MI-1]
          Length = 93

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 40/90 (44%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  +E++     ++      K +  G  G PDR+++ P G   ++E+K P       Q
Sbjct: 1  MNEAQIERKFKREVERRGGKAWKFTSPGMSGVPDRIVLLPGGRSIFVELKAPGEEPRPLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
          +   +EL   G  V  + S   ++ F+ E+
Sbjct: 61 VKRAKELTELGFEVYCIDSFAAINKFVIEV 90


>gi|304439203|ref|ZP_07399121.1| VRR-NUC domain protein [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372335|gb|EFM25923.1| VRR-NUC domain protein [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 93

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 44/90 (48%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E ++EK LV   K       K + +   G PDR+I+ P G + ++E K+P G     Q
Sbjct: 1  MLENEIEKALVDKVKLHGGLCLKFTSLSMTGIPDRIILLPKGKVGFVETKRPGGEPRPIQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
             I + +  G +V VL S E +D  ++ +
Sbjct: 61 KKRIRQFKNLGFKVYVLDSKENIDEIIKRI 90


>gi|300933479|ref|ZP_07148735.1| hypothetical protein CresD4_05372 [Corynebacterium resistens DSM
           45100]
          Length = 92

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 1/93 (1%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +E+ L    + +     K +  G  G PDR+ I   G + ++E+K P       Q
Sbjct: 1   MNEHAIEQHLKQAVEAIGGICWKFTSPGTAGVPDRICIHR-GRVIFVELKAPGRLPRPIQ 59

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
              I++L   G  V V+ S+E      + L   
Sbjct: 60  RRRIQQLTDHGMDVVVVDSVEGTKEVADALRAA 92


>gi|227875062|ref|ZP_03993207.1| phage associated protein [Mobiluncus mulieris ATCC 35243]
 gi|304390305|ref|ZP_07372258.1| VRR-NUC domain protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|306817349|ref|ZP_07451094.1| VRR-NUC domain protein [Mobiluncus mulieris ATCC 35239]
 gi|227844340|gb|EEJ54504.1| phage associated protein [Mobiluncus mulieris ATCC 35243]
 gi|304326061|gb|EFL93306.1| VRR-NUC domain protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|304649790|gb|EFM47070.1| VRR-NUC domain protein [Mobiluncus mulieris ATCC 35239]
          Length = 92

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 43/93 (46%), Gaps = 1/93 (1%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+ +E +L    +       K    G  G PDR+ +  N  + ++E+K P  +    Q
Sbjct: 1   MNERTIEHQLKKAIEASGGLCWKLVCPGTTGVPDRICLMRN-RVVFVELKAPGKQPRPIQ 59

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +  + +LR++G    V+ S++ +   L+ L+  
Sbjct: 60  VRRMNQLRQQGFTALVVDSIDGIQEVLDALSAA 92


>gi|48697220|ref|YP_024950.1| hypothetical protein BcepC6B_gp30 [Burkholderia phage BcepC6B]
 gi|47779026|gb|AAT38389.1| gp30 [Burkholderia phage BcepC6B]
          Length = 280

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 46/90 (51%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
              EK VE  LV   +       K S   R   PDR++I P   ++++E+K+P  + +  
Sbjct: 15  IMLEKTVETYLVDRVRAAGGDAYKFSSPARVSVPDRIVIFPPARVYFVELKRPGNKPTKG 74

Query: 68  QMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           Q+ E E LR  G  V+V+ S E VD F+ E
Sbjct: 75  QLREHERLRALGCDVRVIDSREAVDAFVLE 104


>gi|253581728|ref|ZP_04858952.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
 gi|251836077|gb|EES64614.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
          Length = 97

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 50/91 (54%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            EK++EK L    KKL     K +  G  G PDRL++ P G + ++E+K P G+ +  Q
Sbjct: 1  MREKEIEKYLREEIKKLGGIAYKFTSPGNSGVPDRLVLLPCGVVAFVELKAPGGKTTAIQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
            +I  +++    V ++ S  +VD F++++ 
Sbjct: 61 DRQIARIQKLDFDVYIVDSKFKVDCFIQDMQ 91


>gi|315656931|ref|ZP_07909818.1| VRR-NUC domain protein [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|315492886|gb|EFU82490.1| VRR-NUC domain protein [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 92

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+ +E++L    +       K    G  G PDR+ +  N  + ++E+K    +    Q
Sbjct: 1   MNERTIERQLKKAVEACGGLCWKLVCPGTSGVPDRICLM-NSRVVFVELKAAGKQPRPIQ 59

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
              + +LR +G +  V+ S++ +   L+ L   
Sbjct: 60  QRRMSQLRDQGFQTFVVDSVDGIREVLDALHAA 92


>gi|170023448|ref|YP_001719953.1| VRR-NUC domain-containing protein [Yersinia pseudotuberculosis
          YPIII]
 gi|169749982|gb|ACA67500.1| VRR-NUC domain protein [Yersinia pseudotuberculosis YPIII]
          Length = 89

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 41/82 (50%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y  E  +E  LV   KK      K    GRR  PDRL++ P G + ++E K P  + +  
Sbjct: 3  YIREDSIEAHLVKEVKKAGGIAYKFISPGRRSVPDRLVLLPGGNVIFVECKAPGEKPTAA 62

Query: 68 QMSEIEELRRRGQRVKVLVSME 89
          Q+ E E++R  G  V VL S +
Sbjct: 63 QLREHEKIRALGFAVWVLDSKD 84


>gi|295096882|emb|CBK85972.1| VRR-NUC domain [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 91

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 39/80 (48%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y+ E  +EK LV   KK      K    GRR  PDR+++ P G L ++E K P       
Sbjct: 3  YERESLIEKHLVAEVKKAGGVAYKFVSPGRRSVPDRIVLLPGGRLVFVECKAPGKPPRAD 62

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q+ E E LR  G  V VL S
Sbjct: 63 QLREHERLRALGFTVVVLDS 82


>gi|297585288|ref|YP_003701068.1| VRR-NUC domain-containing protein [Bacillus selenitireducens
          MLS10]
 gi|297143745|gb|ADI00503.1| VRR-NUC domain protein [Bacillus selenitireducens MLS10]
          Length = 93

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 42/89 (47%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E+ +E+              K    G  G PDRL I P G + ++E+K+P G+    Q
Sbjct: 1  MEEQKLEQTFKRAVLNHGGLALKLITPGYAGIPDRLAILPGGRVAFVEMKRPGGKPRPLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
          +   E+LR+ G  V V+ S E +  +L E
Sbjct: 61 VKRHEQLRQLGCDVAVIDSNERLGAWLAE 89


>gi|188494825|ref|ZP_03002095.1| phage associated protein [Escherichia coli 53638]
 gi|188490024|gb|EDU65127.1| phage associated protein [Escherichia coli 53638]
 gi|323173127|gb|EFZ58758.1| VRR-NUC domain protein [Escherichia coli LT-68]
 gi|332088067|gb|EGI93192.1| VRR-NUC domain protein [Shigella boydii 5216-82]
          Length = 98

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 39/80 (48%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y+ E  +EK LV   KK      K    G R  PDR+++ P G + ++E K P       
Sbjct: 12 YERESLIEKHLVAEVKKAGGVAFKFVSPGHRSVPDRIVLLPGGRIVFVECKSPGKPPRPD 71

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q+ E E LR+ G  V VL S
Sbjct: 72 QLREHERLRKLGFTVVVLDS 91


>gi|194429282|ref|ZP_03061809.1| VRR-NUC domain protein [Escherichia coli B171]
 gi|218555137|ref|YP_002388050.1| hypothetical protein ECIAI1_2667 [Escherichia coli IAI1]
 gi|194412690|gb|EDX28985.1| VRR-NUC domain protein [Escherichia coli B171]
 gi|218361905|emb|CAQ99505.1| conserved hypothetical protein from bacteriophage origin
          [Escherichia coli IAI1]
 gi|323159214|gb|EFZ45204.1| VRR-NUC domain protein [Escherichia coli E128010]
          Length = 95

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 38/80 (47%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y+ E  +EK LV   KK      K    GRR  PDR+++ P G + ++E K P       
Sbjct: 3  YERENLIEKHLVAEVKKAGGVAFKFVSPGRRSVPDRIVLLPGGRIIFVECKSPGKPPRPD 62

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q+ E   LR  G  V VL S
Sbjct: 63 QLREHGRLRALGFTVVVLDS 82


>gi|304389861|ref|ZP_07371820.1| VRR-NUC domain protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|304327037|gb|EFL94276.1| VRR-NUC domain protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
          Length = 92

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 42/93 (45%), Gaps = 1/93 (1%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+ +E +L    + +     K    G  G PDR+ +  N    ++E+K P       Q
Sbjct: 1   MNERTIEAKLKKAVEDIGGLCWKLVCPGTIGVPDRICLMRN-RAVFVELKVPGQNPRPIQ 59

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +  + +LR +G    V+ S++++   L+ L+  
Sbjct: 60  LRRMNQLRYQGFTALVVDSVDDIQEVLDALSAA 92


>gi|262043425|ref|ZP_06016550.1| hypothetical protein HMPREF0484_3568 [Klebsiella pneumoniae
          subsp. rhinoscleromatis ATCC 13884]
 gi|259039251|gb|EEW40397.1| hypothetical protein HMPREF0484_3568 [Klebsiella pneumoniae
          subsp. rhinoscleromatis ATCC 13884]
          Length = 89

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 38/80 (47%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y+ E  +EK L    K +     K    GRR  PDR+++ P G + ++E K P       
Sbjct: 3  YERESIIEKHLTATVKAVGGIAYKFVSPGRRSVPDRIVLLPGGRIVFVECKTPGKAPRAD 62

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q+ E E LR  G  V VL S
Sbjct: 63 QLREHERLRALGFNVVVLDS 82


>gi|204927408|ref|ZP_03218610.1| VRR-NUC domain protein [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|204324073|gb|EDZ09268.1| VRR-NUC domain protein [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
          Length = 89

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 38/80 (47%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y+ E  +EK LV   KK      K    GRR  PDR+++ P G L ++E K P       
Sbjct: 3  YERESIIEKHLVAEVKKAGGVAFKFVSPGRRSVPDRIVLLPGGRLVFVECKAPGKAPRAD 62

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q  E E LR  G  V VL S
Sbjct: 63 QGREHERLRALGFTVVVLDS 82


>gi|9633591|ref|NP_051005.1| hypothetical protein APSE-1_44 [Acyrthosiphon pisum bacteriophage
          APSE-1]
 gi|9910954|sp|Q9T1Q4|VP44_BPAPS RecName: Full=Putative nuclease p44
 gi|6118039|gb|AAF03987.1|AF157835_44 P44 [Endosymbiont phage APSE-1]
          Length = 93

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 42/83 (50%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
              E  +EK LV+  +K+     K    GRRG PDRL+  PNG + ++E K P  + + 
Sbjct: 2  RLIREDSIEKHLVSEVRKIGGIAYKFVSPGRRGVPDRLVALPNGKIIFVECKAPGEKPTP 61

Query: 67 QQMSEIEELRRRGQRVKVLVSME 89
           Q+ E   L   G +V VL S +
Sbjct: 62 YQLREHARLFALGHQVIVLDSQD 84


>gi|331654017|ref|ZP_08355018.1| putative protein p44 [Escherichia coli M718]
 gi|331048866|gb|EGI20942.1| putative protein p44 [Escherichia coli M718]
          Length = 98

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 39/80 (48%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y+ E  +EK LV   KK      K    G R  PDR+++ P G + ++E K P       
Sbjct: 12 YERESLIEKHLVAEVKKAGGVAFKFVSPGHRSVPDRIVLLPGGRIVFVECKSPGKPPRPD 71

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q+ E E LR+ G  V VL S
Sbjct: 72 QLREHERLRKLGFTVVVLDS 91


>gi|325662085|ref|ZP_08150704.1| hypothetical protein HMPREF0490_01442 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471748|gb|EGC74967.1| hypothetical protein HMPREF0490_01442 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 96

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 1/93 (1%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E++VEK+L+   KK      K    G  G PDR++I P+G + ++EVK+P  +    Q
Sbjct: 5   MREREVEKQLIDEVKKRGGLCEKWIS-GTVGWPDRIVIIPDGKIGFVEVKRPGEKPRPIQ 63

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +    +LR+ G +V VL   +++   L +L  T
Sbjct: 64  VHRHNQLRQIGVKVYVLDHQDKIGGILNDLQST 96


>gi|212712314|ref|ZP_03320442.1| hypothetical protein PROVALCAL_03402 [Providencia alcalifaciens
          DSM 30120]
 gi|212685060|gb|EEB44588.1| hypothetical protein PROVALCAL_03402 [Providencia alcalifaciens
          DSM 30120]
          Length = 89

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  +E+ LV   KK+     K +  GRRG PDR+++ P+G + ++E K P  +    Q
Sbjct: 4  IREDVIERHLVYKVKKVGGIAYKFTSPGRRGVPDRIVLLPHGKIIFVECKAPGEKPRPDQ 63

Query: 69 MSEIEELRRRGQRVKVLVSME 89
          + E   L   G  V VL S +
Sbjct: 64 LREHARLFALGFHVVVLDSKD 84


>gi|327461126|gb|EGF07459.1| VRR-NUC domain protein [Streptococcus sanguinis SK1057]
          Length = 106

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 48/93 (51%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+ +E++L   ++K      K    G  G PDR++  P G + ++E+K P  +    Q
Sbjct: 1   MQERAIEEKLRVESQKRGGLAMKFISPGLVGVPDRIVALPQGKIGFVELKAPGEKPRKIQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +  +E+LR+ G  V VL   E++   L+++  T
Sbjct: 61  VRRMEQLRKLGFLVYVLDDKEKIGEILDDIQGT 93


>gi|211731860|gb|ACJ10158.1| conserved hypothetical protein [Bacteriophage APSE-3]
          Length = 93

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 42/83 (50%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
              E  +EK LV+  +K+     K    GRRG PDRL+  PNG + ++E K P  + + 
Sbjct: 2  RLIREDSIEKHLVSEVQKIGGIAYKFVSPGRRGVPDRLVALPNGKIIFVECKAPGEKPTP 61

Query: 67 QQMSEIEELRRRGQRVKVLVSME 89
           Q+ E   L   G +V VL S +
Sbjct: 62 YQLREHARLFALGHQVIVLDSQD 84


>gi|212499740|ref|YP_002308548.1| hypothetical protein APSE235 [Bacteriophage APSE-2]
 gi|238898731|ref|YP_002924412.1| APSE-2 prophage; hypothetical protein [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
 gi|75906054|gb|ABA29400.1| conserved hypothetical protein [Bacteriophage APSE-2]
 gi|211731709|gb|ACJ10197.1| conserved hypothetical protein [Bacteriophage APSE-2]
 gi|211731854|gb|ACJ10153.1| conserved hypothetical protein [Bacteriophage APSE-4]
 gi|229466490|gb|ACQ68264.1| APSE-2 prophage; conserved hypothetical protein [Candidatus
          Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 94

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 41/83 (49%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
              E  +EK LV   +K+     K    GRRG PDRL+  PNG + ++E K P  + + 
Sbjct: 2  RLIREDSIEKHLVREVQKIGGIAYKFVSPGRRGVPDRLVALPNGKIIFVECKAPGEKPTP 61

Query: 67 QQMSEIEELRRRGQRVKVLVSME 89
           Q+ E   L   G +V VL S +
Sbjct: 62 YQLREHARLFALGHQVIVLDSQD 84


>gi|303239098|ref|ZP_07325628.1| VRR-NUC domain protein [Acetivibrio cellulolyticus CD2]
 gi|302593436|gb|EFL63154.1| VRR-NUC domain protein [Acetivibrio cellulolyticus CD2]
          Length = 138

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 47/90 (52%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EK++EK+L T  K +     K    G  G PDR+++ PNG +++ E+K+   +L   Q
Sbjct: 47  MLEKELEKKLRTAVKAIGGLALKFVSPGMAGVPDRMVLLPNGRIYFSELKRHGEKLRPLQ 106

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
               ++L   G +V  + S   ++ FL E+
Sbjct: 107 QKRKQQLEMLGFKVYCIDSASSLEGFLREV 136


>gi|315121968|ref|YP_004062457.1| VRR-NUC domain-containing protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|315122936|ref|YP_004063425.1| VRR-NUC domain-containing protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495370|gb|ADR51969.1| VRR-NUC domain-containing protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496338|gb|ADR52937.1| VRR-NUC domain-containing protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 101

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 72/96 (75%), Positives = 81/96 (84%)

Query: 6   FHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
            H Q+E ++EKRLV G ++LDCWVRKASFV  RGCPDRLIITP G LWWIEVK+P+GRLS
Sbjct: 5   SHQQSEHEIEKRLVKGVQQLDCWVRKASFVSHRGCPDRLIITPQGRLWWIEVKQPSGRLS 64

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
            QQ  EIEEL RRGQRVKVL S EEVDNFL+ELAC+
Sbjct: 65  PQQKIEIEELLRRGQRVKVLFSAEEVDNFLKELACS 100


>gi|320140664|gb|EFW32518.1| VRR-NUC domain protein [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320142764|gb|EFW34567.1| VRR-NUC domain protein [Staphylococcus aureus subsp. aureus
           MRSA177]
          Length = 116

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 48/94 (51%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
           Y  E  +EK LV    KL+    K    G RG PDR+II P G  +++E+K+  G+L   
Sbjct: 20  YMKESTLEKYLVKEISKLNGLCLKWVAPGTRGVPDRIIIMPEGKTYFVEMKQEKGKLHPL 79

Query: 68  QMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           Q     +   R  +V VL + E+V+ F+  +  T
Sbjct: 80  QKYVHRQFENRDHKVYVLWNKEQVNTFIRMVGGT 113


>gi|211731845|gb|ACJ10148.1| conserved hypothetical protein [Bacteriophage APSE-5]
          Length = 93

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 41/83 (49%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
              E  +EK LV   +K+     K    GRRG PDRL+  PNG + ++E K P  + + 
Sbjct: 2  RLIREDSIEKHLVREVQKIGGIAYKFVSPGRRGVPDRLVALPNGKIIFVECKAPGEKPTP 61

Query: 67 QQMSEIEELRRRGQRVKVLVSME 89
           Q+ E   L   G +V VL S +
Sbjct: 62 YQLREHARLFALGHQVIVLDSQD 84


>gi|237738631|ref|ZP_04569112.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
 gi|229424114|gb|EEO39161.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
          Length = 102

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 51/91 (56%), Gaps = 2/91 (2%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGR--LSHQ 67
          +E+++E  LV   K  +    K +  G  G PDR++I P G ++++E+K    R  LS  
Sbjct: 4  SEREIEAYLVKSIKNKNGLCMKWTSPGNAGVPDRIVIVPGGDVYFVELKAEGKREDLSPL 63

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
          Q + I +L+      +V+ S +EVD F+EE+
Sbjct: 64 QRNFINKLKNLNCDARVIASFKEVDEFIEEV 94


>gi|260845242|ref|YP_003223020.1| hypothetical protein ECO103_3135 [Escherichia coli O103:H2 str.
          12009]
 gi|257760389|dbj|BAI31886.1| hypothetical protein ECO103_3135 [Escherichia coli O103:H2 str.
          12009]
 gi|309702942|emb|CBJ02273.1| putative phage related protein [Escherichia coli ETEC H10407]
          Length = 97

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 38/80 (47%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y+ E  +EK LV   KK      K    GRR  PDR+++ P G + ++E K P       
Sbjct: 3  YERESLIEKHLVAEVKKAGGVAFKFISPGRRSVPDRIVLLPGGRIVFVECKAPGKPPRAG 62

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q+ E   LR  G  V VL S
Sbjct: 63 QLREHGRLRALGFTVVVLDS 82


>gi|284007834|emb|CBA73722.1| conserved hypothetical phage protein [Arsenophonus nasoniae]
          Length = 93

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 42/83 (50%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
              E+ +EK LV   +K+     K    GRRG PDRL+  PNG + ++E K P  + + 
Sbjct: 2  RLIREESIEKHLVREVQKIGGIAYKFVSPGRRGVPDRLVALPNGNIIFVECKAPGEKPTP 61

Query: 67 QQMSEIEELRRRGQRVKVLVSME 89
           Q+ E   L   G +V VL S +
Sbjct: 62 YQLREHARLFALGHQVIVLDSQD 84


>gi|238018845|ref|ZP_04599271.1| hypothetical protein VEIDISOL_00705 [Veillonella dispar ATCC
          17748]
 gi|237864611|gb|EEP65901.1| hypothetical protein VEIDISOL_00705 [Veillonella dispar ATCC
          17748]
          Length = 110

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 50/89 (56%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
          EKD+E+ L    KK+ C   K    G  G PDR+I+ P GG+ ++E+K   G+L   Q  
Sbjct: 2  EKDIERWLGNQLKKMGCIYMKFVSPGNDGVPDRIIVLPGGGVIFVELKDTNGKLMANQRV 61

Query: 71 EIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          +I  LR++G  V V+  M +   F+E++ 
Sbjct: 62 QISRLRKQGALVFVVTGMPDAKLFVEDME 90


>gi|282911094|ref|ZP_06318896.1| gp33 [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282324789|gb|EFB55099.1| gp33 [Staphylococcus aureus subsp. aureus WBG10049]
          Length = 96

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 46/93 (49%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +EK LV    KL+    K    G RG PDR+II P G  +++E+K+  G+L   Q
Sbjct: 1   MKESTLEKYLVKEITKLNGLCLKWVAPGTRGVPDRIIIMPEGKTYFVEMKQEKGKLHPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
                +   R   V VL + E+VD F+  +  T
Sbjct: 61  KYVHRQFENRDHTVYVLWNKEQVDEFIRMVGGT 93


>gi|332160955|ref|YP_004297532.1| VRR-NUC domain protein [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|325665185|gb|ADZ41829.1| VRR-NUC domain protein [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330862110|emb|CBX72274.1| putative protein p44 [Yersinia enterocolitica W22703]
          Length = 90

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 42/80 (52%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y  E  +E  LV   KK+     K    GRR  PDRL++ P G + ++E K P  + +  
Sbjct: 3  YNREDSIEDHLVKEVKKVGGIAYKFISPGRRSVPDRLVLLPGGKVIFVECKAPGEKPTAA 62

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q+ E E+LR  G  V+VL S
Sbjct: 63 QLREHEKLRALGFTVRVLDS 82


>gi|291283831|ref|YP_003500649.1| Phage associated protein [Escherichia coli O55:H7 str. CB9615]
 gi|290763704|gb|ADD57665.1| Phage associated protein [Escherichia coli O55:H7 str. CB9615]
          Length = 89

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 39/80 (48%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          Y+ E  +EK LV   KK      K     RR  PDR+++ P G L ++E K P       
Sbjct: 3  YERENLIEKHLVAEVKKAGGVAFKFISPSRRSVPDRIVLLPGGRLVFVECKSPGKPPRPD 62

Query: 68 QMSEIEELRRRGQRVKVLVS 87
          Q+ E E LR+ G  V VL S
Sbjct: 63 QLREHERLRKLGFTVVVLDS 82


>gi|300856811|ref|YP_003781795.1| phage-like protein [Clostridium ljungdahlii DSM 13528]
 gi|300436926|gb|ADK16693.1| phage related protein [Clostridium ljungdahlii DSM 13528]
          Length = 91

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 46/91 (50%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  +EKRL    +K+     K    G  G PDR+++ P+G + ++E+K P  +    Q
Sbjct: 1  MLESVIEKRLKKEIEKIGGKALKFVSPGMSGVPDRIVLLPHGKIIFVELKAPGKKRRKLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
              +EL   G RV+ + S+  V  F++EL 
Sbjct: 61 EYRAKELNTLGFRVECIDSISGVKQFIKELR 91


>gi|325687763|gb|EGD29784.1| VRR-NUC domain protein [Streptococcus sanguinis SK72]
          Length = 103

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 48/91 (52%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E+++E++L   ++K      K    G  G PDR+++ P G L ++E+K P  +    Q
Sbjct: 1  MREREIEEKLRVESQKRGGLAMKFVSPGLIGVPDRIVVLPQGRLGFVELKAPGEKPRKIQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          +  +E+LR+ G  V VL    ++   L+++ 
Sbjct: 61 VRRMEQLRKLGFLVYVLDDKGKIGEILDDIQ 91


>gi|331085753|ref|ZP_08334836.1| hypothetical protein HMPREF0987_01139 [Lachnospiraceae bacterium
          9_1_43BFAA]
 gi|330406676|gb|EGG86181.1| hypothetical protein HMPREF0987_01139 [Lachnospiraceae bacterium
          9_1_43BFAA]
          Length = 94

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 45/90 (50%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQM 69
          +EK +E++L T  KK+  W  K S  G  G PDRL++ P G L ++E+K P  ++   Q 
Sbjct: 3  SEKSIEQKLRTETKKMGGWAVKFSSPGLDGMPDRLVLFPGGKLGFVELKAPGKKMRPLQE 62

Query: 70 SEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
               L   G  V  + S E +   L E+ 
Sbjct: 63 KRKRTLEELGFLVFCVDSKEMIGGVLHEIR 92


>gi|257428239|ref|ZP_05604637.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257432447|ref|ZP_05608810.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257275080|gb|EEV06567.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257283326|gb|EEV13458.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
          Length = 96

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 46/93 (49%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +EK LV    KL+    K    G RG PDR+II P G  +++E+K+  G+L   Q
Sbjct: 1   MKESTLEKYLVKEITKLNGLCLKWVAPGTRGVPDRIIIMPEGKTFFVEMKQEKGKLHPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
                +   R   V VL + E+V+ F+  +  T
Sbjct: 61  KYVHRQFENRDHTVYVLWNKEQVNTFIRMVGGT 93


>gi|266623805|ref|ZP_06116740.1| putative protein p44 [Clostridium hathewayi DSM 13479]
 gi|288864377|gb|EFC96675.1| putative protein p44 [Clostridium hathewayi DSM 13479]
          Length = 111

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 49/94 (52%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EKD+EK LV   KKL     K    G  G PDR++I P     ++E+K   GRLS  Q
Sbjct: 1   MLEKDIEKILVNEVKKLGGRAYKWVSPGNDGVPDRIVILPGLRPVFVELKTEKGRLSAIQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
             +IE L++  Q V VL    +V +FLEE    L
Sbjct: 61  RVQIERLKKMKQDVSVLYGEPQVRDFLEECKHRL 94


>gi|49483701|ref|YP_040925.1| hypothetical protein SAR1524 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49485833|ref|YP_043054.1| hypothetical protein SAS0927 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|66395630|ref|YP_239996.1| ORF045 [Staphylococcus phage 3A]
 gi|209363582|ref|YP_002268000.1| hypothetical protein phi2958PVL_gp30 [Staphylococcus phage
           phi2958PVL]
 gi|258445561|ref|ZP_05693743.1| gp33 [Staphylococcus aureus A6300]
 gi|258455569|ref|ZP_05703526.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|262052906|ref|ZP_06025089.1| hypothetical protein SA930_0247 [Staphylococcus aureus 930918-3]
 gi|282921766|ref|ZP_06329483.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|295428025|ref|ZP_06820657.1| predicted protein [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297591004|ref|ZP_06949642.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49241830|emb|CAG40522.1| hypothetical phage protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49244276|emb|CAG42703.1| hypothetical phage protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|62635976|gb|AAX91087.1| ORF045 [Staphylococcus phage 3A]
 gi|208973083|dbj|BAG74399.1| hypothetical protein [Staphylococcus phage phi2958PVL]
 gi|257855608|gb|EEV78541.1| gp33 [Staphylococcus aureus A6300]
 gi|257862257|gb|EEV85028.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|259159213|gb|EEW44274.1| hypothetical protein SA930_0247 [Staphylococcus aureus 930918-3]
 gi|282594028|gb|EFB99017.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|295128383|gb|EFG58017.1| predicted protein [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297575890|gb|EFH94606.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MN8]
 gi|315128427|gb|EFT84435.1| hypothetical protein CGSSa03_13292 [Staphylococcus aureus subsp.
           aureus CGS03]
          Length = 96

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 46/93 (49%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +EK LV    KL+    K    G RG PDR+II P G  +++E+K+  G+L   Q
Sbjct: 1   MKESTLEKYLVKEITKLNGLCLKWVAPGTRGVPDRIIIMPEGKTYFVEMKQEKGKLHPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
                +   R   V VL + E+V+ F+  +  T
Sbjct: 61  KYVHRQFENRDHTVYVLWNKEQVNTFIRMVGGT 93


>gi|297242713|ref|ZP_06926651.1| hypothetical protein GVAMD_0725 [Gardnerella vaginalis AMD]
 gi|296888924|gb|EFH27658.1| hypothetical protein GVAMD_0725 [Gardnerella vaginalis AMD]
          Length = 96

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 46/95 (48%)

Query: 7   HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
            +  EK+ E++LV   K       K +     G PDRL++   G + ++E+K P  +   
Sbjct: 2   GFLREKETERKLVRDVKAAGGMAIKLTSPSVDGLPDRLVLLNGGKIGFVELKAPGKKPRV 61

Query: 67  QQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
            Q+  +++L+  G +V V+    ++   ++ +  T
Sbjct: 62  LQVKRMKDLQALGFKVFVVDEKSQIGGVIDAIRAT 96


>gi|87161853|ref|YP_494106.1| hypothetical protein SAUSA300_1409 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|161509686|ref|YP_001575345.1| hypothetical protein USA300HOU_1457 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|294848485|ref|ZP_06789231.1| hypothetical protein SKAG_00548 [Staphylococcus aureus A9754]
 gi|300911908|ref|ZP_07129351.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|87127827|gb|ABD22341.1| conserved hypothetical phage protein [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|160368495|gb|ABX29466.1| hypothetical bacteriophage protein [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|294824511|gb|EFG40934.1| hypothetical protein SKAG_00548 [Staphylococcus aureus A9754]
 gi|300886154|gb|EFK81356.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|315197729|gb|EFU28063.1| hypothetical bacteriophage protein [Staphylococcus aureus subsp.
           aureus CGS01]
          Length = 96

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 47/93 (50%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +EK LV    KL+    K    G RG PDR+II P G  +++E+K+  G+L   Q
Sbjct: 1   MKESTLEKYLVKEISKLNGLCLKWVAPGTRGVPDRIIIMPEGKTYFVEMKQEKGKLHPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
                +   R  +V VL + E+V+ F+  +  T
Sbjct: 61  KYVHRQFENRDHKVYVLWNKEQVNTFIRMVGGT 93


>gi|254975144|ref|ZP_05271616.1| VRR-NUC domain-containing protein [Clostridium difficile
          QCD-66c26]
 gi|255092534|ref|ZP_05322012.1| VRR-NUC domain-containing protein [Clostridium difficile CIP
          107932]
 gi|255306561|ref|ZP_05350732.1| VRR-NUC domain-containing protein [Clostridium difficile ATCC
          43255]
 gi|255314271|ref|ZP_05355854.1| VRR-NUC domain-containing protein [Clostridium difficile
          QCD-76w55]
 gi|255516951|ref|ZP_05384627.1| VRR-NUC domain-containing protein [Clostridium difficile
          QCD-97b34]
 gi|255650053|ref|ZP_05396955.1| VRR-NUC domain-containing protein [Clostridium difficile
          QCD-37x79]
 gi|306519588|ref|ZP_07405935.1| phage-like protein [Clostridium difficile QCD-32g58]
          Length = 108

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 51/91 (56%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  +EKRL    + L     K    G  G PDR+++ P G + ++E+K P  +L   Q
Sbjct: 1  MLESKIEKRLKKEIELLGGKAMKFISPGEAGVPDRIVLLPEGHVIFVELKAPGKKLRKLQ 60

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
            ++ ELR  G +VK + +++E+D+F++E+ 
Sbjct: 61 QYKMRELRELGFKVKCVSTLKEIDDFIKEVK 91


>gi|29028642|ref|NP_803331.1| phi related protein [Staphylococcus phage phi 12]
 gi|66395698|ref|YP_240069.1| ORF044 [Staphylococcus phage 47]
 gi|88195256|ref|YP_500059.1| phi related protein [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|148267488|ref|YP_001246431.1| VRR-NUC [Staphylococcus aureus subsp. aureus JH9]
 gi|150393542|ref|YP_001316217.1| VRR-NUC domain-containing protein [Staphylococcus aureus subsp.
           aureus JH1]
 gi|253315480|ref|ZP_04838693.1| VRR-NUC domain-containing protein [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|258420305|ref|ZP_05683252.1| VRR-NUC domain-containing protein [Staphylococcus aureus A9719]
 gi|258427144|ref|ZP_05688066.1| VRR-NUC domain-containing protein [Staphylococcus aureus A9299]
 gi|258448844|ref|ZP_05696954.1| VRR-NUC domain-containing protein [Staphylococcus aureus A6224]
 gi|282905865|ref|ZP_06313720.1| phi family protein [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282919230|ref|ZP_06326965.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282927342|ref|ZP_06334960.1| phi protein [Staphylococcus aureus A10102]
 gi|284024516|ref|ZP_06378914.1| VRR-NUC domain-containing protein [Staphylococcus aureus subsp.
           aureus 132]
 gi|295407566|ref|ZP_06817359.1| phage protein [Staphylococcus aureus A8819]
 gi|296276323|ref|ZP_06858830.1| VRR-NUC domain-containing protein [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297207822|ref|ZP_06924256.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|297246596|ref|ZP_06930429.1| phi like protein [Staphylococcus aureus A8796]
 gi|18920566|gb|AAL82306.1| phi related protein [Staphylococcus phage phi 12]
 gi|62636122|gb|AAX91233.1| ORF044 [Staphylococcus phage 47]
 gi|87202814|gb|ABD30624.1| phi related protein [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|147740557|gb|ABQ48855.1| VRR-NUC [Staphylococcus aureus subsp. aureus JH9]
 gi|149945994|gb|ABR51930.1| VRR-NUC domain protein [Staphylococcus aureus subsp. aureus JH1]
 gi|257843730|gb|EEV68132.1| VRR-NUC domain-containing protein [Staphylococcus aureus A9719]
 gi|257849922|gb|EEV73881.1| VRR-NUC domain-containing protein [Staphylococcus aureus A9299]
 gi|257857881|gb|EEV80772.1| VRR-NUC domain-containing protein [Staphylococcus aureus A6224]
 gi|282317040|gb|EFB47414.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282331157|gb|EFB60671.1| phi family protein [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282590666|gb|EFB95742.1| phi protein [Staphylococcus aureus A10102]
 gi|283469595|emb|CAQ48806.1| phi related protein [Staphylococcus aureus subsp. aureus ST398]
 gi|283470736|emb|CAQ49947.1| phi related protein [Staphylococcus aureus subsp. aureus ST398]
 gi|294967585|gb|EFG43621.1| phage protein [Staphylococcus aureus A8819]
 gi|296887538|gb|EFH26437.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|297176554|gb|EFH35819.1| phi like protein [Staphylococcus aureus A8796]
 gi|298693628|gb|ADI96850.1| hypothetical phage protein [Staphylococcus aureus subsp. aureus
           ED133]
 gi|302333126|gb|ADL23319.1| VRR-NUC domain [Staphylococcus aureus subsp. aureus JKD6159]
 gi|312438076|gb|ADQ77147.1| phi phage protein [Staphylococcus aureus subsp. aureus TCH60]
 gi|323438428|gb|EGA96183.1| hypothetical protein SAO11_2724 [Staphylococcus aureus O11]
 gi|323441316|gb|EGA98981.1| hypothetical protein SAO46_2726 [Staphylococcus aureus O46]
 gi|329729402|gb|EGG65807.1| VRR-NUC domain protein [Staphylococcus aureus subsp. aureus 21189]
 gi|329730601|gb|EGG66986.1| VRR-NUC domain protein [Staphylococcus aureus subsp. aureus 21193]
          Length = 96

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 47/93 (50%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +EK LV    KL+    K    G RG PDR+II P G  +++E+K+  G+L   Q
Sbjct: 1   MKESTLEKYLVKEITKLNGLCLKWVAPGTRGVPDRIIIMPEGKTYFVEMKQEKGKLHPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
                +   R  +V VL + E+V+ F+  +  T
Sbjct: 61  KYVHRQFENRDHKVYVLWNKEQVNTFIRMVGGT 93


>gi|312897718|ref|ZP_07757134.1| VRR-NUC domain protein [Megasphaera micronuciformis F0359]
 gi|310621102|gb|EFQ04646.1| VRR-NUC domain protein [Megasphaera micronuciformis F0359]
          Length = 111

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 50/88 (56%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+D+EK+LV G KKL     K    G  G PDR++I P+G + +IE+K   G+LS  Q
Sbjct: 16  MLERDIEKKLVAGVKKLGGRAYKFVSPGNIGVPDRIVIWPDGSIEFIELKTAKGQLSKTQ 75

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLE 96
            ++I  L+     V +L  M+ V+ +L 
Sbjct: 76  ATQIARLQAMECNVHILYGMDAVNAYLN 103


>gi|269120030|ref|YP_003308207.1| VRR-NUC domain protein [Sebaldella termitidis ATCC 33386]
 gi|268613908|gb|ACZ08276.1| VRR-NUC domain protein [Sebaldella termitidis ATCC 33386]
          Length = 110

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 47/94 (50%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EKD+EK L    KK+     K    G  G PDRL++ P    +++E+K P  +    Q
Sbjct: 6   LKEKDIEKYLRDEIKKVGGIAYKFVSPGNAGVPDRLVLLPGRWSFFVELKAPGKKTRAVQ 65

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
             +I ++R     V ++ S ++VD+ ++ +   L
Sbjct: 66  DRQIRKIRNLDFSVLIIDSKKQVDDLVKMIKHHL 99


>gi|66395557|ref|YP_239929.1| ORF053 [Staphylococcus phage 42E]
 gi|215401141|ref|YP_002332396.1| hypothetical protein SauSIPLA35_gp33 [Staphylococcus phage
           phiSauS-IPLA35]
 gi|62636050|gb|AAX91161.1| ORF053 [Staphylococcus phage 42E]
 gi|215260492|gb|ACJ64622.1| gp33 [Staphylococcus phage phiSauS-IPLA35]
          Length = 96

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 46/93 (49%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +EK LV    KL+    K    G RG PDR+II P G  +++E+K+  G+L   Q
Sbjct: 1   MKESTLEKYLVKEITKLNGLCLKWVAPGTRGVPDRIIIMPEGKTYFVEMKQEKGKLHPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
                +   R   V VL + E+V+ F+  +  +
Sbjct: 61  KYVHRQFENRDHTVYVLWNKEQVNTFIRMVGGS 93


>gi|156603989|ref|YP_001429935.1| hypothetical protein SPTP3102_gp40 [Staphylococcus phage tp310-2]
 gi|154818075|gb|ABS87502.1| hypothetical protein [Staphylococcus phage tp310-2]
          Length = 96

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 47/93 (50%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E  +EK LV    KL+    K    G RG PDR+II P G  +++E+K+  G+L   Q
Sbjct: 1   MKETTLEKYLVKEITKLNGLCLKWVAPGTRGVPDRIIIMPEGKTYFVEMKQEKGKLHPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
                +   R  RV VL + E+V+ F+  +  T
Sbjct: 61  KYVHRQFENRDHRVYVLWNKEQVNTFIRMVGGT 93


>gi|15837284|ref|NP_297972.1| hypothetical protein XF0682 [Xylella fastidiosa 9a5c]
 gi|15838883|ref|NP_299571.1| hypothetical protein XF2292 [Xylella fastidiosa 9a5c]
 gi|15839116|ref|NP_299804.1| hypothetical protein XF2526 [Xylella fastidiosa 9a5c]
 gi|9105564|gb|AAF83492.1|AE003912_4 phage-related protein [Xylella fastidiosa 9a5c]
 gi|9107456|gb|AAF85091.1|AE004041_3 phage-related protein [Xylella fastidiosa 9a5c]
 gi|9107732|gb|AAF85324.1|AE004059_14 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 92

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 49/90 (54%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
          +   E+ +E+ LV   +     +RK  + GR G PDR+ + PNG   W+E+K P  + + 
Sbjct: 3  NIPRERTIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPNGRTLWVELKAPGKQCTP 62

Query: 67 QQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           Q+ E   +RR GQ V V+ S++ VD  L 
Sbjct: 63 HQVREHARMRRMGQHVVVVDSLKGVDEVLA 92


>gi|71274494|ref|ZP_00650782.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71900323|ref|ZP_00682458.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71164226|gb|EAO13940.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71729898|gb|EAO31994.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 92

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/90 (36%), Positives = 49/90 (54%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
          +   E+ +E+ LV   +     +RK  + GR G PDR+ + P G   W+E+K P  + + 
Sbjct: 3  NIPRERTIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPEGRTLWVELKAPGQQCTP 62

Query: 67 QQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           Q+ E E LRR GQRV V+ S + VD  L 
Sbjct: 63 HQVREHERLRRMGQRVVVVDSFKGVDEVLA 92


>gi|41179403|ref|NP_958712.1| Bbp43 [Bordetella phage BPP-1]
 gi|45569536|ref|NP_996605.1| hypothetical protein BMP-1p42 [Bordetella phage BMP-1]
 gi|45580787|ref|NP_996653.1| hypothetical protein BIP-1p42 [Bordetella phage BIP-1]
 gi|40950142|gb|AAR97708.1| Bbp43 [Bordetella phage BPP-1]
          Length = 87

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E D+EK LV   +KL   VRK  ++GR G PDRL++ P+    W+E+K P  +    Q
Sbjct: 1  MRESDIEKYLVERVRKLGGEVRKVRWIGRNGAPDRLVMLPD-RTVWVELKAPGEKCRPHQ 59

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          + E E +RR GQRV V+ S E VD  L 
Sbjct: 60 IREHERMRRMGQRVAVVDSHEGVDEVLA 87


>gi|71276268|ref|ZP_00652546.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71902065|ref|ZP_00684105.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71162876|gb|EAO12600.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71728176|gb|EAO30367.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 92

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/90 (36%), Positives = 50/90 (55%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
          +   E+ +E+ LV   +     +RK  + GR G PDR+ + P G   W+E+K P  + + 
Sbjct: 3  NIPRERTIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPEGRTLWVELKAPGQQCTP 62

Query: 67 QQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           Q+ E E LRR GQRV V+ S++ VD  L 
Sbjct: 63 HQVREHERLRRMGQRVVVVDSLKGVDEVLA 92


>gi|313896465|ref|ZP_07830016.1| VRR-NUC domain protein [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312974889|gb|EFR40353.1| VRR-NUC domain protein [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 93

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 50/92 (54%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E+ +E++L    K +     K +  G  G PDRL++ P G + ++E+K P  +    Q
Sbjct: 1   MYERTIEQKLAARVKAMGGIAPKFTSPGFDGMPDRLVLLPGGRMGFVELKTPGKKPRALQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
           ++    LRR G +V V+  +E++D+ LEE+  
Sbjct: 61  LARHRLLRRLGFKVYVIDGIEQIDSVLEEIDH 92


>gi|213692068|ref|YP_002322654.1| hypothetical protein Blon_1186 [Bifidobacterium longum subsp.
          infantis ATCC 15697]
 gi|213523529|gb|ACJ52276.1| conserved hypothetical protein [Bifidobacterium longum subsp.
          infantis ATCC 15697]
 gi|320458180|dbj|BAJ68801.1| conserved hypothetical protein [Bifidobacterium longum subsp.
          infantis ATCC 15697]
          Length = 96

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 41/86 (47%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQM 69
           E  VE+R    A++      K    GR G PDRL+  P G L+ +E+K+P G+    Q 
Sbjct: 5  RENTVERRFNMLARRHGGLSLKWVSPGRLGVPDRLLFMPGGRLYLVELKRPGGKPRASQN 64

Query: 70 SEIEELRRRGQRVKVLVSMEEVDNFL 95
          +   +L  RG  V V+   +   + +
Sbjct: 65 AMFAKLETRGFHVWVVDDPDAFFDMI 90


>gi|182682344|ref|YP_001830504.1| VRR-NUC domain-containing protein [Xylella fastidiosa M23]
 gi|273810425|ref|YP_003344896.1| putative nuclease [Xylella phage Xfas53]
 gi|182632454|gb|ACB93230.1| VRR-NUC domain protein [Xylella fastidiosa M23]
 gi|257097800|gb|ACV41106.1| putative nuclease [Xylella phage Xfas53]
          Length = 91

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 49/89 (55%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
             E+ +E+ LV   +     +RK  + GR G PDR+ + PNG   W+E+K P  + +  
Sbjct: 3  IPRERTIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPNGRTLWVELKAPGQQCTPH 62

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          Q+ E E +R  GQRV V+ S++ VD  L 
Sbjct: 63 QVREHERMRGMGQRVVVVDSLKGVDEVLA 91


>gi|28199027|ref|NP_779341.1| hypothetical protein PD1135 [Xylella fastidiosa Temecula1]
 gi|28199080|ref|NP_779394.1| hypothetical protein PD1192 [Xylella fastidiosa Temecula1]
 gi|28199603|ref|NP_779917.1| hypothetical protein PD1728 [Xylella fastidiosa Temecula1]
 gi|182681749|ref|YP_001829909.1| VRR-NUC domain-containing protein [Xylella fastidiosa M23]
 gi|182681806|ref|YP_001829966.1| VRR-NUC domain-containing protein [Xylella fastidiosa M23]
 gi|28057125|gb|AAO28990.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|28057178|gb|AAO29043.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|28057718|gb|AAO29566.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|182631859|gb|ACB92635.1| VRR-NUC domain protein [Xylella fastidiosa M23]
 gi|182631916|gb|ACB92692.1| VRR-NUC domain protein [Xylella fastidiosa M23]
 gi|307578625|gb|ADN62594.1| VRR-NUC domain-containing protein [Xylella fastidiosa subsp.
          fastidiosa GB514]
 gi|307580178|gb|ADN64147.1| VRR-NUC domain-containing protein [Xylella fastidiosa subsp.
          fastidiosa GB514]
 gi|307580242|gb|ADN64211.1| VRR-NUC domain-containing protein [Xylella fastidiosa subsp.
          fastidiosa GB514]
          Length = 92

 Score = 98.6 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 49/89 (55%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
             E+ +E+ LV   +     +RK  + GR G PDR+ + PNG   W+E+K P  + +  
Sbjct: 4  IPRERTIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPNGRTLWVELKAPGQQCTPH 63

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          Q+ E E +R  GQRV V+ S++ VD  L 
Sbjct: 64 QVREHERMRGMGQRVVVVDSLKGVDEVLA 92


>gi|318064434|gb|ADV36448.1| gp36 [Edwardsiella phage eiAU]
 gi|318064542|gb|ADV36500.1| gp36 [Edwardsiella phage eiDWF]
 gi|318064646|gb|ADV36552.1| gp36 [Edwardsiella phage eiMSLS]
          Length = 92

 Score = 98.6 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 48/86 (55%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
          E  V+  L    K +   VRK S+ GRRGCPD  I+ P G +  +EVKKP G     Q+ 
Sbjct: 4  EGKVQAHLQRRFKAIGGLVRKISYEGRRGCPDLFIVLPGGVVVMVEVKKPGGTPEPHQVR 63

Query: 71 EIEELRRRGQRVKVLVSMEEVDNFLE 96
          EIE LR+RG  V V+ S+E  D  + 
Sbjct: 64 EIERLRQRGVPVYVIDSIEGADKLVA 89


>gi|258646423|ref|ZP_05733892.1| putative protein p44 [Dialister invisus DSM 15470]
 gi|260403826|gb|EEW97373.1| putative protein p44 [Dialister invisus DSM 15470]
          Length = 105

 Score = 98.6 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/90 (38%), Positives = 50/90 (55%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQM 69
          +E+D EK LV+  KKL     K +  G  G PDR+II P G + ++E+K  TG LS  Q 
Sbjct: 7  SERDAEKLLVSKIKKLGGRAYKFTSPGSAGVPDRIIILPGGYVEFVEMKSETGMLSVLQK 66

Query: 70 SEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
            I  LR  G  V+VL   ++VD ++  + 
Sbjct: 67 ICISHLRSLGCHVEVLYGAKDVDTYVTRVK 96


>gi|160935261|ref|ZP_02082644.1| hypothetical protein CLOBOL_00157 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441992|gb|EDP19689.1| hypothetical protein CLOBOL_00157 [Clostridium bolteae ATCC
           BAA-613]
          Length = 97

 Score = 98.6 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 49/94 (52%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EKD+E  L    +K+     K    G  G PDR+ I P+G +W++E+K+  G+++  Q
Sbjct: 1   MLEKDIEDWLNKQIEKMGGLAFKFVSPGNPGVPDRIYILPDGRVWFVELKQQLGKVARIQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
             + E L R G   +++  M++   ++ E+   L
Sbjct: 61  KWQRERLIRLGCNYRLVKGMDDARAYVGEMRDAL 94


>gi|304436364|ref|ZP_07396340.1| VRR-NUC domain protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304370633|gb|EFM24282.1| VRR-NUC domain protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 93

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 49/92 (53%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             EKD+EK L    K +     K +  G  G PDRL++ P G + ++E+K P  +    Q
Sbjct: 1   MREKDIEKELTARTKAMGGIAPKFTSPGFDGMPDRLVLLPRGRMEFVELKAPGRKPRPLQ 60

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
           ++    LRR G +V V+  + ++D  LE+++ 
Sbjct: 61  LARHRLLRRLGFKVYVIDEINQIDGVLEDISH 92


>gi|281416461|ref|YP_003347381.1| hypothetical protein [Enterococcus phage phiFL4A]
 gi|270209637|gb|ACZ64176.1| conserved hypothetical protein [Enterococcus phage phiFL4A]
          Length = 106

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
           E D+EK L+   K+      K +  G RG PDR+I+   G ++++E+K+P G+    Q+ 
Sbjct: 4   ENDIEKYLIRQIKRTGALCYKFTSPGTRGVPDRIILY-QGNVFFVELKRPGGKPRKDQLK 62

Query: 71  EIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
            IE+ + +   V V+ S + VD  +  +  
Sbjct: 63  IIEKFKEQLIPVFVIDSKQGVDTLIYAMQS 92


>gi|227520160|ref|ZP_03950209.1| VRR-NUC domain protein [Enterococcus faecalis TX0104]
 gi|227072405|gb|EEI10368.1| VRR-NUC domain protein [Enterococcus faecalis TX0104]
 gi|315160594|gb|EFU04611.1| VRR-NUC domain protein [Enterococcus faecalis TX0645]
 gi|315574063|gb|EFU86254.1| VRR-NUC domain protein [Enterococcus faecalis TX0309B]
 gi|315579440|gb|EFU91631.1| VRR-NUC domain protein [Enterococcus faecalis TX0630]
 gi|315582008|gb|EFU94199.1| VRR-NUC domain protein [Enterococcus faecalis TX0309A]
          Length = 127

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
           E D+EK L+   K+      K +  G RG PDR+I+   G ++++E+K+P G+    Q+ 
Sbjct: 25  ENDIEKYLIRQIKRTGALCYKFTSPGTRGVPDRIILY-QGNVFFVELKRPGGKPRKDQLK 83

Query: 71  EIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
            IE+ + +   V V+ S + VD  +  +  
Sbjct: 84  IIEKFKEQLIPVFVIDSKQGVDTLIYAMQS 113


>gi|71901492|ref|ZP_00683579.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71728748|gb|EAO30892.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 92

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 48/89 (53%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
             E+ +E+ LV   K     +RK  + GR G PDR+ + P G   W+E+K P  + +  
Sbjct: 4  IPRERTIERYLVAQVKAKGGEIRKVKWGGRHGAPDRIAMLPEGRTLWVELKAPGQQCTPH 63

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          Q+ E E +R  GQRV V+ S++ VD  L 
Sbjct: 64 QVREHERMRGMGQRVVVVDSLKGVDEVLA 92


>gi|257088836|ref|ZP_05583197.1| predicted protein [Enterococcus faecalis CH188]
 gi|256997648|gb|EEU84168.1| predicted protein [Enterococcus faecalis CH188]
          Length = 132

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
           E D+EK L+   K+      K +  G RG PDR+I+   G ++++E+K+P G+    Q+ 
Sbjct: 30  ENDIEKYLIRQIKRTGALCYKFTSPGTRGVPDRIILY-QGNVFFVELKRPGGKPRKDQLK 88

Query: 71  EIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
            IE+ + +   V V+ S + VD  +  +  
Sbjct: 89  IIEKFKEQLIPVFVIDSKQGVDTLIYAMQS 118


>gi|71275470|ref|ZP_00651756.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71276172|ref|ZP_00652452.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71898327|ref|ZP_00680500.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71900966|ref|ZP_00683079.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71163090|gb|EAO12812.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71163770|gb|EAO13486.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71729271|gb|EAO31389.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71731850|gb|EAO33908.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 92

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 48/89 (53%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
             E+ +E+ LV   +     +RK  + GR G PDR+ + P G   W+E+K P  + +  
Sbjct: 4  IPRERTIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPEGRTLWVELKAPGQQCTPH 63

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          Q+ E E +RR GQRV V+ S + VD  L 
Sbjct: 64 QVREHERMRRMGQRVVVVDSFKGVDEVLA 92


>gi|71899885|ref|ZP_00682033.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71730325|gb|EAO32408.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 92

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 49/89 (55%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
             E+ +E+ LV   +     +RK  + GR G PDR+ + P G   W+E+K P  + +  
Sbjct: 4  IPRERTIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPEGRTLWVELKAPGQQCTPH 63

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          Q+ E E +RR GQRV V+ S++ VD  L 
Sbjct: 64 QVREHERMRRMGQRVVVVDSLKGVDEVLA 92


>gi|29374968|ref|NP_814121.1| hypothetical protein EF0329 [Enterococcus faecalis V583]
 gi|29342426|gb|AAO80192.1| conserved hypothetical protein [Enterococcus faecalis V583]
          Length = 106

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
           E D+EK LV   K++     K +  G RG PDR+I+   G ++++E+K+P G+    Q+ 
Sbjct: 4   ENDIEKYLVRQIKRIGALCYKFTSPGTRGVPDRIILY-QGNVFFVELKRPGGKPRKDQLK 62

Query: 71  EIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
            IE+ + +   V V+ S + VD  +  +  
Sbjct: 63  IIEKFKEQLIPVFVIDSKQGVDMLIYAMQS 92


>gi|225220077|ref|YP_002720044.1| hypothetical protein EpSSL_gp05 [Enterobacteria phage SSL-2009a]
 gi|224986018|gb|ACN74582.1| hypothetical protein [Enterobacteria phage SSL-2009a]
          Length = 92

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 52/90 (57%), Gaps = 1/90 (1%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
           E  ++  L+   K +  + RK ++ GR G PD +II  NG + ++EVK+P G+    Q+ 
Sbjct: 4   EGRIQIYLMKQVKAVGGFCRKVAWEGRAGAPDLIIII-NGKIVFVEVKRPGGKPKPHQIR 62

Query: 71  EIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
           E E + RRG  V+V+ ++++ D  + EL  
Sbjct: 63  EHERMARRGADVRVIDNIDDCDLLVAELVA 92


>gi|71911261|ref|YP_282811.1| hypothetical protein M5005_Spy_1448 [Streptococcus pyogenes
          MGAS5005]
 gi|157311153|ref|YP_001469198.1| hypothetical protein P9_gp18 [Streptococcus phage P9]
 gi|71854043|gb|AAZ52066.1| phage-related protein [Streptococcus pyogenes MGAS5005]
 gi|119104302|gb|ABL61047.1| hypothetical protein [Streptococcus phage P9]
          Length = 91

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
          +TEKD+E  L    K       K +  G  G PDR+++   G   ++EVK P  +    Q
Sbjct: 2  RTEKDIENYLKKKTK---GLCLKFTSPGTIGVPDRIVVMNTGTF-FVEVKAPGKKPRPSQ 57

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          ++  ++++  GQ V V+ S E VD  L+E+ 
Sbjct: 58 VAMHKKIKEAGQHVWVVDSYESVDMALKEME 88


>gi|71897668|ref|ZP_00679913.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71898926|ref|ZP_00681093.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71731338|gb|EAO33402.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71732571|gb|EAO34624.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 92

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 48/89 (53%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
             E+ +E+ LV   +     +RK  + GR G PDR+ + P G   W+E+K P  + +  
Sbjct: 4  IPRERTIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPEGRTLWVELKAPGQQCTPH 63

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          Q+ E E +R  GQRV V+ S++ VD  L 
Sbjct: 64 QVREHERMRGMGQRVVVVDSLKGVDEVLA 92


>gi|28198297|ref|NP_778611.1| hypothetical protein PD0380 [Xylella fastidiosa Temecula1]
 gi|182680934|ref|YP_001829094.1| VRR-NUC domain-containing protein [Xylella fastidiosa M23]
 gi|28056367|gb|AAO28260.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|182631044|gb|ACB91820.1| VRR-NUC domain protein [Xylella fastidiosa M23]
 gi|307579402|gb|ADN63371.1| VRR-NUC domain-containing protein [Xylella fastidiosa subsp.
          fastidiosa GB514]
          Length = 92

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 49/89 (55%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
             E+ +E+ LV   +     +RK  + GR G PDR+ + PNG   W+E+K P  + +  
Sbjct: 4  IPRERTIERYLVAQVRAKGGEIRKVKWEGRHGAPDRIAMLPNGRTLWVELKAPGQQCTPH 63

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          Q+ E E +R  GQRV V+ S++ VD  L 
Sbjct: 64 QVREHERMRGMGQRVVVVDSLKGVDEVLA 92


>gi|94992971|ref|YP_601070.1| hypothetical protein MGAS2096_Spy1474 [Streptococcus pyogenes
          MGAS2096]
 gi|94546479|gb|ABF36526.1| phage-related protein [Streptococcus pyogenes MGAS2096]
          Length = 97

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
          +TEKD+E  L    K       K +  G  G PDR+++   G   ++EVK P  +    Q
Sbjct: 8  RTEKDIENYLKKKTK---GLCLKFTSPGTIGVPDRIVVMNTGTF-FVEVKAPGKKPRPSQ 63

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          ++  ++++  GQ V V+ S E VD  L+E+ 
Sbjct: 64 VAMHKKIKEAGQHVWVVDSYESVDMALKEME 94


>gi|153814244|ref|ZP_01966912.1| hypothetical protein RUMTOR_00453 [Ruminococcus torques ATCC 27756]
 gi|145848640|gb|EDK25558.1| hypothetical protein RUMTOR_00453 [Ruminococcus torques ATCC 27756]
          Length = 74

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 37/74 (50%)

Query: 28  WVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVS 87
              K       G PDR+++ P+G + ++E+K P  +    Q+     L R G  V V+ +
Sbjct: 1   MALKFVSHSMNGVPDRIVLMPDGKMAFVELKAPGKKPRPLQLKRKRMLERLGFPVYVVDN 60

Query: 88  MEEVDNFLEELACT 101
           +E++   L+E+  T
Sbjct: 61  IEQIGGILDEIQST 74


>gi|320530607|ref|ZP_08031659.1| VRR-NUC domain protein [Selenomonas artemidis F0399]
 gi|320137134|gb|EFW29064.1| VRR-NUC domain protein [Selenomonas artemidis F0399]
          Length = 123

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 42/94 (44%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRL 64
             H   E  +E+  V   KK      K    GR G PDR+++ P G   + E+K P  +L
Sbjct: 15  RLHIDHESWIEQAFVREVKKRGGLALKFVSPGRVGVPDRIVLIPGGRCVFAEIKAPGKKL 74

Query: 65  SHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
              Q++    +   G  V V+ S+EEV  F E  
Sbjct: 75  RKLQIAAHRVIHGFGLEVSVVSSLEEVKTFCERY 108


>gi|94989080|ref|YP_597181.1| hypothetical protein MGAS9429_Spy1450 [Streptococcus pyogenes
          MGAS9429]
 gi|94542588|gb|ABF32637.1| phage-related protein [Streptococcus pyogenes MGAS9429]
          Length = 97

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 4/90 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
          +TEKD+E  L    K       K +  G  G PDR+++   G   ++EVK P  +    Q
Sbjct: 8  RTEKDIENYLKKKTK---GLCLKFTSPGTIGVPDRIVVMNTGTF-FVEVKAPGKKPRPSQ 63

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
          ++  ++++  GQ V V+ S E VD  L+E+
Sbjct: 64 VAMHKKIKEAGQHVWVVDSYESVDMALKEM 93


>gi|71898990|ref|ZP_00681156.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71901325|ref|ZP_00683421.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71728909|gb|EAO31044.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71731236|gb|EAO33301.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 92

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 48/89 (53%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
             E+ +E+ LV   +     +RK  + GR G PDR+ + P G   W+E+K P  + +  
Sbjct: 4  IPRERIIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPEGRTLWVELKAPGQQCTPH 63

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          Q+ E E +R  GQRV V+ S++ VD  L 
Sbjct: 64 QVREHERMRGMGQRVVVVDSLKGVDEVLA 92


>gi|273810590|ref|YP_003344971.1| gp36 [Sodalis phage SO-1]
 gi|258619875|gb|ACV84128.1| gp36 [Sodalis phage SO-1]
          Length = 92

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 52/90 (57%), Gaps = 1/90 (1%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
           E  ++  L+   K++  + RK ++ GR G PD +II  NG + ++EVK+P G+    Q+ 
Sbjct: 4   EGKIQSHLMRRVKEVGGFCRKLAWEGRAGAPDLIIII-NGKIVFVEVKRPGGKPKPHQVR 62

Query: 71  EIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
           E E + RRG  V+V+ ++ + D  + EL  
Sbjct: 63  EHERMARRGADVRVIDNISDCDLLVAELVA 92


>gi|225871339|ref|YP_002747286.1| phage protein [Streptococcus equi subsp. equi 4047]
 gi|225700743|emb|CAW95384.1| hypothetical phage protein [Streptococcus equi subsp. equi 4047]
          Length = 91

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
          +TEKD+E  L    K       K +  G  G PDR+++   G   ++EVK P  +    Q
Sbjct: 2  RTEKDIENYLKKKTK---GLCLKFASPGTIGVPDRIVVMNTGTF-FVEVKAPGKKPRPSQ 57

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          ++  ++++  GQ V V+ S E VD  L+E+ 
Sbjct: 58 VAMHKKIKEAGQHVWVVDSYESVDIALKEME 88


>gi|209559300|ref|YP_002285772.1| hypothetical protein Spy49_0764 [Streptococcus phage NZ131.2]
 gi|209540501|gb|ACI61077.1| hypothetical protein Spy49_0764 [Streptococcus phage NZ131.2]
          Length = 97

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
          +TEKD+E  L    K       K +  G  G PDR+++   G   ++EVK P  +    Q
Sbjct: 8  RTEKDIENYLKKKTK---GLCLKFASPGTIGVPDRIVVMNTGTF-FVEVKAPGKKPRPSQ 63

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          ++  +++++ GQ V V+ S E VD  L+E+ 
Sbjct: 64 VAMHKKIKKAGQHVWVVDSYESVDIALKEME 94


>gi|21910977|ref|NP_665245.1| hypothetical protein SpyM3_1441 [Streptococcus pyogenes MGAS315]
 gi|28876471|ref|NP_795677.1| hypothetical protein SpyM3_1441 [Streptococcus pyogenes phage
          315.6]
 gi|28895336|ref|NP_801686.1| hypothetical protein SPs0424 [Streptococcus pyogenes SSI-1]
 gi|139473886|ref|YP_001128602.1| hypothetical protein SpyM51053 [Streptococcus pyogenes str.
          Manfredo]
 gi|21905185|gb|AAM80048.1| conserved hypothetical protein - phage-associated [Streptococcus
          pyogenes MGAS315]
 gi|28810582|dbj|BAC63519.1| hypothetical protein [Streptococcus pyogenes SSI-1]
 gi|134272133|emb|CAM30378.1| hypothetical phage protein [Streptococcus pyogenes str. Manfredo]
          Length = 91

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
          +TEKD+E  L    K       K +  G  G PDR+++   G   ++EVK P  +    Q
Sbjct: 2  RTEKDIENYLKKKTK---GLCLKFASPGTIGVPDRIVVMNTGTF-FVEVKAPGKKPRPSQ 57

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          ++  +++++ GQ V V+ S E VD  L+E+ 
Sbjct: 58 VAMHKKIKKAGQHVWVVDSYESVDIALKEME 88


>gi|50913382|ref|YP_059354.1| hypothetical protein M6_Spy0036 [Streptococcus pyogenes
          MGAS10394]
 gi|50902456|gb|AAT86171.1| Phage-related protein [Streptococcus pyogenes MGAS10394]
          Length = 97

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
          +TEKD+E  L    K       K +  G  G PDR+++   G   ++EVK P  +    Q
Sbjct: 8  RTEKDIENYLKKKTK---GLCLKFASPGTIGVPDRIVVMNTGTF-FVEVKAPGKKPRPSQ 63

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          ++  +++++ GQ V V+ S E VD  L+E+ 
Sbjct: 64 VAMHKKIKKAGQHVWVVDSYESVDIALKEME 94


>gi|170729636|ref|YP_001775069.1| hypothetical protein Xfasm12_0425 [Xylella fastidiosa M12]
 gi|170730323|ref|YP_001775756.1| hypothetical protein Xfasm12_1175 [Xylella fastidiosa M12]
 gi|170730596|ref|YP_001776029.1| hypothetical protein Xfasm12_1483 [Xylella fastidiosa M12]
 gi|167964429|gb|ACA11439.1| conserved hypothetical protein [Xylella fastidiosa M12]
 gi|167965116|gb|ACA12126.1| conserved hypothetical protein [Xylella fastidiosa M12]
 gi|167965389|gb|ACA12399.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 92

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/90 (35%), Positives = 50/90 (55%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
          +   E+ +E+ LV   +     +RK  + GR G PDR+ + P G   W+E+K P  + + 
Sbjct: 3  NIPRERTIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPEGRTLWVELKAPGQQCTL 62

Query: 67 QQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           Q+ E E +RR GQRV V+ S++ VD  L 
Sbjct: 63 HQVREHERMRRMGQRVVVVDSLKGVDEVLA 92


>gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040871|gb|ACT57667.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120756|gb|ADV02577.1| endonuclease [Candidatus Liberibacter asiaticus]
          Length = 98

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 63/94 (67%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
           Y +E  +EKRLV G+KKLDC V K  F+ +RGCPDRLIITPNG  +W+E+K   GRLS+ 
Sbjct: 5   YLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNA 64

Query: 68  QMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           Q   I  L    Q+V+VL S EEVD FL  L C 
Sbjct: 65  QKRVIATLLLYHQKVQVLSSTEEVDGFLRMLECY 98


>gi|306826831|ref|ZP_07460131.1| VRR-NUC domain protein [Streptococcus pyogenes ATCC 10782]
 gi|304430849|gb|EFM33858.1| VRR-NUC domain protein [Streptococcus pyogenes ATCC 10782]
          Length = 91

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 49/91 (53%), Gaps = 4/91 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
          +TEKD+E  L    K       K +  G  G PDR+++   G ++++EVK P  +    Q
Sbjct: 2  RTEKDIENYLKKKTK---GLCLKFTSPGTIGVPDRIVVMNTG-IFFVEVKAPDKKPRPSQ 57

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          ++  ++++  GQ V V+ S E VD  L+E+ 
Sbjct: 58 VAMHKKIKEAGQHVWVVDSYESVDIALKEME 88


>gi|227872573|ref|ZP_03990909.1| VRR-NUC domain protein [Oribacterium sinus F0268]
 gi|227841574|gb|EEJ51868.1| VRR-NUC domain protein [Oribacterium sinus F0268]
          Length = 103

 Score = 93.2 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 48/89 (53%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
          EK VEK +V     L C   K      RG PDRL IT  G +++ E+K   GRLS  Q +
Sbjct: 5  EKKVEKAMVRMLWNLGCESYKFVSPNCRGVPDRLFITEEGKVFFAELKTIKGRLSSLQEN 64

Query: 71 EIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          +I++L+   Q V V+  ME V  F+E+  
Sbjct: 65 QIKKLKALKQEVYVIYGMEGVRKFVEDFQ 93


>gi|293400002|ref|ZP_06644148.1| hypothetical protein HMPREF0863_00285 [Erysipelotrichaceae
          bacterium 5_2_54FAA]
 gi|291306402|gb|EFE47645.1| hypothetical protein HMPREF0863_00285 [Erysipelotrichaceae
          bacterium 5_2_54FAA]
          Length = 106

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 2/89 (2%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP-TGRLSHQQM 69
          E+ VEK L      L     K +  G  G PDR+II  NG + ++E+K+P  GR+S  Q 
Sbjct: 12 ERQVEKYLTDKISNLGGLPWKFTSPGTAGVPDRIIIM-NGLICFVELKRPRGGRISDMQQ 70

Query: 70 SEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
            IE+LR++G +  V+ + EEVD  +E +
Sbjct: 71 WRIEQLRKQGMKAYVIKNKEEVDYLVEHM 99


>gi|262200538|ref|YP_003271746.1| VRR-NUC domain-containing protein [Gordonia bronchialis DSM 43247]
 gi|262083885|gb|ACY19853.1| VRR-NUC domain protein [Gordonia bronchialis DSM 43247]
          Length = 131

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGG----LWWIE 56
           MS  S     E  +E+ LV    ++     K +  G  G PDR+++  +        ++E
Sbjct: 1   MSTRSSA-PRESAIERHLVQRCAEIGVLCLKFTSPGHVGVPDRVLMGHDANDDSVTLFVE 59

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
           VK+P       Q++ I  +R  GQ   V  S   VD  + + 
Sbjct: 60  VKRPDEAPRPSQVAMIRRMRDHGQHAVVADSKASVDALISDY 101


>gi|288799808|ref|ZP_06405267.1| putative protein p44 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288333056|gb|EFC71535.1| putative protein p44 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 100

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQM 69
          +EK +E+ L    K++     K       G PDRLII  NG   + E+K   GRL+ +Q 
Sbjct: 8  SEKVLERNLQKRVKEIGGKAYKFISSNCTGVPDRLIIF-NGRFCFAEIKSYNGRLAPRQE 66

Query: 70 SEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
           EI +L+  G +V ++ + E++++ ++ +
Sbjct: 67 IEIRKLKNLGAKVFIVYTPEDIESIIKYI 95


>gi|217965846|ref|YP_002351524.1| VRR_NUC domain protein [Listeria monocytogenes HCC23]
 gi|217335116|gb|ACK40910.1| VRR_NUC domain protein [Listeria monocytogenes HCC23]
 gi|307569606|emb|CAR82785.1| phage protein, putative [Listeria monocytogenes L99]
          Length = 92

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 1/87 (1%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  VEK L     K      K +  G RG PDR+++  +  + ++E K P   L   Q
Sbjct: 1  MLESKVEKYLREQVNKRGGLCWKFTSPGTRGVPDRIVML-DRRIVFVETKAPKKELRKLQ 59

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFL 95
               ++  +G     + + E+VDN +
Sbjct: 60 EKRKAQIEAQGLLHYAVDTKEQVDNLM 86


>gi|322691246|ref|YP_004220816.1| hypothetical protein BLLJ_1057 [Bifidobacterium longum subsp.
          longum JCM 1217]
 gi|320456102|dbj|BAJ66724.1| conserved hypothetical protein [Bifidobacterium longum subsp.
          longum JCM 1217]
          Length = 88

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 40/82 (48%)

Query: 14 VEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIE 73
          +E+R    A++      K    GR G PDRL+  P G L+ +E+K+P G+    Q +   
Sbjct: 1  MERRFNMLARRHGGLSLKWVSPGRLGVPDRLLFMPGGRLYLVELKRPGGKPRASQSAMFA 60

Query: 74 ELRRRGQRVKVLVSMEEVDNFL 95
          +L  RG  V V+   +   + +
Sbjct: 61 KLETRGFHVWVVDDPDAFFDMI 82


>gi|331007740|ref|ZP_08330866.1| hypothetical protein IMCC1989_1941 [gamma proteobacterium
          IMCC1989]
 gi|330418448|gb|EGG92988.1| hypothetical protein IMCC1989_1941 [gamma proteobacterium
          IMCC1989]
          Length = 88

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 1/81 (1%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  +EK++   AK+      K S    RG PDRL       +  +E K    + S  Q
Sbjct: 1  MRESVIEKKVTEYAKEQGWLSYKWSSPNSRGVPDRLYF-KRCLVVVVEFKATNKKPSKLQ 59

Query: 69 MSEIEELRRRGQRVKVLVSME 89
              ++L  +G  V V+ S+E
Sbjct: 60 KEIHKKLNEQGFLVHVIDSIE 80


>gi|290466809|gb|ADD25739.1| hypothetical protein [Lactococcus phage 1358]
          Length = 113

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 3/93 (3%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
             E +VEK L      +     K +     G PDR++I  +  + ++E+K+P       Q
Sbjct: 18  IRESEVEKYLKDRCVAVGGRAMKWTGGN--GVPDRIVIVNDC-VVFVELKRPYATPRADQ 74

Query: 69  MSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +++  ++RR G  V V+   E+VD  L++L   
Sbjct: 75  LAQHAKIRRAGGTVYVVDRFEQVDELLDKLTAK 107


>gi|152990201|ref|YP_001355923.1| hypothetical protein NIS_0452 [Nitratiruptor sp. SB155-2]
 gi|151422062|dbj|BAF69566.1| phage-related protein [Nitratiruptor sp. SB155-2]
          Length = 91

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            E  ++K+++   KK  C+  K       G PD L    NG    IEVK    + +  Q
Sbjct: 1  MKESLIQKKILDFLKKRGCYAVKVIAANESGTPDILACC-NGKFVGIEVKAGRNKPTKLQ 59

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
          M ++E+++       V  S+E+V+  LE+
Sbjct: 60 MHKLEKIKEAAGISMVAYSVEDVEKMLED 88


>gi|125974242|ref|YP_001038152.1| hypothetical protein Cthe_1738 [Clostridium thermocellum ATCC
           27405]
 gi|125714467|gb|ABN52959.1| conserved hypothetical protein [Clostridium thermocellum ATCC
           27405]
          Length = 121

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 40/100 (40%), Gaps = 6/100 (6%)

Query: 9   QTEKDVEKRLVTGAKKL-DCWVRKASFVG--RRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
            TEK  + +++   K L   W  K    G  R G PD +    NG    IE+K   G+ +
Sbjct: 1   MTEKQFQTKVIKYLKTLSKTWYFKVFGGGFQRSGIPDLICCI-NGVFVAIELKAEKGKPT 59

Query: 66  HQQMSEIEELRRRGQRVKVLV--SMEEVDNFLEELACTLY 103
             Q   I+ +   G    +L     EE    +EE+    +
Sbjct: 60  ELQKMNIKNINEAGGIGIILYPSGFEEFKKLIEEVLACNF 99


>gi|212638493|ref|YP_002315013.1| RecB family endonuclease [Anoxybacillus flavithermus WK1]
 gi|212559973|gb|ACJ33028.1| RecB family endonuclease [Anoxybacillus flavithermus WK1]
          Length = 105

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASF--VGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
            TEK +E ++     +L  W  K       + G PD +    +     IE+K+P G++S 
Sbjct: 1   MTEKTIENQIKRYLDRLGVWYMKVHGSMYQKAGVPDIIACI-DSVFVGIEIKRPGGKVSV 59

Query: 67  QQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
            Q   I+E+ + G    V  S+E+V   + EL   L
Sbjct: 60  LQQLNIDEINKNGGCAFVAYSVEDVQRKIAELRHAL 95


>gi|282533170|gb|ADA82279.1| hypothetical protein [Escherichia phage K1G]
 gi|282534221|gb|ADA82329.1| hypothetical protein [Escherichia phage K1H]
          Length = 99

 Score = 89.4 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTG-RLSHQQ 68
           E  V+K      + L   VRK S+ GR G PD L+I P G +W++EVKK    +    Q
Sbjct: 8  KEGRVQKYAKDRFEALGGLVRKLSYEGRSGAPDLLVILPGGIVWFVEVKKDENTKPDPHQ 67

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          + E E +R+RG  V V+ S ++VD+ + 
Sbjct: 68 LREHERMRKRGANVFVVGSFKQVDDLIA 95


>gi|328913306|gb|AEB64902.1| hypothetical protein LL3_03372 [Bacillus amyloliquefaciens LL3]
          Length = 83

 Score = 87.5 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 30  RKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSME 89
            K    G  G PDR+++ P G L ++E+K P  +    Q+   ++L   G  V+VL S++
Sbjct: 1   MKFISPGLSGVPDRIVLLPGGKLVFVEMKAPGEKPRPLQLKRKKDLETMGFEVRVLDSID 60

Query: 90  EVDNFL----EELACT 101
            +  F+     E+  T
Sbjct: 61  SITAFVRGAFREIQTT 76


>gi|21910874|ref|NP_665142.1| hypothetical protein SpyM3_1338 [Streptococcus pyogenes MGAS315]
 gi|28876420|ref|NP_795621.1| hypothetical protein SpyM3_1338 [Streptococcus pyogenes phage
           315.5]
 gi|28895436|ref|NP_801786.1| hypothetical protein SPs0524 [Streptococcus pyogenes SSI-1]
 gi|21905080|gb|AAM79945.1| conserved hypothetical protein - phage-associated [Streptococcus
           pyogenes MGAS315]
 gi|28810682|dbj|BAC63619.1| hypothetical protein [Streptococcus pyogenes SSI-1]
          Length = 106

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 42/101 (41%), Gaps = 13/101 (12%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
           TE  ++ ++     K    V +                   +G  D     P+G +++IE
Sbjct: 3   TESLIQNQIRVALSKAGHMVFRANVGKVKTVDGRLFDTGLPKGFCDLFGFKPDGQIFFIE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK  TGR+  +Q + +E +  RG  V V  S+E+    + +
Sbjct: 63  VKNETGRVRPEQKNFMEVMASRGALVGVARSVEDALKIVND 103


>gi|306827204|ref|ZP_07460494.1| phage protein [Streptococcus pyogenes ATCC 10782]
 gi|304430660|gb|EFM33679.1| phage protein [Streptococcus pyogenes ATCC 10782]
          Length = 116

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 41/102 (40%), Gaps = 13/102 (12%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWI 55
            +E D++  +     +    V +                   +G  D     PNG +++I
Sbjct: 12  LSEHDIQNLIRMELSQAGHMVFRANVGKVKTADGRFFDTGLPKGFCDLFGFKPNGQIFFI 71

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           EVK  TGR+  +Q   +E +  RG  V V  S+E+    + +
Sbjct: 72  EVKNETGRIRPEQKKFMEVMASRGALVGVARSVEDALKIVND 113


>gi|319955978|ref|YP_004167241.1| vrr-nuc domain-containing protein [Nitratifractor salsuginis DSM
          16511]
 gi|319418382|gb|ADV45492.1| VRR-NUC domain-containing protein [Nitratifractor salsuginis DSM
          16511]
          Length = 92

 Score = 85.9 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 1/89 (1%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
           TE+ ++KR++   K +  +  K     R G PD L    NG    IEVK P    +  Q
Sbjct: 1  MTEQKIQKRILRFLKDIGAYPAKIVTGNRAGIPDILACV-NGRFVAIEVKVPGKEATKLQ 59

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
             ++ ++  G    V    +EV   L +
Sbjct: 60 DLHLQRIKEAGGVAFVAHGADEVREALMK 88


>gi|94990321|ref|YP_598421.1| phage protein [Streptococcus phage 10270.2]
 gi|94994244|ref|YP_602342.1| phage protein [Streptococcus phage 10750.2]
 gi|94543829|gb|ABF33877.1| phage protein [Streptococcus phage 10270.2]
 gi|94547752|gb|ABF37798.1| phage protein [Streptococcus phage 10750.2]
          Length = 106

 Score = 85.9 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 41/101 (40%), Gaps = 13/101 (12%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
           TE  ++ ++     K    V +                   +G  D     P+G +++IE
Sbjct: 3   TESLIQNQIRVALSKAGHMVFRANVGKVKTVDGRLFDTGLPKGFCDLFGFKPDGQIFFIE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK  TGR+  +Q   +E +  RG  V V  S+E+    + +
Sbjct: 63  VKNETGRVRPEQKKFMEVMASRGALVGVARSVEDALKIVND 103


>gi|134288569|ref|YP_001110808.1| hypothetical protein SPSV3_gp08 [Salmonella phage SETP3]
 gi|125631934|gb|ABN47337.1| hypothetical protein [Salmonella phage SETP3]
          Length = 95

 Score = 85.9 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/88 (38%), Positives = 48/88 (54%), Gaps = 1/88 (1%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTG-RLSHQQ 68
           E  V+K      + L   VRK S+ GR G PD L+I P G +W++EVKK    +    Q
Sbjct: 4  KEGRVQKYAKERFEALGGLVRKLSYEGRSGAPDLLVILPRGVIWFVEVKKDENTKPDPHQ 63

Query: 69 MSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          + E E  R+RG  V V+ S ++VD  +E
Sbjct: 64 LREHERFRKRGANVFVVGSFKQVDKLIE 91


>gi|291336802|gb|ADD96337.1| hypothetical protein BACINT_02220 [uncultured organism
          MedDCM-OCT-S08-C700]
          Length = 79

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
           TE   +K+L+   +K    V K     + G PD + + P+  + +IEVK P GRLS  Q
Sbjct: 1  MTEAQYQKKLIDRHEKEGWTVIKLIMCNKAGLPDLICMKPD-EVKFIEVKGPKGRLSEVQ 59

Query: 69 MSEIEELRRRGQRVKVLV 86
             IEEL+  G  V+V+ 
Sbjct: 60 KYRIEELKEAGFDVEVMR 77


>gi|220922591|ref|YP_002497893.1| VRR-NUC domain-containing protein [Methylobacterium nodulans ORS
           2060]
 gi|219947198|gb|ACL57590.1| VRR-NUC domain protein [Methylobacterium nodulans ORS 2060]
          Length = 129

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 16/99 (16%)

Query: 11  EKDVEKRLVTGA-KKLDCWVRKASFVGRRG---------------CPDRLIITPNGGLWW 54
           E+ ++ ++V    ++ DC        GRRG                PD ++    G  + 
Sbjct: 7   EQVIQTKIVVAMHRRFDCLCVHVPNGGRRGKREGVAFKEMGVEAGHPDLIVYGRGGRCFL 66

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN 93
           IEVK P G LS  Q + +  LR RG  V V+ S++E   
Sbjct: 67  IEVKAPGGSLSASQRAFLPGLRERGFPVHVVDSVDEALA 105


>gi|313895715|ref|ZP_07829271.1| VRR-NUC domain protein [Selenomonas sp. oral taxon 137 str.
          F0430]
 gi|312975841|gb|EFR41300.1| VRR-NUC domain protein [Selenomonas sp. oral taxon 137 str.
          F0430]
          Length = 93

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 4/92 (4%)

Query: 9  QTEKDVEKRLVTGAKKL-DCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
            E  + K ++T  K   DC+  KA     G  G PD +     G  +  EVK   G+ +
Sbjct: 1  MKESSIVKSILTYLKSRPDCFCWKAHGGLYGTAGIPDIIACI-GGKFYGFEVKTERGKPT 59

Query: 66 HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
            Q + I ++   G    V+ S+ +V   LEE
Sbjct: 60 ALQEATIRKINAVGGIAAVVRSVADVKAVLEE 91


>gi|9632454|ref|NP_049426.1| hypothetical protein DT1p37 [Streptococcus phage DT1]
 gi|4530174|gb|AAD21914.1| unknown [Streptococcus phage DT1]
          Length = 107

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 41/100 (41%), Gaps = 13/100 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
           TE  ++ ++     K    V +                   +G  D     P+G +++IE
Sbjct: 3   TESLIQNQIRVELSKAGYTVFRINVGKVRMADGRWFDTGAPKGFCDLFGFRPDGQIFFIE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           VK   GRL   Q   +E +++RG  V V  S+E+    ++
Sbjct: 63  VKNEKGRLRDDQKKFMEAMKKRGALVGVARSVEDAMRIVD 102


>gi|189465858|ref|ZP_03014643.1| hypothetical protein BACINT_02220 [Bacteroides intestinalis DSM
          17393]
 gi|189434122|gb|EDV03107.1| hypothetical protein BACINT_02220 [Bacteroides intestinalis DSM
          17393]
          Length = 80

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
          E  ++ R++   +    +V K     + G PD L++  +G  +++EVK+P  +    Q  
Sbjct: 5  ESKIQARIIKRLEAQGYYVVKLILTNKNGIPDLLVL-KDGKAFFVEVKRPGEKPRPLQEY 63

Query: 71 EIEELRRRGQRVKV 84
           + EL+  G   +V
Sbjct: 64 RMNELKELGFICEV 77


>gi|256003542|ref|ZP_05428532.1| VRR-NUC domain protein [Clostridium thermocellum DSM 2360]
 gi|255992566|gb|EEU02658.1| VRR-NUC domain protein [Clostridium thermocellum DSM 2360]
 gi|316941394|gb|ADU75428.1| VRR-NUC domain-containing protein [Clostridium thermocellum DSM
          1313]
          Length = 95

 Score = 84.8 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 4/92 (4%)

Query: 9  QTEKDVEKRLVTGAKKL-DCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
           +E+ +  +++   K +  C+  K      G  G PD +    NG     E+K P+G+ +
Sbjct: 1  MSERSIVTKVLRYLKTVPGCFCWKEHGGMYGTAGIPDIIACV-NGRFIAFEIKTPSGKTT 59

Query: 66 HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
            Q + I ++   G    V+ S++EV   LE+
Sbjct: 60 KLQEATIRKILNAGGVAAVVHSVDEVKVILEK 91


>gi|62327353|ref|YP_224066.1| hypothetical protein BPKS7gp44 [Salmonella phage SS3e]
 gi|57472387|gb|AAW51249.1| hypothetical protein [Salmonella phage SS3e]
          Length = 95

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTG-RLSHQQM 69
          E  V+K      + L   VRK S+  R G PD L+I P G +W++EVKK    +    Q+
Sbjct: 5  EGRVQKYAKERFEALGGLVRKLSYENRVGAPDLLVILPGGIIWFVEVKKDENTKPDPHQL 64

Query: 70 SEIEELRRRGQRVKVLVSMEEVDNFLE 96
           E E +R+RG  V V+ S ++VD  +E
Sbjct: 65 REHERMRKRGANVFVVGSKKQVDKLIE 91


>gi|94988184|ref|YP_596285.1| phage protein [Streptococcus phage 9429.1]
 gi|94990064|ref|YP_598164.1| phage protein [Streptococcus phage 10270.1]
 gi|94993976|ref|YP_602074.1| phage protein [Streptococcus phage 10750.1]
 gi|94541692|gb|ABF31741.1| phage protein [Streptococcus phage 9429.1]
 gi|94543572|gb|ABF33620.1| phage protein [Streptococcus phage 10270.1]
 gi|94547484|gb|ABF37530.1| phage protein [Streptococcus phage 10750.1]
          Length = 106

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 42/101 (41%), Gaps = 13/101 (12%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
           TE  ++ ++  G  +    V +                   +G  D     P+G +++IE
Sbjct: 3   TESLIQNQIRVGLSQAGHMVFRANVGKVKTADGRFFDTGLPKGFCDLFGFKPDGQVFFIE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK  TGR+  +Q   +E +  RG  V V  S+E+    + +
Sbjct: 63  VKNETGRVRPEQKKFMEVMASRGALVGVARSVEDALKIVND 103


>gi|160898848|ref|YP_001564430.1| VRR-NUC domain-containing protein [Delftia acidovorans SPH-1]
 gi|160364432|gb|ABX36045.1| VRR-NUC domain protein [Delftia acidovorans SPH-1]
          Length = 94

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 33/90 (36%), Gaps = 9/90 (10%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITP---------NGGLWWIEV 57
          +   E  +E+      K     + K    GR G PD +++ P              ++E 
Sbjct: 2  NMPRESAIERADRKNHKAAGRLLLKFVSPGRNGMPDDILLNPIPPEHQELVARYFRFVEY 61

Query: 58 KKPTGRLSHQQMSEIEELRRRGQRVKVLVS 87
          KKP       Q+    ELR  G  V V+ S
Sbjct: 62 KKPKATPRADQLRRHAELRALGFTVDVIDS 91


>gi|125974152|ref|YP_001038062.1| hypothetical protein Cthe_1646 [Clostridium thermocellum ATCC
          27405]
 gi|125714377|gb|ABN52869.1| hypothetical protein Cthe_1646 [Clostridium thermocellum ATCC
          27405]
          Length = 100

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 9  QTEKDVEKRLVTGAKKL-DCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
           +EK +  +++   K +  C+  K      G  G PD +    NG     EVK P+G+ +
Sbjct: 1  MSEKSIVTKILRYLKTVPGCFCWKEHGGMYGTAGLPDIIACV-NGRFIAFEVKTPSGKTT 59

Query: 66 HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
            Q + I+++   G    V+ S++EV   LE+
Sbjct: 60 KLQEATIKKILNAGGVAAVVHSVDEVKVILEK 91


>gi|241894875|ref|ZP_04782171.1| phage protein [Weissella paramesenteroides ATCC 33313]
 gi|241871883|gb|EER75634.1| phage protein [Weissella paramesenteroides ATCC 33313]
          Length = 112

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 35/103 (33%), Gaps = 14/103 (13%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWW 54
             E+D++  +    +     V +                    G PD       +  +++
Sbjct: 1   MREQDIQNAIRAAVEHDGHVVFRINTGKVLTKDDRWFMTGVPNGHPDLYGFRKTDNQVFY 60

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           IEVK  TGR    Q+   + L  RG    +  S E+    + E
Sbjct: 61  IEVKTATGRPRKDQIFFHQALSNRGVIHGIARSSEDALKIINE 103


>gi|168229314|ref|YP_001686835.1| orf41 [Streptococcus phage 858]
 gi|155241709|gb|ABT18029.1| orf41 [Streptococcus phage 858]
          Length = 106

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 41/101 (40%), Gaps = 13/101 (12%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
           +E  ++ ++     K    V +                   +G  D     P+G +++IE
Sbjct: 3   SEHSIQNQIRVELSKAGYMVFRINVGKVRMADGRWFDTGAPKGFCDLFGFRPDGQIFFIE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK   GRL   Q   +  +++RG  V V  S++E  + + E
Sbjct: 63  VKNEKGRLREDQKKFMNAMKKRGALVGVARSVKEAMDIVNE 103


>gi|9632928|ref|NP_049957.1| hypothetical protein Sfi19p37 [Streptococcus phage Sfi19]
 gi|9634998|ref|NP_056714.1| gp106 [Streptococcus phage Sfi11]
 gi|5524023|gb|AAD44076.1|AF115102_35 orf106 gp [Streptococcus phage Sfi19]
 gi|7523558|gb|AAF63061.1|AF158600_15 gp106 [Streptococcus phage Sfi11]
 gi|7523588|gb|AAF63090.1|AF158601_18 gp106 [Streptococcus phage SFi18]
          Length = 106

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 42/104 (40%), Gaps = 13/104 (12%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
           TE  ++ ++  G  K    V +                   +G  D     P+G +++IE
Sbjct: 3   TESLIQNQIRVGLSKAGYMVFRINVGKVRMADGRWFDTGAPKGFCDLFGFRPDGQIFFIE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
           VK   GRL   Q   +  +++RG  V V  S++E  + + E   
Sbjct: 63  VKNEKGRLREDQKKFMNAMKKRGALVGVARSVKEAMDIVNEKQS 106


>gi|66391798|ref|YP_238522.1| hypothetical protein SPV2972_gp39 [Streptococcus phage 2972]
 gi|56718455|gb|AAW27961.1| hypothetical protein [Streptococcus phage 2972]
          Length = 106

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 41/101 (40%), Gaps = 13/101 (12%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
           TE  ++ ++     K    V +                   +G  D     P+G +++IE
Sbjct: 3   TESLIQNQIRVELSKAGYMVFRINVGKVRMADGRWFDTGAPKGFCDLFGFRPDGQIFFIE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK   GRL   Q   +  +++RG  V V  S++E  + + E
Sbjct: 63  VKNEKGRLREDQKKFMNAMKKRGALVGVARSVKEAMDIVNE 103


>gi|21910491|ref|NP_664759.1| hypothetical protein SpyM3_0955 [Streptococcus pyogenes MGAS315]
 gi|28876239|ref|NP_795452.1| hypothetical protein SpyM3_0955 [Streptococcus pyogenes phage
           315.2]
 gi|28895812|ref|NP_802162.1| hypothetical protein SPs0900 [Streptococcus pyogenes SSI-1]
 gi|21904690|gb|AAM79562.1| conserved hypothetical protein - phage-associated [Streptococcus
           pyogenes MGAS315]
 gi|28811061|dbj|BAC63995.1| hypothetical protein [Streptococcus pyogenes SSI-1]
          Length = 106

 Score = 84.0 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 41/101 (40%), Gaps = 13/101 (12%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
           TE  ++ ++     +    V +                   +G  D     PNG +++IE
Sbjct: 3   TESLIQNQIRVVLSRAGHMVFRANVGKVKTADGRFFDTGLPKGFCDLFGFKPNGQIFFIE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK  TGR+  +Q   +E +  RG  V V  S+E+    + +
Sbjct: 63  VKNETGRIRPEQKKFMEVMASRGALVGVARSVEDALKIVND 103


>gi|9885253|emb|CAC04165.1| hypothetical protein [Lactococcus phage phi31]
          Length = 103

 Score = 83.6 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 41/101 (40%), Gaps = 13/101 (12%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWI 55
           ++E D++  +     K  C   +                   +G  D     P+G +++I
Sbjct: 2   RSEHDIQNEIRLALTKAGCVAFRCNVGCVQTIDGRWFDTGLPKGHADLYGFRPDGQVFYI 61

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           EVK   GR+   Q++ +E +R+ G    +  S+E+    + 
Sbjct: 62  EVKSEIGRVRPDQINFLETMRKNGALAGIARSVEDAMKIIN 102


>gi|223933201|ref|ZP_03625192.1| VRR-NUC domain protein [Streptococcus suis 89/1591]
 gi|223898131|gb|EEF64501.1| VRR-NUC domain protein [Streptococcus suis 89/1591]
          Length = 106

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 40/100 (40%), Gaps = 13/100 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
            E  ++  +  G  +  C V +                   +G  D      +G +++IE
Sbjct: 3   KEHKIQNDIRVGLTEAGCLVFRANVGKVRTADGRYFDTGLPKGFSDLFGFRSDGQIFFIE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           VK   GR+  +Q   IE +R+ G    V  S+E+  N +E
Sbjct: 63  VKNEKGRVRPEQEKFIERMRKFGALAGVARSVEDALNIVE 102


>gi|329767791|ref|ZP_08259307.1| hypothetical protein HMPREF0428_01004 [Gemella haemolysans M341]
 gi|328838892|gb|EGF88486.1| hypothetical protein HMPREF0428_01004 [Gemella haemolysans M341]
          Length = 97

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 5/94 (5%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKA--SFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
           +EK  E ++    K+  C+  K    + G +G PD LI   NG    IEVK+ TG+ S 
Sbjct: 2  MSEKAFENKIKKFLKEKGCYFLKYNPEYFGIKGTPDLLICC-NGYFLGIEVKRETGKPSK 60

Query: 67 QQMSEIEELRRRGQRVKVLV--SMEEVDNFLEEL 98
           Q+ +IEE++  G    VL     E+    +EEL
Sbjct: 61 LQLKKIEEIKNAGGIAMVLYPSGFEKFKKLIEEL 94


>gi|312984190|ref|ZP_07791536.1| phage protein [Lactobacillus crispatus CTV-05]
 gi|310894409|gb|EFQ43485.1| phage protein [Lactobacillus crispatus CTV-05]
          Length = 122

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 38/101 (37%), Gaps = 14/101 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWI 55
           +E  ++  +     K  C V +              S     G PD       +G +++I
Sbjct: 14  SEHAIQNEIQVALSKHKCSVFRANVGKIRLPDGRFFSTGLPSGFPDLFGFRWTDGKIFFI 73

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           EVK   GRL   Q+   + L+R G    V  S+ +    ++
Sbjct: 74  EVKNVKGRLRPDQIVFHKMLQRHGIIHGVARSVHDALMIVD 114


>gi|220924928|ref|YP_002500230.1| VRR-NUC domain-containing protein [Methylobacterium nodulans ORS
           2060]
 gi|219949535|gb|ACL59927.1| VRR-NUC domain protein [Methylobacterium nodulans ORS 2060]
          Length = 129

 Score = 82.1 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 16/96 (16%)

Query: 11  EKDVEKRLVTGA-KKLDCWVRKASFVGRRG---------------CPDRLIITPNGGLWW 54
           E+ ++ ++V    ++ DC        GRRG                PD ++    G  + 
Sbjct: 7   EQVIQTKIVVAMHRRFDCRCVHVPNGGRRGKLEGVAFKEMGVEAGHPDLIVYGRGGRCFL 66

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEE 90
           IEVK P G LS  Q + +  LR RG  V V+ S+E+
Sbjct: 67  IEVKAPGGSLSASQRAFLPGLRERGFPVHVVDSVED 102


>gi|220923738|ref|YP_002499040.1| VRR-NUC domain-containing protein [Methylobacterium nodulans ORS
           2060]
 gi|219948345|gb|ACL58737.1| VRR-NUC domain protein [Methylobacterium nodulans ORS 2060]
          Length = 129

 Score = 82.1 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 16/96 (16%)

Query: 11  EKDVEKRLVTGA-KKLDCWVRKASFVGRRG---------------CPDRLIITPNGGLWW 54
           E+ ++ ++V    ++ DC        GRRG                PD ++    G  + 
Sbjct: 7   EQVIQTKIVVAMHRRFDCLCVHVPNGGRRGKLEGVAFKEMGVEAGHPDLIVYGRGGRCFL 66

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEE 90
           IEVK P G LS  Q + +  LR RG  V V+  +E+
Sbjct: 67  IEVKAPGGSLSASQRAFLPVLRERGFPVHVVDCVED 102


>gi|91214214|ref|NP_919001.2| conserved phage protein [Burkholderia phage BcepNazgul]
 gi|88604907|gb|AAQ63368.2| conserved phage protein [Burkholderia phage BcepNazgul]
          Length = 108

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQM 69
            E  +E +    AK    +V K    G+RG PDR+ I  +G + +IE K+        Q 
Sbjct: 19  RETRIEDQTNDWAKANGWFVAKFVSPGQRGVPDRMYIR-SGIVVFIEFKRKDAEPKRHQY 77

Query: 70  SEIEELRRRGQRVKVLVSMEEVDNFLE 96
           ++ +E+RR G  V    + E+    L 
Sbjct: 78  NKHDEMRRHGAYVHWADNHEDAIRILA 104


>gi|223044312|ref|ZP_03614347.1| phage protein [Staphylococcus capitis SK14]
 gi|222442280|gb|EEE48390.1| phage protein [Staphylococcus capitis SK14]
          Length = 102

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 16/102 (15%)

Query: 9   QTEKDVEKRL--------------VTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWW 54
            TE+D++  +              V   +  D           +G  D     P+G +++
Sbjct: 1   MTEQDIQNLIRIAASKENIIFRANVGKVRTADGRFFDTGLP--QGFCDLFGFRPDGQIFF 58

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           IEVKKP G++  +Q+  IE ++++G    V  S+E+    +E
Sbjct: 59  IEVKKPGGKIRDKQIKFIETVKKKGALAGVAYSVEDAIEIIE 100


>gi|281418296|ref|ZP_06249316.1| VRR-NUC domain protein [Clostridium thermocellum JW20]
 gi|281409698|gb|EFB39956.1| VRR-NUC domain protein [Clostridium thermocellum JW20]
          Length = 100

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query: 9  QTEKDVEKRLVTGAKKL-DCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
           +EK +  +++   + +  C+  K      G  G PD +    NG     EVK  +G+ +
Sbjct: 1  MSEKGIVTKVLRYLRTVPGCFCWKEHGGMYGTAGIPDIIACV-NGRFVAFEVKTASGKAT 59

Query: 66 HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
            Q + I+++   G    V+ S++EV   LE+ 
Sbjct: 60 KLQEATIKKILNVGGVAAVVRSVDEVKVILEKY 92


>gi|297565626|ref|YP_003684598.1| VRR-NUC domain-containing protein [Meiothermus silvanus DSM 9946]
 gi|296850075|gb|ADH63090.1| VRR-NUC domain protein [Meiothermus silvanus DSM 9946]
          Length = 111

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 43/104 (41%), Gaps = 11/104 (10%)

Query: 2   SFYSF--HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRG--------CPDRLIITPNGG 51
           SF        +E ++++ +V   +     V +     +RG         PD       G 
Sbjct: 9   SFRRRLAEAMSEAEIQQGIVRYLRATGWVVLEIKGNAKRGGTVFQTKGIPDLYAARK-GR 67

Query: 52  LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
             W+EVK+P  R   +Q +  E LR+ G  V V+  +E ++  L
Sbjct: 68  SLWLEVKRPGQRPRPEQEALHERLRQEGCEVHVIDGIEALEKLL 111


>gi|291336952|gb|ADD96479.1| VRR NUC domain containing protein [uncultured organism
           MedDCM-OCT-S09-C94]
          Length = 120

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 39/99 (39%), Gaps = 14/99 (14%)

Query: 3   FYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTG 62
           F  FH   E      L    KK+           + GCPD ++  P G + +IE+K   G
Sbjct: 24  FRHFHVPNEGKRSIYLHAQMKKMGL---------KSGCPDIIVEYPMGKILYIELKNEKG 74

Query: 63  RLSHQQMSEIEELRRRGQRVKVLVS-----MEEVDNFLE 96
           RLS  Q     + +  G    V+       +++V   +E
Sbjct: 75  RLSDNQKLWAVQSKGLGTPHFVVKGGLTECLDQVKQIIE 113


>gi|294783587|ref|ZP_06748911.1| holliday junction resolvase Hjc [Fusobacterium sp. 1_1_41FAA]
 gi|294480465|gb|EFG28242.1| holliday junction resolvase Hjc [Fusobacterium sp. 1_1_41FAA]
          Length = 108

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 38/92 (41%), Gaps = 4/92 (4%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVK-KPTGRLS 65
             EK VE ++    K    W  K         G PD L    +G    IEVK    G +S
Sbjct: 14  LKEKAVENKIKKWLKDKGYWFFKVHGSIFQPSGIPDILACI-DGKFVAIEVKRTKGGVVS 72

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
             Q ++I +++  G    V  SMEE    L+E
Sbjct: 73  PLQKAQIAKIKENGGIAGVASSMEEFLEILKE 104


>gi|290891512|ref|ZP_06554570.1| hypothetical protein AWRIB429_1960 [Oenococcus oeni AWRIB429]
 gi|290478861|gb|EFD87527.1| hypothetical protein AWRIB429_1960 [Oenococcus oeni AWRIB429]
          Length = 118

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 38/101 (37%), Gaps = 14/101 (13%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASF------------VGR-RGCPDRLIITP-NGGLWW 54
            +E  ++  +     K    V + +              G   G PD     P +  +++
Sbjct: 1   MSEHSIQDDVRVALSKYGYKVFRTAAGKIKMLAGGYFDPGMPNGWPDLTGFNPVDHTIFF 60

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           IE+K P G+    Q++  + L++ G    +  S E+    +
Sbjct: 61  IEMKSPIGKPRDDQITFHKFLKKYGVCHGIARSPEDAIKIV 101


>gi|254555659|ref|YP_003062076.1| phage protein [Lactobacillus plantarum JDM1]
 gi|254044586|gb|ACT61379.1| phage protein [Lactobacillus plantarum JDM1]
          Length = 110

 Score = 80.5 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 38/103 (36%), Gaps = 14/103 (13%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWW 54
             E++++ ++     K  C + +                   +G PD       +G +++
Sbjct: 1   MREQEIQNQIRVAVSKNKCTIFRANVGKVEMKNGRWFDTGLPQGFPDLFGFRHSDGSIFF 60

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           IE K  TGR    Q+   + L ++     +  S E+    + E
Sbjct: 61  IECKNETGRPRADQIKFHKFLMKQHTIHGIARSPEDALKIINE 103


>gi|329117681|ref|ZP_08246398.1| VRR-NUC domain protein [Streptococcus parauberis NCFD 2020]
 gi|326908086|gb|EGE55000.1| VRR-NUC domain protein [Streptococcus parauberis NCFD 2020]
          Length = 115

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 42/101 (41%), Gaps = 13/101 (12%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
           +E D++  +     KL     +              S    +G PD      +G +++IE
Sbjct: 8   SEHDIQSLIRLELTKLGIPCFRINVGKVKMKDGRWFSTGAPKGFPDLFGYRQDGQIFFIE 67

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK   GR+  +Q + ++  + +G    V  S+E+    +E+
Sbjct: 68  VKDNKGRVRPEQENFMKVAKSKGALAGVARSVEDALEIIED 108


>gi|191637877|ref|YP_001987043.1| Orf106 gp [Lactobacillus casei BL23]
 gi|190712179|emb|CAQ66185.1| Orf106 gp [Lactobacillus casei BL23]
 gi|327381946|gb|AEA53422.1| hypothetical protein LC2W_1088 [Lactobacillus casei LC2W]
 gi|327385106|gb|AEA56580.1| hypothetical protein LCBD_1082 [Lactobacillus casei BD-II]
          Length = 104

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 34/101 (33%), Gaps = 14/101 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E  ++  +        C + +                   +G PD       +G L  +E
Sbjct: 4   EAKIQNDIRVALSAHGCTIIRTNSGSVKTVDGRMFIAGPPKGWPDLTGFRHSDGRLILVE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK  TGRL   Q    E ++R      V  S EE    +EE
Sbjct: 64  VKNETGRLRPDQKRFAEFIQRFPVIYGVCRSAEEAIKLIEE 104


>gi|311110110|ref|ZP_07711507.1| phage protein [Lactobacillus gasseri MV-22]
 gi|311065264|gb|EFQ45604.1| phage protein [Lactobacillus gasseri MV-22]
          Length = 114

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 36/101 (35%), Gaps = 14/101 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWI 55
           +E  ++ ++     K  C V +              S     G PD       +G  ++I
Sbjct: 4   SEHSIQSKIQVELSKHHCTVFRANVGKMRTPDGRFFSTGLPSGYPDLSGFRWIDGKAFFI 63

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           EVK  TG+    Q+     L   G    +  S+++    +E
Sbjct: 64  EVKNATGKPREDQIRFHHMLMSHGIIHGIARSVDDARMIVE 104


>gi|226949729|ref|YP_002804820.1| VRR-NUC domain protein [Clostridium botulinum A2 str. Kyoto]
 gi|226843509|gb|ACO86175.1| VRR-NUC domain protein [Clostridium botulinum A2 str. Kyoto]
          Length = 62

 Score = 79.4 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/60 (36%), Positives = 40/60 (66%)

Query: 40 CPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           PDR+++ P G + ++E+K P  +    Q   I+ELR  G RV+++ S+E+++NF+EE+ 
Sbjct: 1  MPDRIVLLPQGRIVFVELKAPDKKPRPIQKYRIKELRALGFRVEIIDSIEDINNFVEEIK 60


>gi|256826726|ref|YP_003150685.1| VRR-NUC domain-containing protein [Cryptobacterium curtum DSM
           15641]
 gi|256582869|gb|ACU94003.1| VRR-NUC domain-containing protein [Cryptobacterium curtum DSM
           15641]
          Length = 112

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 31/98 (31%), Gaps = 11/98 (11%)

Query: 6   FHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLW--WIEVKKPTGR 63
           +H   E     +  +  K L             G PD  I    G     +IE+K    +
Sbjct: 22  YHIPNEAKRNPKTASHLKALGMVA---------GVPDLCIPVARGVYHGLYIEMKAGRNK 72

Query: 64  LSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
            +  QM  +  L+ +G    V    +E    + E    
Sbjct: 73  PTESQMRWLSLLQEQGYAATVCWGADEAIATIGEYMHA 110


>gi|220922463|ref|YP_002497765.1| VRR-NUC domain-containing protein [Methylobacterium nodulans ORS
           2060]
 gi|219947070|gb|ACL57462.1| VRR-NUC domain protein [Methylobacterium nodulans ORS 2060]
          Length = 129

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 16/96 (16%)

Query: 11  EKDVEKRLVTGA-KKLDCWVRKASFVGRRG---------------CPDRLIITPNGGLWW 54
           E+ ++ ++V    ++ DC        GRRG                PD ++    G  + 
Sbjct: 7   EQVIQTKIVVAMHRRFDCRCVHVPNGGRRGKLEGVAFKEMGVEAGHPDLIVYGRGGRCFL 66

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEE 90
           IEVK P G LS  Q + +  LR RG  V V+  +E+
Sbjct: 67  IEVKAPGGSLSASQRAFLPGLRERGFPVHVVDCVED 102


>gi|158320330|ref|YP_001512837.1| VRR-NUC domain-containing protein [Alkaliphilus oremlandii
          OhILAs]
 gi|158140529|gb|ABW18841.1| VRR-NUC domain protein [Alkaliphilus oremlandii OhILAs]
          Length = 96

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query: 9  QTEKDVEKRLVTGAKKL-DCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
            EK ++ ++V   K+  + W  K         G PD ++    G    +E+K+P  + +
Sbjct: 1  MKEKAIQNKIVQYLKQQPNTWFFKTHGGMYQVAGIPDLILCY-MGHFVALEIKRPGEKPT 59

Query: 66 HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
            Q   +++++  G    V+ S+ +V + L+ L
Sbjct: 60 KLQEKVLKDIQEAGGISVVVHSLLDVKSVLDTL 92


>gi|257485315|ref|ZP_05639356.1| hypothetical protein PsyrptA_18773 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 440

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 4/73 (5%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV---SM 88
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V     + 
Sbjct: 361 VKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCYVQWAT 420

Query: 89  EEVDNFLEELACT 101
           E   + +EELAC 
Sbjct: 421 EHAADVIEELACH 433


>gi|71903675|ref|YP_280478.1| phage protein [Streptococcus pyogenes MGAS6180]
 gi|71802770|gb|AAX72123.1| phage protein [Streptococcus pyogenes MGAS6180]
          Length = 94

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 2/84 (2%)

Query: 14 VEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIE 73
          V +  V   K  D           +G  D     PNG +++IEVK  TGR+  +Q   +E
Sbjct: 10 VFRANVGKVKTADGRFFDTGLP--KGFCDLFGFKPNGQIFFIEVKNETGRIRPEQKKFME 67

Query: 74 ELRRRGQRVKVLVSMEEVDNFLEE 97
           +  RG  V V  S+E+  N + +
Sbjct: 68 VMASRGALVGVARSVEDALNIVND 91


>gi|254304001|ref|ZP_04971359.1| hypothetical protein FNP_1670 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148324193|gb|EDK89443.1| hypothetical protein FNP_1670 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 107

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 4/92 (4%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVK-KPTGRLS 65
             EK VE ++    K    W  K         G PD L    NG    IEVK    G +S
Sbjct: 13  LKEKAVENKIKKWLKDKGYWFFKVHGSIFQPAGIPDILACV-NGKFVAIEVKRTKGGVVS 71

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
             Q ++I++++  G    V  +M+E    L+E
Sbjct: 72  PLQKAQIQKIKENGGIAGVASTMDEFLEILKE 103


>gi|262047922|ref|ZP_06020867.1| VRR-NUC domain-containing protein [Lactobacillus crispatus
           MV-3A-US]
 gi|260571775|gb|EEX28351.1| VRR-NUC domain-containing protein [Lactobacillus crispatus
           MV-3A-US]
          Length = 112

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 39/101 (38%), Gaps = 14/101 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWI 55
           +E  ++K++     +  C V +              +     G PD       +G +++I
Sbjct: 3   SEHSIQKKIELALSQHQCHVFRANVGKIRTPDGRFFTTGLPSGYPDLHGFRNVDGKMFYI 62

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           EVK  TG+L   Q++    L        V  S+++    ++
Sbjct: 63  EVKTKTGKLRDDQIAFHNMLMSYNIIHGVARSVKDALMIVD 103


>gi|330988154|gb|EGH86257.1| hypothetical protein PLA107_24225 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331010816|gb|EGH90872.1| hypothetical protein PSYTB_14223 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 567

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 4/73 (5%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV---SM 88
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V     + 
Sbjct: 488 VKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCYVQWAT 547

Query: 89  EEVDNFLEELACT 101
           E   + +EELAC 
Sbjct: 548 EHAADVIEELACH 560


>gi|307317156|ref|ZP_07596597.1| VRR-NUC domain protein [Sinorhizobium meliloti AK83]
 gi|306897244|gb|EFN27989.1| VRR-NUC domain protein [Sinorhizobium meliloti AK83]
          Length = 95

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 40/89 (44%), Gaps = 2/89 (2%)

Query: 9  QTE-KDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
            E  DV++ LV   K     VRK  + GRRG PD       G    IE KK       Q
Sbjct: 1  MAEFSDVQRPLVEYGKSEGWLVRKVVYQGRRGSPDLW-FLKGGTWVLIEAKKFGDEARIQ 59

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          Q  E E LRR+G  V V+ ++ E    L+
Sbjct: 60 QKREHERLRRKGANVYVVDTLAEGKRILD 88


>gi|268319307|ref|YP_003292963.1| hypothetical protein FI9785_823 [Lactobacillus johnsonii FI9785]
 gi|262397682|emb|CAX66696.1| hypothetical protein predicted by Glimmer/Critica [Lactobacillus
           johnsonii FI9785]
          Length = 111

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 38/102 (37%), Gaps = 14/102 (13%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWW 54
            TE +++K +     +  C V +                   +G PD +     +  ++ 
Sbjct: 1   MTEHEIQKLIQVALSQHKCSVFRTNVGKVQTIDHRWFDTGLPQGFPDLMGYRWVDNQIFM 60

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           IEVK  TG+    Q+   E L+       +  S+++    ++
Sbjct: 61  IEVKTKTGKPRKDQLKFHEFLQSHNVIHGIARSVQDALMIVD 102


>gi|298487457|ref|ZP_07005501.1| hypothetical protein PSA3335_2911 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157972|gb|EFH99048.1| hypothetical protein PSA3335_2911 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 567

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 4/73 (5%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV---SM 88
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V     + 
Sbjct: 488 VKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCYVQWAT 547

Query: 89  EEVDNFLEELACT 101
           E   + +EELAC 
Sbjct: 548 EHAADVIEELACH 560


>gi|85859013|ref|YP_461215.1| putative cytoplasmic protein [Syntrophus aciditrophicus SB]
 gi|85722104|gb|ABC77047.1| hypothetical cytosolic protein [Syntrophus aciditrophicus SB]
          Length = 105

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 37/104 (35%), Gaps = 16/104 (15%)

Query: 9   QTEKDVEKRLVTGA---KKLDCWVR-------------KASFVGRRGCPDRLIITPNGGL 52
             E  +   +       + L   V              +   +GR G PD LI   NG  
Sbjct: 1   MRESAILTAICQYLQYQENLGQLVFIRNNSGAFINPKGQFYKMGRPGSPDLLIFLKNGRC 60

Query: 53  WWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
             IEVK   G+ +  Q    + +   G    V+ S+E+V+  L 
Sbjct: 61  AHIEVKNEKGKQNEAQKEYEQAVTDLGHDYHVVRSVEQVEQLLN 104


>gi|289627260|ref|ZP_06460214.1| hypothetical protein PsyrpaN_19339 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289650906|ref|ZP_06482249.1| hypothetical protein Psyrpa2_24680 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330866929|gb|EGH01638.1| hypothetical protein PSYAE_06657 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 567

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 4/73 (5%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV---SM 88
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V     + 
Sbjct: 488 VKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCYVQWAT 547

Query: 89  EEVDNFLEELACT 101
           E   + +EELAC 
Sbjct: 548 EHAADVIEELACH 560


>gi|71734017|ref|YP_275199.1| hypothetical protein PSPPH_3020 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71554570|gb|AAZ33781.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320328333|gb|EFW84337.1| hypothetical protein PsgRace4_20606 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330878408|gb|EGH12557.1| hypothetical protein Pgy4_12616 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 567

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 4/73 (5%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV---SM 88
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V     + 
Sbjct: 488 VKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCYVQWAT 547

Query: 89  EEVDNFLEELACT 101
           E   + +EELAC 
Sbjct: 548 EHAADVIEELACH 560


>gi|19746258|ref|NP_607394.1| hypothetical protein spyM18_1287 [Streptococcus pyogenes
          MGAS8232]
 gi|19748445|gb|AAL97893.1| hypothetical phage protein [Streptococcus pyogenes MGAS8232]
          Length = 94

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 2/84 (2%)

Query: 14 VEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIE 73
          V +  V   K  D           +G  D     PNG +++IEVK  TGR+  +Q   +E
Sbjct: 10 VFRANVGKVKTADGRFFDTGLP--KGFCDLFGFKPNGQIFFIEVKNETGRIRPEQKKFME 67

Query: 74 ELRRRGQRVKVLVSMEEVDNFLEE 97
           +  RG  V V  S+E+    + +
Sbjct: 68 VMASRGALVGVARSVEDALKIVND 91


>gi|330889754|gb|EGH22415.1| hypothetical protein PSYMO_13309 [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 567

 Score = 77.8 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 29/73 (39%), Gaps = 4/73 (5%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV---SM 88
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V     + 
Sbjct: 488 VKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDSQLRWLDFCAEHGMPVEVCYVQWAT 547

Query: 89  EEVDNFLEELACT 101
           E     +EELAC 
Sbjct: 548 EHAAEVIEELACH 560


>gi|260663332|ref|ZP_05864223.1| VRR-NUC domain-containing protein [Lactobacillus fermentum
           28-3-CHN]
 gi|260552184|gb|EEX25236.1| VRR-NUC domain-containing protein [Lactobacillus fermentum
           28-3-CHN]
          Length = 113

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 18/102 (17%), Positives = 34/102 (33%), Gaps = 14/102 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWI 55
           +E  ++  +     +  C V +              S     G PD       +   ++I
Sbjct: 3   SEHKIQNDIRIALSRHQCTVFRVNVGSVKTPDGRFFSAGVPSGHPDLYGFRWSDHQAFYI 62

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           EVK   GR    Q+   E L+       +  S ++    ++E
Sbjct: 63  EVKNERGRPRKDQVRFHEFLQSHNVIHGIARSPDDAVKIVKE 104


>gi|255994013|ref|ZP_05427148.1| putative protein p44 [Eubacterium saphenum ATCC 49989]
 gi|255993681|gb|EEU03770.1| putative protein p44 [Eubacterium saphenum ATCC 49989]
          Length = 145

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 8/99 (8%)

Query: 7   HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
           +  TEKD+E+RL+   K       K       G PDR+++   G ++++EVK+P G LS 
Sbjct: 3   NTITEKDIERRLIRKVKSYGDKTYKFISPTAAGVPDRIVLLA-GHVFFVEVKRPDGELSL 61

Query: 67  QQMSEIEELR-------RRGQRVKVLVSMEEVDNFLEEL 98
           +Q+  + EL+       +   R  VL + +EVD ++E +
Sbjct: 62  RQVLRLIELKGTVPHKSKLIPRCAVLSTADEVDVWVEYI 100


>gi|289167299|ref|YP_003445566.1| hypothetical protein smi_0426 [Streptococcus mitis B6]
 gi|288906864|emb|CBJ21698.1| conserved hypothetical protein [Streptococcus mitis B6]
          Length = 102

 Score = 76.7 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 43/100 (43%), Gaps = 13/100 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
           +E++V+  +     +    V +                   +G  D     P+G ++++E
Sbjct: 3   SEQEVQNEIRVALTQAGYTVFRTNVGKVRTADGRWFDTGLPKGHADLYGFRPDGQIFYVE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           VKK  GR+  +Q + IE +R+RG    V  S +E    ++
Sbjct: 63  VKKENGRVRPEQENFIETVRKRGAIAGVARSAQEALELVK 102


>gi|297587095|ref|ZP_06945740.1| VRR-NUC domain protein [Finegoldia magna ATCC 53516]
 gi|297575076|gb|EFH93795.1| VRR-NUC domain protein [Finegoldia magna ATCC 53516]
          Length = 65

 Score = 76.7 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 33/62 (53%)

Query: 37 RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
            G PDR+I+ P G + ++E K+P G     Q   I + +  G +V VL S E +D  ++
Sbjct: 1  MTGIPDRIILLPKGKVGFVETKRPGGEPRPIQKKRIRQFKNLGFKVYVLDSKENIDEIIK 60

Query: 97 EL 98
           +
Sbjct: 61 RI 62


>gi|76788419|ref|YP_329253.1| hypothetical protein SAK_0621 [Streptococcus agalactiae A909]
 gi|76799184|ref|ZP_00781364.1| gp106 [Streptococcus agalactiae 18RS21]
 gi|76563476|gb|ABA46060.1| conserved hypothetical protein [Streptococcus agalactiae A909]
 gi|76585460|gb|EAO62038.1| gp106 [Streptococcus agalactiae 18RS21]
          Length = 93

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 38/96 (39%), Gaps = 6/96 (6%)

Query: 1  MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
          M      Y     V +  V   K  D           +G  D     PNG +++IEVK  
Sbjct: 1  MELSQAGYM----VFRANVGKVKTADGRFFDTGLP--KGFCDLFGFKPNGQIFFIEVKNE 54

Query: 61 TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          TGR+  +Q + +E +  +G    V  S+E+    + 
Sbjct: 55 TGRIRPEQKNFMEVMASKGALAGVARSVEDALKIVN 90


>gi|160944093|ref|ZP_02091323.1| hypothetical protein FAEPRAM212_01595 [Faecalibacterium prausnitzii
           M21/2]
 gi|158444769|gb|EDP21773.1| hypothetical protein FAEPRAM212_01595 [Faecalibacterium prausnitzii
           M21/2]
          Length = 138

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 5/94 (5%)

Query: 8   YQTEKDVEKRLVTGA-KKLDCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKP-TGR 63
             +E  ++K ++    K++  +  K +     R+G PD ++   +G  +  EVK+P  G 
Sbjct: 43  IPSEAKIQKDILAHLNKQVGGFWWKDAAGPYQRQGIPD-IVGCHDGHFYAFEVKRPLVGE 101

Query: 64  LSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           LS  Q   +  +   G    V+ S+E+V    E 
Sbjct: 102 LSAIQRHTLTAINAAGGSAYVVTSVEDVRQVFER 135


>gi|325276310|ref|ZP_08142095.1| VRR-NUC domain-containing protein [Pseudomonas sp. TJI-51]
 gi|324098557|gb|EGB96618.1| VRR-NUC domain-containing protein [Pseudomonas sp. TJI-51]
          Length = 549

 Score = 75.9 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 34/88 (38%), Gaps = 7/88 (7%)

Query: 3   FYSFHYQTEKDVEKRLV----TGAKKLDCWVRKASFVGRRGCPDRLIITPN-GGLWWIEV 57
           F+S    +E  +++ L        K     + +     R G PD +   P  G    +EV
Sbjct: 456 FWS--MLSEALLQQALACLPAAQLKHCFVRLLQDIRSNRAGMPDLIQFWPEQGRYRMVEV 513

Query: 58  KKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           K P  RL   Q+  +   ++ G  V V 
Sbjct: 514 KGPGDRLQDNQLRWLAFCQQHGLPVAVC 541


>gi|260663813|ref|ZP_05864699.1| VRR-NUC domain-containing protein [Lactobacillus fermentum
           28-3-CHN]
 gi|260551627|gb|EEX24813.1| VRR-NUC domain-containing protein [Lactobacillus fermentum
           28-3-CHN]
          Length = 113

 Score = 75.9 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 34/102 (33%), Gaps = 14/102 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWI 55
           +E  ++  +     +  C V +              S     G PD       +  +++I
Sbjct: 3   SEHKIQNDIRIALSRHQCTVFRVNVGSVKTPDGRFFSAGVPSGHPDMYGYRWSDNQIFYI 62

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           EVK   GR    Q+     L+       +  S ++    ++E
Sbjct: 63  EVKNERGRPRKDQIRFHNFLQSHNVIHGICRSADDALKVVKE 104


>gi|325956970|ref|YP_004292382.1| hypothetical protein LAC30SC_06595 [Lactobacillus acidophilus 30SC]
 gi|325333535|gb|ADZ07443.1| hypothetical protein LAC30SC_06595 [Lactobacillus acidophilus 30SC]
          Length = 131

 Score = 75.9 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 42/115 (36%), Gaps = 18/115 (15%)

Query: 1   MSFYSFHYQT----EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDR 43
           M++ +   +     E  ++  ++       C V +              S     G PD 
Sbjct: 1   MAYRARRVKRGSGPEHRIQNDIIAMLNLNRCSVYRINVGKVRTPDGRYFSTGAPNGMPDL 60

Query: 44  LIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
                 +  +++IEVK P GR+   QM+  ++L        +  S+++    + E
Sbjct: 61  FGFRWIDRRIFFIEVKSPAGRIRPDQMAFHQDLMHLHVIHGIARSIDDARKIVNE 115


>gi|227534634|ref|ZP_03964683.1| phage protein [Lactobacillus paracasei subsp. paracasei ATCC 25302]
 gi|227187735|gb|EEI67802.1| phage protein [Lactobacillus paracasei subsp. paracasei ATCC 25302]
          Length = 108

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 33/106 (31%), Gaps = 14/106 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWI 55
           +E  ++  ++    +  C V +              +     G PD   I   +G    +
Sbjct: 3   SEHAIQSEIMLALSEHGCIVARTNVGTVRTVDGRIFNAGPPPGWPDITAIRKADGRAVLV 62

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           E K   GRL   Q      +        V  S ++    LE   CT
Sbjct: 63  ECKNEKGRLREDQKRFAAAISGTKVIYGVCRSADDAVKLLEANKCT 108


>gi|266623804|ref|ZP_06116739.1| hypothetical protein CLOSTHATH_05124 [Clostridium hathewayi DSM
           13479]
 gi|288864376|gb|EFC96674.1| hypothetical protein CLOSTHATH_05124 [Clostridium hathewayi DSM
           13479]
          Length = 123

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 42/96 (43%), Gaps = 8/96 (8%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
            T+ D+E+++          + + S     G P  ++I P G + ++E+    G+ +  Q
Sbjct: 1   MTKIDLEQKIKDAVDARGGRMHEISVGNTPGFPGYMVILPGGHVGFVEI----GKPNRNQ 56

Query: 69  ----MSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
                ++I ELR  G     + +  ++++ +  +  
Sbjct: 57  LIALRNQISELRTLGCAAMAIDNESQINSMMMYILS 92


>gi|184154943|ref|YP_001843283.1| hypothetical protein LAF_0467 [Lactobacillus fermentum IFO 3956]
 gi|183226287|dbj|BAG26803.1| hypothetical phage protein [Lactobacillus fermentum IFO 3956]
          Length = 114

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 33/101 (32%), Gaps = 14/101 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E  ++ ++        C V +                   RG  D       +G  ++IE
Sbjct: 5   EHVIQNQIRLALSANQCTVFRINVGKLRLPDGTLFQTGVPRGYSDLSGFRWSDGKAFFIE 64

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK  TGR    Q+     L   G    +  S E+    ++E
Sbjct: 65  VKTQTGRPRKDQIQFHHMLTSHGIVHGIARSPEDAIKIVKE 105


>gi|146309124|ref|YP_001189589.1| hypothetical protein Pmen_4110 [Pseudomonas mendocina ymp]
 gi|145577325|gb|ABP86857.1| hypothetical protein Pmen_4110 [Pseudomonas mendocina ymp]
          Length = 547

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 22/66 (33%), Gaps = 4/66 (6%)

Query: 25  LDCWVRKA---SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQ 80
           L  W R+        R G PD +   P       IEVK P  RL   Q   +      G 
Sbjct: 477 LGAWFRRLLADIRENRAGMPDLIQFWPAERRYRMIEVKGPGDRLQDNQKRWLAFCAEHGM 536

Query: 81  RVKVLV 86
            V V  
Sbjct: 537 PVSVCY 542


>gi|330505342|ref|YP_004382211.1| hypothetical protein MDS_4428 [Pseudomonas mendocina NK-01]
 gi|328919628|gb|AEB60459.1| hypothetical protein MDS_4428 [Pseudomonas mendocina NK-01]
          Length = 543

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P  G    IEVK P  RL   Q   +      G  V V  
Sbjct: 484 IRENRAGMPDLIQFWPSEGRYRMIEVKGPGDRLQDNQKRWLAFCAEHGMPVSVCY 538


>gi|323485272|ref|ZP_08090622.1| VRR-NUC domain-containing protein [Clostridium symbiosum
          WAL-14163]
 gi|323401450|gb|EGA93798.1| VRR-NUC domain-containing protein [Clostridium symbiosum
          WAL-14163]
          Length = 118

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 6/92 (6%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVG---RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          EK+ E ++    K    WV K        + G PD L+   +G    IEVK P G  S  
Sbjct: 4  EKNFENKVKKFLKDKGAWVLKYWGGAAYTKSGIPDLLVC-SDGRFLGIEVKAPNGEPSLL 62

Query: 68 QMSEIEELRRRGQRVKVLV--SMEEVDNFLEE 97
          Q+  ++++R  G    +L     E+   F+ +
Sbjct: 63 QLVNLKKIRESGGYGILLYPKDFEQFKMFIAK 94


>gi|300361367|ref|ZP_07057544.1| phage protein [Lactobacillus gasseri JV-V03]
 gi|300353986|gb|EFJ69857.1| phage protein [Lactobacillus gasseri JV-V03]
          Length = 113

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 38/101 (37%), Gaps = 14/101 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWI 55
           +E +++K +     +  C V +                   +G PD +     +  ++ I
Sbjct: 4   SEHEIQKLIQVALSRHKCSVFRTNVGKVQTIDKRWFDTGLPQGFPDLMGYRWVDNQIFMI 63

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           EVK  TG+    Q+   E L+       +  S+++    ++
Sbjct: 64  EVKSKTGKPRKDQLRFHEFLQSHNVIHGIARSVQDALMIVD 104


>gi|23455863|ref|NP_695093.1| hypothetical protein O1205p15 [Streptococcus phage O1205]
 gi|2444095|gb|AAC79531.1| ORF15 [Streptococcus phage O1205]
          Length = 86

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 2/82 (2%)

Query: 19  VTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRR 78
           V   +  D           +G  D     P+G +++IEVK   GRL   Q   +E +++R
Sbjct: 7   VGKVRMADGRWFDTGAP--KGFCDLFGFRPDGQIFFIEVKNEKGRLRDDQKKFMEAMKKR 64

Query: 79  GQRVKVLVSMEEVDNFLEELAC 100
           G  V V  S+++  + + E  C
Sbjct: 65  GALVGVARSVKDAMDIVNEKKC 86


>gi|62327129|ref|YP_223917.1| hypothetical protein phiJL1_ORF114 [Lactobacillus phage phiJL-1]
 gi|37930146|gb|AAP74544.1| putative protein [Lactobacillus phage phiJL-1]
          Length = 114

 Score = 74.8 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 36/102 (35%), Gaps = 14/102 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPN-GGLWWI 55
            E  ++  +     K    V +                    G PD +   P+ G +++I
Sbjct: 6   REAAIQDSIRVALAKAGYVVFRTNVGKVKTADGRWFDTGLPTGFPDLIGYKPDNGRIFFI 65

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           EVK P GR    Q++    LR +     V  S +E    + +
Sbjct: 66  EVKTPIGRRRKDQVNFANGLRDKNVIYGVARSAKEAVTIVRD 107


>gi|295319701|gb|ADG00079.1| VRR-NUC domain protein [Clostridium botulinum F str. 230613]
          Length = 62

 Score = 74.8 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 40 CPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           PDR+++ P G + ++E+K P  +    Q   I+ELR  G RV+++ S+E ++NF+E + 
Sbjct: 1  MPDRIVLLPEGRIIFVELKAPGKKPRPIQKYRIKELRSLGFRVEIIDSIERINNFVEGIK 60


>gi|104781734|ref|YP_608232.1| hypothetical protein PSEEN2643 [Pseudomonas entomophila L48]
 gi|95110721|emb|CAK15434.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 550

 Score = 74.8 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 25/67 (37%), Gaps = 1/67 (1%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRR 78
              K     + +     R G PD +   P  G    +EVK P  RL   Q+  ++  +  
Sbjct: 475 QHLKACFVRLLQDIRNNRAGMPDLIQFWPAEGRYRMVEVKGPGDRLQDNQLRWLDFCQAH 534

Query: 79  GQRVKVL 85
           G  V V 
Sbjct: 535 GLPVVVC 541


>gi|167033941|ref|YP_001669172.1| VRR-NUC domain-containing protein [Pseudomonas putida GB-1]
 gi|166860429|gb|ABY98836.1| VRR-NUC domain protein [Pseudomonas putida GB-1]
          Length = 549

 Score = 74.8 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 7/88 (7%)

Query: 3   FYSFHYQTEKDVEKRLV----TGAKKLDCWVRKASFVGRRGCPDRLIITPN-GGLWWIEV 57
           F+S    +E  +++ L        K+    + +     R G PD +   P  G    +EV
Sbjct: 456 FWS--MLSEDLLQQALACLPAAQLKQCFLRLLQDIRSNRAGMPDLIQFWPEQGLYRMVEV 513

Query: 58  KKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           K P  RL   Q+  +E  R+ G  V V 
Sbjct: 514 KGPGDRLQDNQLRWLEFCRQHGLPVAVC 541


>gi|194466774|ref|ZP_03072761.1| VRR-NUC domain protein [Lactobacillus reuteri 100-23]
 gi|194453810|gb|EDX42707.1| VRR-NUC domain protein [Lactobacillus reuteri 100-23]
          Length = 112

 Score = 74.4 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 35/102 (34%), Gaps = 14/102 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWI 55
           +E  ++  +     K  C V +              S     G PD       +  +++I
Sbjct: 3   SEHKIQNDIRVALSKHQCTVFRVNVGSVKTPDGRFFSAGVPSGHPDLYGFRWSDHQVFYI 62

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           EVK   G+    Q+   E L +R     +  S  +    +EE
Sbjct: 63  EVKNEKGKPRADQIRFHEMLTKREIIHGIARSAGDAVKIVEE 104


>gi|315038324|ref|YP_004031892.1| hypothetical protein LA2_05690 [Lactobacillus amylovorus GRL 1112]
 gi|312276457|gb|ADQ59097.1| hypothetical protein LA2_05690 [Lactobacillus amylovorus GRL 1112]
          Length = 139

 Score = 73.6 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 40/100 (40%), Gaps = 13/100 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKASFVG------------RRGCPDRLII-TPNGGLWWIEV 57
           E  ++  ++   +   C V + +                 G PD +     +  +++IEV
Sbjct: 26  EHRIQNDIIAMLRMHRCSVMRVNAGTIKTQSGSYFKGVENGTPDLIGYRWRDKQIFFIEV 85

Query: 58  KKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           K P GR+   Q++  ++L        +  S+++    ++E
Sbjct: 86  KAPKGRIRPDQLAYHQDLMHHNVIHGIARSVDDALKIIDE 125


>gi|331019268|gb|EGH99324.1| hypothetical protein PLA106_24773 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 568

 Score = 73.2 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 23/61 (37%), Gaps = 1/61 (1%)

Query: 27  CWVRKASFVGRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
             + +     R G PD +   P       IEVK P  RL   Q+  ++     G  V+V 
Sbjct: 486 WRLLQDIKANRTGMPDLIQFFPEQRGYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVC 545

Query: 86  V 86
            
Sbjct: 546 Y 546


>gi|167630915|ref|YP_001681414.1| hypothetical protein HM1_2894 [Heliobacterium modesticaldum Ice1]
 gi|167593655|gb|ABZ85403.1| hypothetical protein HM1_2894 [Heliobacterium modesticaldum Ice1]
          Length = 144

 Score = 73.2 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 4/94 (4%)

Query: 9  QTEKDVEKRLVTGAKKL-DCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
            E+D+   ++   K + +C+  K      G  G PD +     G     EVK  +GRL+
Sbjct: 1  MAERDIVNAIMRYLKSVPECFCWKEHGGMYGTAGLPDIICCIK-GRFIAFEVKTASGRLT 59

Query: 66 HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
            Q + + ++R        + S+ +V   L+ L+
Sbjct: 60 KLQEATMRKIRDAKGEAFKVTSVGDVRTVLDGLS 93


>gi|312901375|ref|ZP_07760655.1| VRR-NUC domain protein [Enterococcus faecalis TX0470]
 gi|311291538|gb|EFQ70094.1| VRR-NUC domain protein [Enterococcus faecalis TX0470]
          Length = 97

 Score = 73.2 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 4/89 (4%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASF--VGRRGCPDRLIITPNGGLWWIEVKKP-TGRLSHQ 67
          EK VE ++      L  +  K         G PD L    NG    IEVK+P  G +S  
Sbjct: 5  EKKVENQIKKYLDSLGAYYLKVHGSMYQPAGTPDVLACV-NGYFVAIEVKRPNGGVVSAL 63

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          Q S+++ + + G    V  S+++V   L+
Sbjct: 64 QKSKLKRIEQAGGISIVARSVDDVSTMLK 92


>gi|220924122|ref|YP_002499424.1| VRR-NUC domain-containing protein [Methylobacterium nodulans ORS
           2060]
 gi|219948729|gb|ACL59121.1| VRR-NUC domain protein [Methylobacterium nodulans ORS 2060]
          Length = 126

 Score = 73.2 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 38/103 (36%), Gaps = 16/103 (15%)

Query: 11  EKDVEKRLVTGAK-KLDCWVRKASFVGRRG---------------CPDRLIITPNGGLWW 54
           E  ++  +V   +   D  V      GRRG                PD +    +G +  
Sbjct: 7   EHHIQAAIVARLRGSFDAIVAAVPNGGRRGKREAVELRAEGVEPGHPDLIAYGRDGRVLL 66

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           +EVK   G LS  Q   I  LR RG  V V+  +E     + E
Sbjct: 67  LEVKAAGGSLSAAQRRLIPNLRERGFPVAVVRDIEGAVQAMRE 109


>gi|167758218|ref|ZP_02430345.1| hypothetical protein CLOSCI_00556 [Clostridium scindens ATCC 35704]
 gi|167664115|gb|EDS08245.1| hypothetical protein CLOSCI_00556 [Clostridium scindens ATCC 35704]
          Length = 159

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 39/95 (41%), Gaps = 3/95 (3%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLW--WIEVKKPTGRLS 65
           +  E  +   +    K+ +  V K +   + G PD  +  P GG    +IE+K  +G+ +
Sbjct: 22  FIPELRLLHHVPNEGKRTNGAVLK-AAGLKTGVPDLSLPVPRGGFHGLYIEMKFGSGKTT 80

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
             Q   +  LR++G +  V    E+    +     
Sbjct: 81  KAQEEFMALLRQQGYKTAVAYGAEQAREIIRHYLA 115


>gi|170722146|ref|YP_001749834.1| VRR-NUC domain-containing protein [Pseudomonas putida W619]
 gi|169760149|gb|ACA73465.1| VRR-NUC domain protein [Pseudomonas putida W619]
          Length = 549

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 25/67 (37%), Gaps = 1/67 (1%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRR 78
              K+    + +     R G PD +   P  G    +EVK P  RL   Q+  +E     
Sbjct: 475 AHLKQCFLRLLQDIRNNRTGMPDLIQFWPEQGRYRMVEVKGPGDRLQDNQLRWLEFCAEH 534

Query: 79  GQRVKVL 85
           G  V V 
Sbjct: 535 GLPVAVC 541


>gi|330958251|gb|EGH58511.1| hypothetical protein PMA4326_06722 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 562

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 488 IKTNRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 542


>gi|291548667|emb|CBL24929.1| VRR-NUC domain [Ruminococcus torques L2-14]
          Length = 118

 Score = 72.8 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 6/92 (6%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVG---RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          EK+ E ++    K    W+ K        + G PD L+   +G    IEVK P G  S  
Sbjct: 4  EKNFENKVKAFLKDTGAWLLKYWGGAAYTKSGIPDLLVC-SDGCFLGIEVKAPNGEPSLL 62

Query: 68 QMSEIEELRRRGQRVKVLV--SMEEVDNFLEE 97
          Q+  ++++R  G    +L     E+   F+ +
Sbjct: 63 QLVNLKKIRESGGYGILLYPKDFEQFKMFIAK 94


>gi|227877437|ref|ZP_03995505.1| phage protein [Lactobacillus crispatus JV-V01]
 gi|227862941|gb|EEJ70392.1| phage protein [Lactobacillus crispatus JV-V01]
          Length = 125

 Score = 72.8 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 38/101 (37%), Gaps = 14/101 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E  ++  ++       C V +              +     G PD       +   ++IE
Sbjct: 12  EHRIQLDIIAALTMHRCTVYRGNVGKIKMQDGRFFNTGLPNGFPDLFGWRWSDKQFYFIE 71

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK P GR+   Q++  ++L  R     +  S+++    ++E
Sbjct: 72  VKAPKGRIRPDQLAFHQDLMHRKVIHGIARSVDDALKIVKE 112


>gi|227528974|ref|ZP_03959023.1| phage protein [Lactobacillus vaginalis ATCC 49540]
 gi|227351111|gb|EEJ41402.1| phage protein [Lactobacillus vaginalis ATCC 49540]
          Length = 119

 Score = 72.8 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 38/103 (36%), Gaps = 14/103 (13%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLII-TPNGGLWW 54
            +E +++ R++    +  C + +                   +G PD       NG +++
Sbjct: 2   ISEHEIQSRILVAVSQHRCTIFRSNVGKVKTDDGRWFDTGLPKGHPDLYGFKWSNGKVFY 61

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           +E+K   G+    Q+     L        +  S+++    ++E
Sbjct: 62  LEIKNAKGKPRQDQIRFHHMLTSHNIIHGIARSVDDALKIVDE 104


>gi|149910747|ref|ZP_01899382.1| hypothetical protein PE36_00175 [Moritella sp. PE36]
 gi|149806187|gb|EDM66166.1| hypothetical protein PE36_00175 [Moritella sp. PE36]
          Length = 113

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 14/100 (14%)

Query: 11  EKDVEKRLVTGAKKLDCWVR-------KASFVGR-------RGCPDRLIITPNGGLWWIE 56
           E  ++  ++    + D           K+   GR       RG  D + +T NG    IE
Sbjct: 5   ETRIQADIINFLIRDDRIAWVHRCNTGKSLVNGRMVEFGLGRGTADIIGMTCNGKFLAIE 64

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           VK PTGR+S  Q   ++ +   G    V+ S+++V   L 
Sbjct: 65  VKTPTGRISDHQRMWLKRVAMHGGLAAVVRSIDDVKASLN 104


>gi|237801224|ref|ZP_04589685.1| hypothetical protein POR16_20534 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331024082|gb|EGI04139.1| hypothetical protein POR16_20534 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 561

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 25/65 (38%), Gaps = 4/65 (6%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV---SM 88
               R G PD +   P+      IEVK P  RL   Q+  ++     G  V V     S+
Sbjct: 487 IKANRTGMPDLIQFFPDQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVDVCYVRWSL 546

Query: 89  EEVDN 93
           +  + 
Sbjct: 547 DSAEQ 551


>gi|314933978|ref|ZP_07841343.1| phage protein [Staphylococcus caprae C87]
 gi|313654128|gb|EFS17885.1| phage protein [Staphylococcus caprae C87]
          Length = 103

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 38/101 (37%), Gaps = 13/101 (12%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRK------ASFVGR------RGCPDRLIITP-NGGLWWI 55
            TE+ ++  ++    +    + +       +   R      +G PD       +G    I
Sbjct: 1   MTEQQIQNEIILAINQRGHRLFRANAGKVITKDNRVIKLLPKGFPDTFGYRKSDGKFIAI 60

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           EVK   G+L  +Q+   E +  +     V  S+E+    +E
Sbjct: 61  EVKTEKGKLRPEQIKFKEFIETQNVLYGVARSVEDAIKIVE 101


>gi|220921970|ref|YP_002497271.1| VRR-NUC domain-containing protein [Methylobacterium nodulans ORS
           2060]
 gi|219946576|gb|ACL56968.1| VRR-NUC domain protein [Methylobacterium nodulans ORS 2060]
          Length = 127

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 37/103 (35%), Gaps = 16/103 (15%)

Query: 11  EKDVEKRLVTGAK-KLDCWVRKASFVGRRG---------------CPDRLIITPNGGLWW 54
           E  ++  +V   +   D  V      GRRG                PD +    +G +  
Sbjct: 8   EHHIQVAIVARLRGSFDAIVAAVPNGGRRGKREAVELRAEGVEPGHPDLIAYGRDGRVLL 67

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
            EVK   G LS  Q   I  LR RG  V V+  +E     + E
Sbjct: 68  FEVKAAGGSLSAAQRRLIPNLRERGFPVAVVRDVEGAVQAMRE 110


>gi|26989557|ref|NP_744982.1| VRR-NUC domain protein [Pseudomonas putida KT2440]
 gi|24984434|gb|AAN68446.1|AE016477_5 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 549

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 1/54 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
               R G PD +   P  G    +EVK P  RL   Q+  +   R+ G  V V 
Sbjct: 488 IRSNRAGMPDLIQFWPEQGRYRMVEVKGPGDRLQDNQLRWLAFCRQHGLPVAVC 541


>gi|148548065|ref|YP_001268167.1| VRR-NUC domain-containing protein [Pseudomonas putida F1]
 gi|148512123|gb|ABQ78983.1| VRR-NUC domain protein [Pseudomonas putida F1]
          Length = 549

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD +   P  G    +EVK P  RL   Q+  +E  R+ G  V V 
Sbjct: 491 NRTGMPDLIQFWPEQGRYRMVEVKGPGDRLQDNQLRWLEFCRQHGLPVAVC 541


>gi|298682364|gb|ADI95425.1| VRR-NUC domain-containing protein [Pseudomonas putida]
          Length = 497

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD +   P  G    +EVK P  RL   Q+  +E  R+ G  V V 
Sbjct: 439 NRTGMPDLIQFWPEQGRYRMVEVKGPGDRLQDNQLRWLEFCRQHGLPVAVC 489


>gi|220923974|ref|YP_002499276.1| VRR-NUC domain-containing protein [Methylobacterium nodulans ORS
           2060]
 gi|219948581|gb|ACL58973.1| VRR-NUC domain protein [Methylobacterium nodulans ORS 2060]
          Length = 126

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 38/103 (36%), Gaps = 16/103 (15%)

Query: 11  EKDVEKRLVTGAK-KLDCWVRKASFVGRRG---------------CPDRLIITPNGGLWW 54
           E  ++  +V   +   D  V      GRRG                PD +    +G +  
Sbjct: 7   EHHIQAAIVARLRGSFDAIVAAVPNGGRRGKREAVELRAEGVEPGHPDLIAYGRDGRVLL 66

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           +EVK   G LS  Q   I  LR RG  V V+  +E     + E
Sbjct: 67  LEVKAAGGSLSAVQRRLIPNLRERGFPVAVVRDVEGAVQAMHE 109


>gi|313499142|gb|ADR60508.1| VRR-NUC domain-containing protein [Pseudomonas putida BIRD-1]
          Length = 549

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD +   P  G    +EVK P  RL   Q+  +E  R+ G  V V 
Sbjct: 491 NRTGMPDLIQFWPEQGRYRMVEVKGPGDRLQDNQLRWLEFCRQHGLPVAVC 541


>gi|330967731|gb|EGH67991.1| hypothetical protein PSYAC_24423 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 579

 Score = 72.1 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 500 IKANRTGMPDLIQFFPEQRGYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 554


>gi|330875886|gb|EGH10035.1| hypothetical protein PSYMP_11839 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 571

 Score = 72.1 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 492 IKANRTGMPDLIQFFPEQRGYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 546


>gi|66046338|ref|YP_236179.1| hypothetical protein Psyr_3109 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63257045|gb|AAY38141.1| conserved hypothetical protein [Pseudomonas syringae pv. syringae
           B728a]
          Length = 567

 Score = 72.1 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 488 IKANRTGMPDLIQFFPQQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 542


>gi|28870436|ref|NP_793055.1| hypothetical protein PSPTO_3272 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28853683|gb|AAO56750.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 576

 Score = 72.1 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 500 IKANRTGMPDLIQFFPEQRGYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 554


>gi|213969902|ref|ZP_03398036.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|213925450|gb|EEB59011.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 576

 Score = 72.1 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 500 IKANRTGMPDLIQFFPEQRGYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 554


>gi|330982003|gb|EGH80106.1| hypothetical protein PSYAP_26164 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 567

 Score = 72.1 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 488 IKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 542


>gi|302187040|ref|ZP_07263713.1| hypothetical protein Psyrps6_11845 [Pseudomonas syringae pv.
           syringae 642]
          Length = 567

 Score = 72.1 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 488 IKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 542


>gi|301384861|ref|ZP_07233279.1| hypothetical protein PsyrptM_19600 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302064120|ref|ZP_07255661.1| hypothetical protein PsyrptK_29402 [Pseudomonas syringae pv. tomato
           K40]
 gi|302130372|ref|ZP_07256362.1| hypothetical protein PsyrptN_03192 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
          Length = 568

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 492 IKANRTGMPDLIQFFPEQRGYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 546


>gi|330954658|gb|EGH54918.1| hypothetical protein PSYCIT7_25544 [Pseudomonas syringae Cit 7]
          Length = 567

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   + G  V+V  
Sbjct: 488 IKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAKHGMPVEVCY 542


>gi|330897976|gb|EGH29395.1| hypothetical protein PSYJA_10633 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 567

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 488 IKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 542


>gi|289672370|ref|ZP_06493260.1| hypothetical protein PsyrpsF_03945 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 567

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 488 IKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 542


>gi|326336482|ref|ZP_08202652.1| VRR-NUC domain protein [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325691355|gb|EGD33324.1| VRR-NUC domain protein [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 112

 Score = 71.7 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 29/81 (35%), Gaps = 10/81 (12%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRG 79
              K               G  D  ++ P+G + +IE+K    + +  Q +  ++    G
Sbjct: 40  KRLKAEGVLA---------GVADLTVLLPHGKILYIEMKVKGNKQTPNQKTFQQKAEALG 90

Query: 80  QRVKVLVSMEEVDNFL-EELA 99
               V  S EE    + +E+ 
Sbjct: 91  HTYYVCYSFEEFKEIITKEIQ 111


>gi|330974217|gb|EGH74283.1| hypothetical protein PSYAR_27396 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 567

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 488 IKANRTGMPDLIQFFPQQRLYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 542


>gi|330940193|gb|EGH43335.1| hypothetical protein PSYPI_13456 [Pseudomonas syringae pv. pisi
          str. 1704B]
          Length = 93

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33 SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
              R G PD +   P       IEVK P  RL   Q+  ++     G  V+V  
Sbjct: 14 IKANRTGMPDLIQFFPEQRRYRMIEVKGPGDRLQDNQLRWLDFCAEHGMPVEVCY 68


>gi|295699629|ref|YP_003607522.1| VRR-NUC domain protein [Burkholderia sp. CCGE1002]
 gi|295438842|gb|ADG18011.1| VRR-NUC domain protein [Burkholderia sp. CCGE1002]
          Length = 589

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            + +     R G PD +   P       IEVK P  RL   Q+  +    + G  V+V+ 
Sbjct: 506 RLLRDIRGNRSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIRWLAYCAQHGMPVRVVD 565


>gi|209521499|ref|ZP_03270203.1| VRR-NUC domain protein [Burkholderia sp. H160]
 gi|209498059|gb|EDZ98210.1| VRR-NUC domain protein [Burkholderia sp. H160]
          Length = 589

 Score = 71.3 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            + +     R G PD +   P       IEVK P  RL   Q+  +    + G  V+V+ 
Sbjct: 506 RLLRDIRGNRSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIRWLAYCAQHGMPVRVVD 565


>gi|293605909|ref|ZP_06688279.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292815696|gb|EFF74807.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 563

 Score = 71.3 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 25/67 (37%), Gaps = 1/67 (1%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRR 78
              K +   + +     R G PD +   P       IEVK P  +L   Q+  ++     
Sbjct: 488 AHLKLVFTRLLRDVKTNRSGLPDLIRFWPSERRYELIEVKGPGDKLQDNQIRWLQYCVSH 547

Query: 79  GQRVKVL 85
           G  V+V 
Sbjct: 548 GMPVRVC 554


>gi|312873802|ref|ZP_07733846.1| VRR-NUC domain protein [Lactobacillus iners LEAF 2052A-d]
 gi|311090683|gb|EFQ49083.1| VRR-NUC domain protein [Lactobacillus iners LEAF 2052A-d]
          Length = 111

 Score = 70.9 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 40/100 (40%), Gaps = 14/100 (14%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E +++K++     + +C + +                   +G PD       +  +++IE
Sbjct: 4   EHEIQKKIQVAVSQRNCTIFRANVGKIFLSDGGYFDTGLPKGFPDLFGFRWCDHHIFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           VK  TG+ S +Q+   E L+       +  S ++    +E
Sbjct: 64  VKSKTGKPSEEQVRFHEFLQSHQIIHGLARSEKDALLIVE 103


>gi|187920119|ref|YP_001889150.1| VRR-NUC domain-containing protein [Burkholderia phytofirmans PsJN]
 gi|187718557|gb|ACD19780.1| VRR-NUC domain protein [Burkholderia phytofirmans PsJN]
          Length = 636

 Score = 70.9 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            + +     R G PD +   P       IEVK P  RL   Q+  +    + G  V+VL 
Sbjct: 502 RLLRDVRGNRSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIRWLAYCAQHGMPVRVLD 561


>gi|226944474|ref|YP_002799547.1| hypothetical protein Avin_23850 [Azotobacter vinelandii DJ]
 gi|226719401|gb|ACO78572.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 552

 Score = 70.5 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 22/59 (37%), Gaps = 1/59 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            + +     R G PD +   P       IEVK P  RL   Q   ++ +   G  V V 
Sbjct: 484 RILRDIPANRSGLPDLIQFWPAERRYRMIEVKGPGDRLQDNQRRWLDYVVAHGLPVAVC 542


>gi|260911995|ref|ZP_05918558.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260633873|gb|EEX52000.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 115

 Score = 70.5 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 34/80 (42%), Gaps = 3/80 (3%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITP--NGGLWWIEVKKPTGRLSHQQMSEIEELRRRG 79
           K+      +   +G RRG PD ++  P       ++E+K  TGR    Q     +L   G
Sbjct: 35  KRTRFEAMEFKRMGTRRGFPDLILCFPSKGHHALFVEMKTKTGRQQPSQKIMQRQLEWAG 94

Query: 80  QRVKVLVSMEEVDNFLEELA 99
            +  +  S+E+  N + +  
Sbjct: 95  YKYAICRSLEDFINEINDYL 114


>gi|237737480|ref|ZP_04567961.1| predicted protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421342|gb|EEO36389.1| predicted protein [Fusobacterium mortiferum ATCC 9817]
          Length = 117

 Score = 70.5 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 41/115 (35%), Gaps = 25/115 (21%)

Query: 9   QTEKDVEKRLVTGA---KKLDCWVR---------------------KASFVGRRGCPDRL 44
             E +++  ++      +                            K     ++G PD  
Sbjct: 1   MRETNIQSTIIRYLAILETQGKLFFNRTNNIPPVNKDSKGKVIGFRKLPTGAKKGIPDIW 60

Query: 45  IITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           +I  NG    +EVK PTG+ S +Q    E+  + G    V+ S EEV N L +  
Sbjct: 61  VII-NGKTIGLEVKTPTGKQSKEQKEIQEKFIKNGADYYVVRSYEEVKNILNKYL 114


>gi|254254035|ref|ZP_04947352.1| hypothetical protein BDAG_03323 [Burkholderia dolosa AUO158]
 gi|124898680|gb|EAY70523.1| hypothetical protein BDAG_03323 [Burkholderia dolosa AUO158]
          Length = 564

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P+      IEVK P  RL   Q   +   R  G  V+V+ 
Sbjct: 492 VRSNRSGLPDLVRFWPDERRYELIEVKGPGDRLQDNQTRWLAYCRAHGMPVRVVD 546


>gi|330820573|ref|YP_004349435.1| hypothetical protein bgla_2g14770 [Burkholderia gladioli BSR3]
 gi|327372568|gb|AEA63923.1| hypothetical protein bgla_2g14770 [Burkholderia gladioli BSR3]
          Length = 557

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 1/53 (1%)

Query: 35  VGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             R G PD +   P       IEVK P  RL   Q+  ++     G  V+V+ 
Sbjct: 493 GNRSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVAHGVPVRVID 545


>gi|311696611|gb|ADP99484.1| protein containing VRR-NUC domain [marine bacterium HP15]
          Length = 569

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 23/65 (35%), Gaps = 5/65 (7%)

Query: 37  RRGCPDRLIITP-----NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
           R G PD +   P     +     IEVK P  RL   Q+  +E     G    V     + 
Sbjct: 505 RSGFPDLIRFLPNVAEPDKRYEMIEVKGPGDRLQDHQIRWLEFFAAEGIPASVCYVRWQA 564

Query: 92  DNFLE 96
              +E
Sbjct: 565 SEAME 569


>gi|255520638|ref|ZP_05387875.1| hypothetical protein LmonocFSL_05316 [Listeria monocytogenes FSL
           J1-175]
          Length = 104

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 35/100 (35%), Gaps = 14/100 (14%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E D++  +     +   +V +                   +G PD       +G +++IE
Sbjct: 4   EMDIQNSIRLELSRHGHYVFRANVGKVRMPNGRIFDTGLPKGFPDLFGFRGTDGKMFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           VK   G+L  +Q +    +        V  S EE    +E
Sbjct: 64  VKNEIGKLRQEQKNFQRAMEITPAICGVARSAEEALKIVE 103


>gi|91778919|ref|YP_554127.1| hypothetical protein Bxe_B1179 [Burkholderia xenovorans LB400]
 gi|91691579|gb|ABE34777.1| conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 623

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            + +     R G PD +   P       IEVK P  RL   Q+  +    + G  V+VL 
Sbjct: 501 RLLRDIRGNRSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIRWLAYCAQHGMPVRVLD 560


>gi|239638086|ref|ZP_04679045.1| gp51 protein [Staphylococcus warneri L37603]
 gi|239596369|gb|EEQ78907.1| gp51 protein [Staphylococcus warneri L37603]
          Length = 103

 Score = 70.1 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 39/101 (38%), Gaps = 13/101 (12%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRK------ASFVGR------RGCPDRLIITP-NGGLWWI 55
            TE+ ++  ++    K    + +       +   R      +G PD       +G    I
Sbjct: 1   MTEQQIQNEIILAINKRGHRLWRANAGKIVTKDNRIIKLLPKGFPDTFGYRKSDGKFIAI 60

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           EVK   G+L  +Q+   E ++ +     V  S+++    +E
Sbjct: 61  EVKTEKGKLRSEQIKFKEFIKTQNVLYGVARSVDDAIKIVE 101


>gi|157325278|ref|YP_001468700.1| gp61 [Listeria phage B025]
 gi|66733284|gb|AAY53101.1| gp61 [Listeria phage B025]
          Length = 104

 Score = 70.1 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 36/100 (36%), Gaps = 14/100 (14%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E D++  +     +   +V +                   +G PD       +G +++IE
Sbjct: 4   EMDIQNSIRLELSRHGHYVFRANVGKVRMPNGRIFDTGLPKGFPDLFGFRGTDGKMFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           VK   G+L  +Q +  + +        V  S EE    +E
Sbjct: 64  VKNEIGKLRQEQKNFQQAMEITPAICGVARSAEEALKIVE 103


>gi|237737302|ref|ZP_04567783.1| predicted protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421164|gb|EEO36211.1| predicted protein [Fusobacterium mortiferum ATCC 9817]
          Length = 117

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 42/115 (36%), Gaps = 25/115 (21%)

Query: 9   QTEKDVEKRLVTGA---------------------KKLDCWVRKASF---VGRRGCPDRL 44
             E D++  ++                        K     V          ++G PD  
Sbjct: 1   MRETDIQSTIIRYLEILETQGKLFFNRTNNIPPVNKDSKGKVIGFRSLPFGAKKGIPDIW 60

Query: 45  IITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           +I  NG    +EVK PTG+ S +Q    E+  + G    V+ S EEV N L++  
Sbjct: 61  VII-NGKTIGLEVKTPTGKQSKEQKEIQEKFIKNGADYYVVRSYEEVKNILDKYL 114


>gi|152989195|ref|YP_001348784.1| hypothetical protein PSPA7_3424 [Pseudomonas aeruginosa PA7]
 gi|150964353|gb|ABR86378.1| hypothetical protein PSPA7_3424 [Pseudomonas aeruginosa PA7]
          Length = 549

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 31/89 (34%), Gaps = 5/89 (5%)

Query: 3   FYSFHYQTEKDVEKRL----VTGAKKLDCWVRKASFVGRRGCPDRLIITP-NGGLWWIEV 57
           F  +    E  +E+ L        +     + +     R G PD +   P       +EV
Sbjct: 454 FVHWELLGEDLLEQALDCLPAAHLRAWFERLLEDIPGNRAGLPDLIQFWPAQRRYRMVEV 513

Query: 58  KKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           K P  RL   Q+  ++  R R   V V  
Sbjct: 514 KGPGDRLQDNQLRWLQFCRERDMPVAVCY 542


>gi|300310628|ref|YP_003774720.1| hypothetical protein Hsero_1296 [Herbaspirillum seropedicae SmR1]
 gi|300073413|gb|ADJ62812.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 551

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 21/66 (31%), Gaps = 4/66 (6%)

Query: 25  LDCWVRKA---SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQ 80
           L  W  +        R G PD +   P       IEVK P  RL   Q   +    +   
Sbjct: 478 LKHWCLRILEDVRENRSGFPDLIQFWPQQRRYRMIEVKGPGDRLQDNQQRWLAFCAQHQM 537

Query: 81  RVKVLV 86
            V V  
Sbjct: 538 PVAVCY 543


>gi|323528049|ref|YP_004230201.1| VRR-NUC domain-containing protein [Burkholderia sp. CCGE1001]
 gi|323385051|gb|ADX57141.1| VRR-NUC domain-containing protein [Burkholderia sp. CCGE1001]
          Length = 610

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            + +     R G PD +   P       IEVK P  RL   Q+  +    + G  V+VL 
Sbjct: 520 RLLRDVRGNRSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIRWLAYCVQHGMPVRVLD 579


>gi|323485178|ref|ZP_08090529.1| hypothetical protein HMPREF9474_02280 [Clostridium symbiosum
           WAL-14163]
 gi|323401497|gb|EGA93844.1| hypothetical protein HMPREF9474_02280 [Clostridium symbiosum
           WAL-14163]
          Length = 96

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 33/96 (34%), Gaps = 6/96 (6%)

Query: 9   QTEKDVEKRLVTGAKKL--DCWVRKASFVGRRGCPDRLIITPNGGLWWIEV-KKPTGRLS 65
             E   +  L+   K     C V K      +G PD L++  +     +E  K    +  
Sbjct: 1   MLENKFQANLIKELKARFPGCIVMKNDPTYIQGIPDLLVLHKD-KWASLECKKSANAKKQ 59

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
             Q   ++ + +      +    E  +  L+EL  +
Sbjct: 60  PNQEYYVDRMNQMSFSRFIC--PENKEEVLDELQQS 93


>gi|311106864|ref|YP_003979717.1| VRR-NUC domain-containing protein [Achromobacter xylosoxidans A8]
 gi|310761553|gb|ADP17002.1| VRR-NUC domain protein [Achromobacter xylosoxidans A8]
          Length = 547

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 23/59 (38%), Gaps = 1/59 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            + +     R G PD +   P       IEVK P  +L   Q+  ++     G  V+V 
Sbjct: 480 RLLRDVKTNRSGLPDLIRFWPSERRYELIEVKGPGDKLQDNQIRWLQYCVSHGMPVRVC 538


>gi|262047909|ref|ZP_06020855.1| VRR-NUC domain-containing protein [Lactobacillus crispatus
           MV-3A-US]
 gi|260571787|gb|EEX28362.1| VRR-NUC domain-containing protein [Lactobacillus crispatus
           MV-3A-US]
          Length = 112

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 36/101 (35%), Gaps = 14/101 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIIT-PNGGLWWI 55
           +E  ++K++     +  C + +              +     G PD       +   ++I
Sbjct: 3   SEHSIQKKIELVVSQHHCHIFRANVGKIRTPDGRFFTTGLPSGYPDLHGWRDWDHQAFYI 62

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           EVK  TG+    Q++  + L +      +  +  +    +E
Sbjct: 63  EVKNATGKPRPDQIAFHKMLMKFNVIHGIARNTNDALKIVE 103


>gi|160932560|ref|ZP_02079950.1| hypothetical protein CLOLEP_01398 [Clostridium leptum DSM 753]
 gi|156868519|gb|EDO61891.1| hypothetical protein CLOLEP_01398 [Clostridium leptum DSM 753]
          Length = 96

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 37/96 (38%), Gaps = 6/96 (6%)

Query: 9   QTEKDVEKRLVTGAKKL--DCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTG-RLS 65
             E   + +L+   KKL   C V K+     +G PD LI+  +     +E K+  G +  
Sbjct: 1   MLESQFQSKLIKELKKLFPGCIVMKSDSGYLQGIPDLLILFND-KWAALECKQHAGAKKQ 59

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
             Q   + ++        +    E  +  L +L  +
Sbjct: 60  PNQEYYVGKMDEMSFSRFIC--PENKEEVLHDLQQS 93


>gi|266624346|ref|ZP_06117281.1| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
 gi|288863796|gb|EFC96094.1| conserved hypothetical protein [Clostridium hathewayi DSM 13479]
          Length = 96

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 36/96 (37%), Gaps = 6/96 (6%)

Query: 9   QTEKDVEKRLVTGAKKL--DCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTG-RLS 65
             E   +  L+   K+    C V K      +G PD L++  +     +E KK  G +  
Sbjct: 1   MLENKFQANLIKELKERFPGCIVMKNDPTYIQGIPDLLVLHKD-KWASLECKKSAGAKKQ 59

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
             Q   ++ + +      +    E  +  L+EL  +
Sbjct: 60  PNQEYYVDRMNQMSFSRFIC--PENKEEVLDELQQS 93


>gi|70730563|ref|YP_260304.1| hypothetical protein PFL_3199 [Pseudomonas fluorescens Pf-5]
 gi|68344862|gb|AAY92468.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 551

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++  +     V V  
Sbjct: 489 IKANRAGMPDLIQFWPEQKRYRMIEVKGPGDRLQDNQLRWLDFCQEHRMPVAVCY 543


>gi|256851384|ref|ZP_05556773.1| VRR-NUC domain-containing protein [Lactobacillus jensenii 27-2-CHN]
 gi|260660808|ref|ZP_05861723.1| VRR-NUC domain-containing protein [Lactobacillus jensenii
           115-3-CHN]
 gi|260664089|ref|ZP_05864942.1| VRR-NUC domain-containing protein [Lactobacillus jensenii SJ-7A-US]
 gi|282933167|ref|ZP_06338554.1| phage protein [Lactobacillus jensenii 208-1]
 gi|256616446|gb|EEU21634.1| VRR-NUC domain-containing protein [Lactobacillus jensenii 27-2-CHN]
 gi|260548530|gb|EEX24505.1| VRR-NUC domain-containing protein [Lactobacillus jensenii
           115-3-CHN]
 gi|260561975|gb|EEX27944.1| VRR-NUC domain-containing protein [Lactobacillus jensenii SJ-7A-US]
 gi|281302671|gb|EFA94886.1| phage protein [Lactobacillus jensenii 208-1]
          Length = 118

 Score = 69.8 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 37/103 (35%), Gaps = 19/103 (18%)

Query: 10  TEKDVEKRL----------------VTGAKKLDCWVRKASFVGRRGCPDRLIITP-NGGL 52
           +E  +++++                V   K+ D            G PD       +   
Sbjct: 3   SEHLIQQKIQLYITQNNLGCCFRANVGSVKQADGRWFSTGLPN--GYPDLHGTRWIDNQS 60

Query: 53  WWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           ++IEVK PTG++   QM   + L +      +  S+++    +
Sbjct: 61  YFIEVKSPTGKIRDDQMRFHQFLMQHNVIHGIARSVDDAKMII 103


>gi|161520780|ref|YP_001584207.1| VRR-NUC domain-containing protein [Burkholderia multivorans ATCC
           17616]
 gi|189353038|ref|YP_001948665.1| hypothetical protein BMULJ_04272 [Burkholderia multivorans ATCC
           17616]
 gi|160344830|gb|ABX17915.1| VRR-NUC domain protein [Burkholderia multivorans ATCC 17616]
 gi|189337060|dbj|BAG46129.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 567

 Score = 69.4 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P+      IEVK P  RL   Q   +      G  V+V+ 
Sbjct: 493 IRGNRSGLPDLVRFWPDEHRYELIEVKGPGDRLQDNQTRWLAYCIAHGMPVRVVD 547


>gi|167462181|ref|ZP_02327270.1| hypothetical protein Plarl_06425 [Paenibacillus larvae subsp.
          larvae BRL-230010]
          Length = 115

 Score = 69.4 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 35/95 (36%), Gaps = 6/95 (6%)

Query: 9  QTEKDVEKRLVTGAKKL-DCWVRKASFVG--RRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
            E   +K++        D W  K    G  R G PD ++    G    IE+K  TGR S
Sbjct: 1  MKEAQFQKKVTNFLNAQPDIWYVKVWGGGYQRAGIPD-ILCCAKGHFIAIELKSETGRTS 59

Query: 66 HQQMSEIEELRRRGQRVKVLV--SMEEVDNFLEEL 98
            Q   +  +   G    VL     E    F+ E+
Sbjct: 60 KLQDYNLNRISESGGMTIVLRPSEFEAFKRFIREV 94


>gi|307546495|ref|YP_003898974.1| hypothetical protein HELO_3905 [Halomonas elongata DSM 2581]
 gi|307218519|emb|CBV43789.1| hypothetical protein HELO_3905 [Halomonas elongata DSM 2581]
          Length = 559

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 3/53 (5%)

Query: 36  GRRGCPDRLIITPNG---GLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD +   P+       +IEVK P  RL   Q   +   + RG    V 
Sbjct: 499 NRSGLPDLIQFLPDAESPRYRFIEVKGPGDRLQDNQRRWLSFFQTRGIPAAVC 551


>gi|289706284|ref|ZP_06502646.1| VRR-NUC domain protein [Micrococcus luteus SK58]
 gi|289557007|gb|EFD50336.1| VRR-NUC domain protein [Micrococcus luteus SK58]
          Length = 93

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 36/91 (39%), Gaps = 3/91 (3%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
            E D ++++   A+ L   V          RG PD  ++   G + + E+K   GR + 
Sbjct: 1  MREDDFQRQVEGLAESLGWKVYHTHDSRRSHRGWPDL-VLGRRGRVLFRELKTMKGRTTP 59

Query: 67 QQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           Q   +E L   G    V   ++  D  +E 
Sbjct: 60 DQKQWLELLNAAGHDAAVWRPVQWFDRTIER 90


>gi|217964664|ref|YP_002350342.1| hypothetical protein LMHCC_1383 [Listeria monocytogenes HCC23]
 gi|217333934|gb|ACK39728.1| conserved hypothetical protein [Listeria monocytogenes HCC23]
 gi|307570772|emb|CAR83951.1| conserved hypothetical protein [Listeria monocytogenes L99]
          Length = 105

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 37/101 (36%), Gaps = 14/101 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E D++  +     +   +V +                   +G PD       +G +++IE
Sbjct: 4   EMDIQNSIRLELSRHGHYVFRANVGKVKLPNGRIFDTGLPKGFPDLFGFRGTDGKMFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK   G+L  +Q +  + ++       V  S  E    +EE
Sbjct: 64  VKNEIGKLRQEQKNFQQAMQITPAICGVARSAAEAVRIVEE 104


>gi|149375440|ref|ZP_01893210.1| hypothetical protein MDG893_16327 [Marinobacter algicola DG893]
 gi|149360145|gb|EDM48599.1| hypothetical protein MDG893_16327 [Marinobacter algicola DG893]
          Length = 566

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 20/55 (36%), Gaps = 5/55 (9%)

Query: 37  RRGCPDRLIITPNG-----GLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +   P+          IEVK P  RL   Q   +E     G  V V  
Sbjct: 506 RSGFPDLIRFRPDHSDPNRRYEMIEVKGPGDRLQDHQTRWLEFCVDHGIPVSVCY 560


>gi|16801648|ref|NP_471916.1| hypothetical protein lin2586 [Listeria innocua Clip11262]
 gi|16415108|emb|CAC97813.1| lin2586 [Listeria innocua Clip11262]
          Length = 104

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 36/100 (36%), Gaps = 14/100 (14%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E D++  +     +   +V +                   +G PD       +G +++IE
Sbjct: 4   EIDIQNSIRLELSRHGHYVFRANVGKVRMPNGRIFDTGLPKGFPDLFGFRGTDGKMFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           VK   G+L  +Q +  + +        V  S EE    +E
Sbjct: 64  VKNEIGKLRQEQKNFQQAMEITPAICGVARSAEEALKIVE 103


>gi|302385143|ref|YP_003820965.1| VRR-NUC domain protein [Clostridium saccharolyticum WM1]
 gi|302195771|gb|ADL03342.1| VRR-NUC domain protein [Clostridium saccharolyticum WM1]
          Length = 148

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 31/101 (30%), Gaps = 11/101 (10%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKPT 61
           +  H       +K+     K             + G PD  +  P G     +IE+K   
Sbjct: 33  WIHHCPNGGSRQKKEAARLKAQGV---------KPGVPDLHLPIPKGAYAGLYIEMKYDD 83

Query: 62  GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
           G +   Q   I  ++  G    V    +     +EE    L
Sbjct: 84  GTVEPPQKEWIRAMKAAGHFACVCYGYDYAVKVIEEYVSLL 124


>gi|222110614|ref|YP_002552878.1| vrr-nuc domain-containing protein [Acidovorax ebreus TPSY]
 gi|221730058|gb|ACM32878.1| VRR-NUC domain protein [Acidovorax ebreus TPSY]
          Length = 561

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 27/71 (38%), Gaps = 5/71 (7%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITPNG-----GLWWIEVKKPTGRLSHQQMSEIEE 74
              ++L   + +     R G PD +   P           +EVK P  +L   Q+  ++ 
Sbjct: 483 AHLERLFARLLRDVQANRTGLPDLVRFWPGRPPGAERYALVEVKAPGDKLQDNQIRWLDY 542

Query: 75  LRRRGQRVKVL 85
              +G  V+V 
Sbjct: 543 CVAQGIPVQVC 553


>gi|121594770|ref|YP_986666.1| hypothetical protein Ajs_2429 [Acidovorax sp. JS42]
 gi|120606850|gb|ABM42590.1| conserved hypothetical protein [Acidovorax sp. JS42]
          Length = 561

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 27/71 (38%), Gaps = 5/71 (7%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITPNG-----GLWWIEVKKPTGRLSHQQMSEIEE 74
              ++L   + +     R G PD +   P           +EVK P  +L   Q+  ++ 
Sbjct: 483 AHLERLFARLLRDVQANRTGLPDLVRFWPGRPPGAERYALVEVKAPGDKLQDNQIRWLDY 542

Query: 75  LRRRGQRVKVL 85
              +G  V+V 
Sbjct: 543 CVAQGIPVQVC 553


>gi|221196431|ref|ZP_03569478.1| VRR-NUC domain protein [Burkholderia multivorans CGD2M]
 gi|221203103|ref|ZP_03576122.1| VRR-NUC domain protein [Burkholderia multivorans CGD2]
 gi|221177037|gb|EEE09465.1| VRR-NUC domain protein [Burkholderia multivorans CGD2]
 gi|221182985|gb|EEE15385.1| VRR-NUC domain protein [Burkholderia multivorans CGD2M]
          Length = 567

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P+      IEVK P  RL   Q   +      G  V+V+ 
Sbjct: 493 IRGNRSGLPDLVRFWPDERRYELIEVKGPGDRLQDNQTRWLAYCIAHGMPVRVVD 547


>gi|221210059|ref|ZP_03583040.1| VRR-NUC domain protein [Burkholderia multivorans CGD1]
 gi|221170747|gb|EEE03213.1| VRR-NUC domain protein [Burkholderia multivorans CGD1]
          Length = 567

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P+      IEVK P  RL   Q   +      G  V+V+ 
Sbjct: 493 IRGNRSGLPDLVRFWPDERRYELIEVKGPGDRLQDNQTRWLAYCIAHGMPVRVVD 547


>gi|75764644|ref|ZP_00744078.1| hypothetical protein RBTH_00450 [Bacillus thuringiensis serovar
          israelensis ATCC 35646]
 gi|228904535|ref|ZP_04068618.1| hypothetical protein bthur0014_56730 [Bacillus thuringiensis IBL
          4222]
 gi|74487866|gb|EAO51648.1| hypothetical protein RBTH_00450 [Bacillus thuringiensis serovar
          israelensis ATCC 35646]
 gi|228855099|gb|EEM99675.1| hypothetical protein bthur0014_56730 [Bacillus thuringiensis IBL
          4222]
          Length = 92

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 31/81 (38%), Gaps = 4/81 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVG---RRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
            E   + +++   K+   W  K        + G PD L     G    IE+K   G  S
Sbjct: 1  MKESQFQAKVIKYLKEKGVWHVKYWAGSQYTKEGIPDILACI-GGMFHGIELKTDVGTPS 59

Query: 66 HQQMSEIEELRRRGQRVKVLV 86
            Q+  I +++  G +  +L 
Sbjct: 60 KLQLYNIRKIKDSGGQAYILR 80


>gi|170690441|ref|ZP_02881608.1| VRR-NUC domain protein [Burkholderia graminis C4D1M]
 gi|170144876|gb|EDT13037.1| VRR-NUC domain protein [Burkholderia graminis C4D1M]
          Length = 595

 Score = 69.4 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 24/59 (40%), Gaps = 1/59 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            + +     R G PD +   P       IEVK P  RL   Q+  +    + G  V+V+
Sbjct: 514 RLLRDVRGNRSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIRWLAYCVQHGMPVRVV 572


>gi|224501852|ref|ZP_03670159.1| hypothetical protein LmonFR_04957 [Listeria monocytogenes FSL
           R2-561]
          Length = 105

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 36/101 (35%), Gaps = 14/101 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E D++  +     +   +V +                   +G PD       +G +++IE
Sbjct: 4   EMDIQNSIRLELSRHGHYVFRANVGKVKLPNGRIFDTGLPKGFPDLFGFRGTDGKMFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK   G+L  +Q +  + +        V  S  E    +EE
Sbjct: 64  VKNEIGKLRQEQKNFQQAMEITPAICGVARSAAEAVRIVEE 104


>gi|330809671|ref|YP_004354133.1| hypothetical protein PSEBR_a2829 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327377779|gb|AEA69129.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 576

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 29/89 (32%), Gaps = 5/89 (5%)

Query: 3   FYSFHYQTEKDVEKRL----VTGAKKLDCWVRKASFVGRRGCPDRLIITPNGG-LWWIEV 57
           F  +   +E  +E+ L        K     +       R G PD +   P       IEV
Sbjct: 454 FVFWGALSEPLLEQALDCLPAAHLKHWFDRLLLDIKANRAGMPDLIQFWPQHKTYRMIEV 513

Query: 58  KKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           K P  RL   Q+  +E        V V  
Sbjct: 514 KGPGDRLQDNQLRWLEFCHEHQMPVAVCY 542


>gi|322806867|emb|CBZ04437.1| hypothetical protein H04402_02630 [Clostridium botulinum H04402
          065]
          Length = 98

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 36/92 (39%), Gaps = 5/92 (5%)

Query: 11 EKDVEKRLVTGAKKL-DCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          EK  E  +     +L   W  K       + G PD +    +G    IEVK P GR S  
Sbjct: 4  EKKFENEIKNFLSELPKTWFYKNWSGPYSKSGIPDIIACV-DGHFVGIEVKAPNGRASEL 62

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          Q   I  ++  G    +L   ++   F +++ 
Sbjct: 63 QKRNIRLIQESGGVGYILY-PKDFLQFKKDMK 93


>gi|319762281|ref|YP_004126218.1| vrr-nuc domain-containing protein [Alicycliphilus denitrificans BC]
 gi|317116842|gb|ADU99330.1| VRR-NUC domain-containing protein [Alicycliphilus denitrificans BC]
          Length = 138

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 3/69 (4%)

Query: 31  KASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEE 90
           +    G  GCPD L    +G    +EVK   GRL  +Q   +  +R  G    V     +
Sbjct: 71  RFIRFGWPGCPDVLGQLKDGRFLGVEVKAQAGRLRPEQALFLARIRAAGGVAFVAR---D 127

Query: 91  VDNFLEELA 99
             + L EL 
Sbjct: 128 CRDVLRELR 136


>gi|254991955|ref|ZP_05274145.1| hypothetical protein LmonocytoFSL_01764 [Listeria monocytogenes FSL
           J2-064]
          Length = 106

 Score = 69.0 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 38/103 (36%), Gaps = 14/103 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E D++  +     K   +V +                   +G PD       +G +++IE
Sbjct: 4   EMDIQNSIRLALAKKGHYVFRANVGKIRMPNGRIFDTGLPKGFPDLFGFRGTDGKMFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           VK   G+L  +Q +  + +        V  S+EE    +E L 
Sbjct: 64  VKNEIGKLRQEQRNFQQAMEITPAICGVARSVEEALKIVEGLK 106


>gi|92113621|ref|YP_573549.1| hypothetical protein Csal_1497 [Chromohalobacter salexigens DSM
           3043]
 gi|91796711|gb|ABE58850.1| conserved hypothetical protein [Chromohalobacter salexigens DSM
           3043]
          Length = 579

 Score = 68.6 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 20/60 (33%), Gaps = 1/60 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            + +     R G PD +   P       IEVK P  RL   Q   +    R    V V  
Sbjct: 515 RLLRDVRANRAGMPDLIQFHPAQQRYRMIEVKGPGDRLQDNQRRWLAFCARHAMPVDVCY 574


>gi|284801590|ref|YP_003413455.1| hypothetical protein LM5578_1343 [Listeria monocytogenes 08-5578]
 gi|284994732|ref|YP_003416500.1| hypothetical protein LM5923_1296 [Listeria monocytogenes 08-5923]
 gi|284057152|gb|ADB68093.1| hypothetical protein LM5578_1343 [Listeria monocytogenes 08-5578]
 gi|284060199|gb|ADB71138.1| hypothetical protein LM5923_1296 [Listeria monocytogenes 08-5923]
          Length = 105

 Score = 68.6 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 35/101 (34%), Gaps = 14/101 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIIT-PNGGLWWIE 56
           E D++  +     +   +V +                   +G PD       +G  ++IE
Sbjct: 4   EMDIQNSIRLELSRHGHYVFRANVGKVKLPNGRIFDTGLPKGFPDLFGFRGSDGKAFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK   G+L  +Q    + ++       V  S  E    +EE
Sbjct: 64  VKNEIGKLRKEQEHFQQAMQITPAICGVARSAAEAVRIVEE 104


>gi|116872633|ref|YP_849414.1| phage-related protein [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116741511|emb|CAK20635.1| conserved phage-related protein [Listeria welshimeri serovar 6b
           str. SLCC5334]
          Length = 108

 Score = 68.6 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 37/102 (36%), Gaps = 14/102 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E D++  +     K   +V +                   +G PD       +G +++IE
Sbjct: 4   EMDIQNSIRLALAKKGHYVFRANVGKIRMPNGRIFDTGLPKGFPDLFGFRGTDGKMFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
           VK   G+L  +Q +  + +        V  S EE    +E L
Sbjct: 64  VKNEIGKLRQEQRNFQQAMEITPALCGVARSAEEALQIVEGL 105


>gi|262372948|ref|ZP_06066227.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262312973|gb|EEY94058.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 141

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 29  VRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
             K   +G + G PD  ++ PNG +   WIE+K   G+L   Q   I+ L  +G   KV 
Sbjct: 66  AAKFKKMGVKAGVPDLQLLVPNGLIHGLWIELKSKAGKLQPSQRLMIQRLEEQGYMCKVC 125

Query: 86  VSMEEVDNFLEELAC 100
              +E    +++  C
Sbjct: 126 FGADEAIQEIKKYLC 140


>gi|300766172|ref|ZP_07076137.1| hypothetical protein LMHG_12707 [Listeria monocytogenes FSL N1-017]
 gi|300513130|gb|EFK40212.1| hypothetical protein LMHG_12707 [Listeria monocytogenes FSL N1-017]
          Length = 105

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 35/101 (34%), Gaps = 14/101 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIIT-PNGGLWWIE 56
           E D++  +     +   +V +                   +G PD       +G  ++IE
Sbjct: 4   EMDIQNSIRLELSRHGHYVFRANVGKVRMPNGRIFDTGLPKGFPDLFGFRGSDGKAFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           VK   G+L  +Q    + ++       V  S  E    +EE
Sbjct: 64  VKNEIGKLRKEQEHFQQAMQITPAICGVARSAAEAVRIVEE 104


>gi|149915042|ref|ZP_01903571.1| hypothetical protein RAZWK3B_16760 [Roseobacter sp. AzwK-3b]
 gi|149915252|ref|ZP_01903780.1| hypothetical protein RAZWK3B_15483 [Roseobacter sp. AzwK-3b]
 gi|149810973|gb|EDM70812.1| hypothetical protein RAZWK3B_15483 [Roseobacter sp. AzwK-3b]
 gi|149811230|gb|EDM71067.1| hypothetical protein RAZWK3B_16760 [Roseobacter sp. AzwK-3b]
          Length = 146

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 36/111 (32%), Gaps = 23/111 (20%)

Query: 11  EKDVEKRLVTGAKK---LDCWVRKASF-------------------VGRRGCPDRLII-T 47
           E  ++  +V   +      C V                            G PD +++  
Sbjct: 8   ESPIQIAIVDYLRSVLPAGCIVHHCRGEINKSGAAFMRELAKAKRKGALPGFPDLIVLPY 67

Query: 48  PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
            N G  + EVK         Q    E LR  G RV V+ S+++V   L E 
Sbjct: 68  ANIGALFFEVKAEGNYADKNQRDMHEALRALGYRVAVVRSIDDVREALAEW 118


>gi|134300454|ref|YP_001113950.1| hypothetical protein Dred_2615 [Desulfotomaculum reducens MI-1]
 gi|134053154|gb|ABO51125.1| conserved hypothetical protein [Desulfotomaculum reducens MI-1]
          Length = 121

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 41/116 (35%), Gaps = 28/116 (24%)

Query: 9   QTEKDVEKRLV-----------------------TGAKKLDCWV-----RKASFVGRRGC 40
             E D++ ++                           K LD  +     R+       G 
Sbjct: 1   MKESDIQNQIRICVSQQGLGILFRANVGEGWTGEKIVKNLDGSITIHNPRRLKTGLPVGF 60

Query: 41  PDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
            D   +T NG   ++EVK  TGRL  +Q + ++ +R+ G    V  S E+ +    
Sbjct: 61  SDLFGVTENGKAVFVEVKSATGRLRQEQENFLKRMRQMGAYAGVARSPEDAERIFR 116


>gi|323499180|ref|ZP_08104158.1| hypothetical protein VISI1226_10972 [Vibrio sinaloensis DSM 21326]
 gi|323315813|gb|EGA68846.1| hypothetical protein VISI1226_10972 [Vibrio sinaloensis DSM 21326]
          Length = 541

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +G   WIEVK P  +L   Q   I++  R      V  
Sbjct: 485 RNGMPDLIAF-KDGQFEWIEVKGPGDKLQDNQWRWIKQFNRLNVPFAVCY 533


>gi|15597062|ref|NP_250556.1| hypothetical protein PA1865 [Pseudomonas aeruginosa PAO1]
 gi|218892178|ref|YP_002441045.1| hypothetical protein PLES_34591 [Pseudomonas aeruginosa LESB58]
 gi|9947854|gb|AAG05254.1|AE004612_8 hypothetical protein PA1865 [Pseudomonas aeruginosa PAO1]
 gi|218772404|emb|CAW28186.1| hypothetical protein PLES_34591 [Pseudomonas aeruginosa LESB58]
          Length = 559

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 1/53 (1%)

Query: 35  VGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             R G PD +   P       +EVK P  RL   Q+  ++  R R   V V  
Sbjct: 500 GNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCY 552


>gi|22296559|ref|NP_680519.1| hypothetical protein A2p40 [Lactobacillus phage A2]
 gi|6599328|emb|CAB63674.1| hypothetical protein [Lactobacillus phage A2]
          Length = 97

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 28/71 (39%), Gaps = 1/71 (1%)

Query: 32  ASFVGRRGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEE 90
                 +G PD       +G L  IEVK   GRL  +Q    E ++R      V  S ++
Sbjct: 27  FIAGPPKGWPDLTGFRHRDGRLILIEVKNEKGRLRPEQKHFAEFIQRFPVIYGVCRSADD 86

Query: 91  VDNFLEELACT 101
               LE   CT
Sbjct: 87  AVKLLEANKCT 97


>gi|296389740|ref|ZP_06879215.1| hypothetical protein PaerPAb_16391 [Pseudomonas aeruginosa PAb1]
          Length = 559

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 1/53 (1%)

Query: 35  VGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             R G PD +   P       +EVK P  RL   Q+  ++  R R   V V  
Sbjct: 500 GNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCY 552


>gi|254240258|ref|ZP_04933580.1| hypothetical protein PA2G_00901 [Pseudomonas aeruginosa 2192]
 gi|126193636|gb|EAZ57699.1| hypothetical protein PA2G_00901 [Pseudomonas aeruginosa 2192]
          Length = 559

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 1/53 (1%)

Query: 35  VGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             R G PD +   P       +EVK P  RL   Q+  ++  R R   V V  
Sbjct: 500 GNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCY 552


>gi|254234960|ref|ZP_04928283.1| hypothetical protein PACG_00836 [Pseudomonas aeruginosa C3719]
 gi|126166891|gb|EAZ52402.1| hypothetical protein PACG_00836 [Pseudomonas aeruginosa C3719]
          Length = 559

 Score = 68.6 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 1/53 (1%)

Query: 35  VGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             R G PD +   P       +EVK P  RL   Q+  ++  R R   V V  
Sbjct: 500 GNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCY 552


>gi|313110570|ref|ZP_07796455.1| hypothetical protein PA39016_002410156 [Pseudomonas aeruginosa
           39016]
 gi|310882957|gb|EFQ41551.1| hypothetical protein PA39016_002410156 [Pseudomonas aeruginosa
           39016]
          Length = 559

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 1/53 (1%)

Query: 35  VGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             R G PD +   P       +EVK P  RL   Q+  ++  R R   V V  
Sbjct: 500 GNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCY 552


>gi|269961106|ref|ZP_06175474.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834057|gb|EEZ88148.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 538

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
           R G PD +    +G   WIEVK P  +L   Q   I+E  R      V     + 
Sbjct: 485 RNGMPDLIAF-KDGKFEWIEVKGPGDKLQDNQWRWIKEFNRLNVPFSVCYVTAQA 538


>gi|170755794|ref|YP_001781761.1| holliday junction resolvase Hjc [Clostridium botulinum B1 str.
          Okra]
 gi|169121006|gb|ACA44842.1| holliday junction resolvase Hjc [Clostridium botulinum B1 str.
          Okra]
          Length = 98

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 5/92 (5%)

Query: 11 EKDVEKRLVTGAKKL-DCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          EK  E  +     +L   W  K       + G PD +    NG L  IEVK P G+ S  
Sbjct: 4  EKKFENEIKKFLSELPKTWFFKYWAGPMSKAGIPDIIACV-NGKLVGIEVKAPNGKPSEL 62

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
          Q   I  ++  G    +L   +++  F +++ 
Sbjct: 63 QKRNIRLIQESGGVGYILY-PKDLSKFKKDMK 93


>gi|238024584|ref|YP_002908816.1| hypothetical protein bglu_2g11950 [Burkholderia glumae BGR1]
 gi|237879249|gb|ACR31581.1| Hypothetical protein bglu_2g11950 [Burkholderia glumae BGR1]
          Length = 569

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 1/52 (1%)

Query: 36  GRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            R G PD +   P       IEVK P  RL   Q+  ++     G  V+V+ 
Sbjct: 494 NRSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVGHGMPVRVID 545


>gi|307725794|ref|YP_003909007.1| VRR-NUC domain-containing protein [Burkholderia sp. CCGE1003]
 gi|307586319|gb|ADN59716.1| VRR-NUC domain-containing protein [Burkholderia sp. CCGE1003]
          Length = 668

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            + +     R G PD +   P       IEVK P  RL   Q+  +    + G  V+VL 
Sbjct: 541 RLLRDVRANRSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIRWLTYCVQHGMPVRVLD 600


>gi|256819730|ref|YP_003141009.1| VRR-NUC domain-containing protein [Capnocytophaga ochracea DSM
           7271]
 gi|256581313|gb|ACU92448.1| VRR-NUC domain protein [Capnocytophaga ochracea DSM 7271]
          Length = 120

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 24/59 (40%)

Query: 38  RGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
            G  D +++ P G   +IE+K    R +  Q    ++    G    V  S EE    +E
Sbjct: 51  AGVADLVVLLPQGKSLYIEMKVKGNRQTDNQKEFQKKAIALGHTYAVCYSFEEFQQVIE 109


>gi|116049818|ref|YP_791375.1| hypothetical protein PA14_40370 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115585039|gb|ABJ11054.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 558

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 1/53 (1%)

Query: 35  VGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             R G PD +   P       +EVK P  RL   Q+  ++  R R   V V  
Sbjct: 499 GNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCY 551


>gi|254933548|ref|ZP_05266907.1| phage protein [Listeria monocytogenes HPB2262]
 gi|293585112|gb|EFF97144.1| phage protein [Listeria monocytogenes HPB2262]
          Length = 104

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 37/100 (37%), Gaps = 14/100 (14%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E D++  +     K   +V +                   +G PD       +G +++IE
Sbjct: 4   EMDIQNSIRLALAKKGHYVFRANVGKIRMPNGRIFDTGLPKGFPDLFGFRGTDGKMFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           VK   G+L  +Q +  + +        V  S+EE    +E
Sbjct: 64  VKNEIGKLRQEQRNFQQAMEITPAICGVARSVEEALKIVE 103


>gi|160901245|ref|YP_001566827.1| VRR-NUC domain-containing protein [Delftia acidovorans SPH-1]
 gi|160366829|gb|ABX38442.1| VRR-NUC domain protein [Delftia acidovorans SPH-1]
          Length = 558

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 14/67 (20%), Positives = 23/67 (34%), Gaps = 1/67 (1%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRR 78
              K     + +     R G PD +   P       +E K P  +L   Q+  ++     
Sbjct: 479 AHLKLFFARLLRDVQANRTGFPDLVRFWPAERRYELVEAKAPGDKLQDNQIRWLQYCAEH 538

Query: 79  GQRVKVL 85
           G  V+V 
Sbjct: 539 GIPVRVC 545


>gi|17488556|ref|NP_511034.1| Gp51 protein [Listeria phage 2389]
 gi|17402461|emb|CAC85609.1| Gp51 protein [Listeria phage PSA]
          Length = 106

 Score = 68.2 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 38/103 (36%), Gaps = 14/103 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWIE 56
           E D++  +     K   +V +                   +G PD       +G +++IE
Sbjct: 4   EMDIQNSIRLALAKKGHYVFRANVGKIRMPNGRIFDTGLPKGFPDLFGFRGTDGKMFFIE 63

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           VK   G+L  +Q +  + +        V  S+EE    +E L 
Sbjct: 64  VKNEIGKLRQEQRNFQQAMEITPAICGVARSVEEALRIVEGLK 106


>gi|260770417|ref|ZP_05879350.1| hypothetical protein VFA_003484 [Vibrio furnissii CIP 102972]
 gi|260615755|gb|EEX40941.1| hypothetical protein VFA_003484 [Vibrio furnissii CIP 102972]
          Length = 538

 Score = 67.8 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD ++   +G   WIEVK P  +L   Q   + +  R      V  
Sbjct: 485 RNGMPDLIVF-KDGQFEWIEVKGPGDKLQDNQWRWMAQFTRLNVPFSVCY 533


>gi|296155907|ref|ZP_06838746.1| VRR-NUC domain protein [Burkholderia sp. Ch1-1]
 gi|295893413|gb|EFG73192.1| VRR-NUC domain protein [Burkholderia sp. Ch1-1]
          Length = 627

 Score = 67.8 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 1/60 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            + +       G PD +   P       IEVK P  RL   Q+  +    + G  V+VL 
Sbjct: 505 RLLRDIRGNCSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIRWLAYCAQHGMPVRVLD 564


>gi|213157759|ref|YP_002320557.1| hypothetical protein AB57_3238 [Acinetobacter baumannii AB0057]
 gi|301346503|ref|ZP_07227244.1| hypothetical protein AbauAB0_09664 [Acinetobacter baumannii AB056]
 gi|301594702|ref|ZP_07239710.1| hypothetical protein AbauAB059_02795 [Acinetobacter baumannii
           AB059]
 gi|213056919|gb|ACJ41821.1| hypothetical protein AB57_3238 [Acinetobacter baumannii AB0057]
          Length = 141

 Score = 67.8 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 40/101 (39%), Gaps = 11/101 (10%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLW--WIEVK 58
           +S Y FH               KKL           + G PD  +I PNG +   WIE+K
Sbjct: 48  LSDYLFHIPNGGSRNILEAAKFKKLGV---------KAGVPDLQLIVPNGEIHGLWIELK 98

Query: 59  KPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
              G+L   Q   I+ L  +G   KV    +E  + +++  
Sbjct: 99  SKKGKLQPSQRLMIQRLEEQGYMCKVCFGADEAIDEIKKYL 139


>gi|315181485|gb|ADT88398.1| VRR-NUC domain family [Vibrio furnissii NCTC 11218]
          Length = 538

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD ++   +G   WIEVK P  +L   Q   + +  R      V  
Sbjct: 485 RNGMPDLIVF-KDGQFEWIEVKGPGDKLQDNQWRWMAQFTRLNVPFSVCY 533


>gi|153833312|ref|ZP_01985979.1| VRR-NUC domain family [Vibrio harveyi HY01]
 gi|148870448|gb|EDL69369.1| VRR-NUC domain family [Vibrio harveyi HY01]
          Length = 538

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +G   WIEVK P  +L   Q   I+E  R      V  
Sbjct: 485 RNGMPDLIAF-KDGKFEWIEVKGPGDKLQDNQWRWIKEFNRLNVPFSVCY 533


>gi|327480718|gb|AEA84028.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 545

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 24/67 (35%), Gaps = 1/67 (1%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRR 78
              K L   +       R G PD + + P       IEVK P  RL   Q   I+   + 
Sbjct: 470 AHLKLLFQRILADVTGNRTGLPDLIQLWPEARRYRMIEVKGPGDRLQDNQKRWIDYAHQH 529

Query: 79  GQRVKVL 85
           G  + V 
Sbjct: 530 GLPIAVC 536


>gi|152982525|ref|YP_001353392.1| hypothetical protein mma_1702 [Janthinobacterium sp. Marseille]
 gi|151282602|gb|ABR91012.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 551

 Score = 67.4 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 22/68 (32%), Gaps = 1/68 (1%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRR 78
              KK    + +     R G PD +   P       +EVK P  RL   Q+  I      
Sbjct: 476 AHLKKYFARILRDIPANRSGLPDLIQFWPQEQRYRMLEVKGPGDRLQDNQIRWINYCIEH 535

Query: 79  GQRVKVLV 86
              V V  
Sbjct: 536 QMPVAVTY 543


>gi|85059144|ref|YP_454846.1| hypothetical protein SG1166 [Sodalis glossinidius str.
          'morsitans']
 gi|84779664|dbj|BAE74441.1| hypothetical phage protein [Sodalis glossinidius str.
          'morsitans']
          Length = 102

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 38 RGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVS 87
           G PDRL++ P G + ++E K P  +    Q  E + LR  G  V VL  
Sbjct: 39 AGVPDRLVVLPGGRVLFVECKAPGQKARPSQRREHDRLRALGGEVIVLDD 88


>gi|146282462|ref|YP_001172615.1| hypothetical protein PST_2108 [Pseudomonas stutzeri A1501]
 gi|145570667|gb|ABP79773.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
          Length = 545

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 24/67 (35%), Gaps = 1/67 (1%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRR 78
              K L   +       R G PD + + P       IEVK P  RL   Q   I+   + 
Sbjct: 470 AHLKLLFQRILADVTGNRTGLPDLIQLWPEARRYRMIEVKGPGDRLQDNQKRWIDYAHQH 529

Query: 79  GQRVKVL 85
           G  + V 
Sbjct: 530 GLPIAVC 536


>gi|317120880|ref|YP_004100883.1| VRR-NUC domain-containing protein [Thermaerobacter marianensis DSM
           12885]
 gi|315590860|gb|ADU50156.1| VRR-NUC domain-containing protein [Thermaerobacter marianensis DSM
           12885]
          Length = 146

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 27/112 (24%), Positives = 39/112 (34%), Gaps = 21/112 (18%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRR---------------GCPDRLIITP---- 48
             TE + ++ +V   +            G R               G PD LI  P    
Sbjct: 28  IPTEDEEQRVVVQWLQLHGILFAHVPNGGYRRRVEAAIFRGLGVQPGVPDLLIFDPPPAA 87

Query: 49  -NGGLWWIEVKK-PTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
            +     +E+K+   GRL+  Q   +E LR RG    V    +E    LE L
Sbjct: 88  PDRRGVALELKRRQGGRLTEPQRQWLEALRARGWYATVCRGADEAIETLERL 139


>gi|260556797|ref|ZP_05829015.1| PmgM [Acinetobacter baumannii ATCC 19606]
 gi|260410056|gb|EEX03356.1| PmgM [Acinetobacter baumannii ATCC 19606]
          Length = 141

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 29  VRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
             K   +G + G PD  +I PNG +   WIE+K   G+L   Q   I+ L  +G   KV 
Sbjct: 66  AAKFKKLGVKAGVPDLQLIVPNGEIHGLWIELKSKKGKLQPSQRLMIQRLEEQGYMCKVC 125

Query: 86  VSMEEVDNFLEELA 99
              +E  + +++  
Sbjct: 126 FGADEAIDEIKKYL 139


>gi|51596137|ref|YP_070328.1| hypothetical protein YPTB1802 [Yersinia pseudotuberculosis IP
           32953]
 gi|51589419|emb|CAH21041.1| hypothetical protein YPTB1802 [Yersinia pseudotuberculosis IP
           32953]
          Length = 152

 Score = 67.4 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 36/94 (38%), Gaps = 11/94 (11%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKPT 61
           Y  H   E     +    AK+L           R+G PD  +  P GG    WIE+K   
Sbjct: 56  YLIHIPNEGKRGPKAARDAKRLGL---------RKGVPDLFLALPRGGYAGLWIEMKSSK 106

Query: 62  GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           G +++ Q   + +L   G +V V  S       +
Sbjct: 107 GHVNNNQNCWLSKLGDIGYKVDVSYSFLSAKGAI 140


>gi|156977313|ref|YP_001448219.1| hypothetical protein VIBHAR_06099 [Vibrio harveyi ATCC BAA-1116]
 gi|156528907|gb|ABU73992.1| hypothetical protein VIBHAR_06099 [Vibrio harveyi ATCC BAA-1116]
          Length = 537

 Score = 67.1 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +G   WIEVK P  +L   Q   I+E  R      V  
Sbjct: 485 RNGMPDLIAF-KDGKFEWIEVKGPGDKLQDNQWRWIKEFNRLNVPFSVCY 533


>gi|227522314|ref|ZP_03952363.1| phage protein [Lactobacillus hilgardii ATCC 8290]
 gi|227090521|gb|EEI25833.1| phage protein [Lactobacillus hilgardii ATCC 8290]
          Length = 116

 Score = 67.1 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 38/99 (38%), Gaps = 13/99 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWV-------RKASFVGR-----RGCPDRLII-TPNGGLWWIE 56
           +E +++  ++    + DC V        K     R     RG PD       +G +  IE
Sbjct: 15  SEHEIQTEILLALSRHDCTVCRSNAGKIKTDDGRRIMLFPRGWPDITGFEHHSGKMILIE 74

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           VK   G+L   Q    + +++      V  S+++    +
Sbjct: 75  VKNERGKLRDDQKRFAKFIKQYPVLYGVCRSVDDALKII 113


>gi|153811361|ref|ZP_01964029.1| hypothetical protein RUMOBE_01753 [Ruminococcus obeum ATCC 29174]
 gi|149832488|gb|EDM87572.1| hypothetical protein RUMOBE_01753 [Ruminococcus obeum ATCC 29174]
          Length = 174

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 30/78 (38%), Gaps = 3/78 (3%)

Query: 24  KLDCWVRKASFVG-RRGCPDRLIITPNGGL--WWIEVKKPTGRLSHQQMSEIEELRRRGQ 80
           +      K   +G + G PD  +  P G     +IE+K   GRL   Q   ++ L   G 
Sbjct: 62  RNKAEAVKLKQMGVKTGIPDLCLPVPMGMYSGLYIEMKYDAGRLEDSQKKMLKALAAAGH 121

Query: 81  RVKVLVSMEEVDNFLEEL 98
              V    EE    L+E 
Sbjct: 122 YCTVCYGAEEAIRVLQEY 139


>gi|170698650|ref|ZP_02889717.1| VRR-NUC domain protein [Burkholderia ambifaria IOP40-10]
 gi|170136429|gb|EDT04690.1| VRR-NUC domain protein [Burkholderia ambifaria IOP40-10]
          Length = 564

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q   +      G  V+V+ 
Sbjct: 492 IRSNRSGLPDLVRFWPGERRYELIEVKGPGDRLQDNQTRWLAYCVAHGIPVRVVD 546


>gi|172063296|ref|YP_001810947.1| VRR-NUC domain-containing protein [Burkholderia ambifaria MC40-6]
 gi|171995813|gb|ACB66731.1| VRR-NUC domain protein [Burkholderia ambifaria MC40-6]
          Length = 576

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q   +      G  V+V+ 
Sbjct: 504 IRSNRSGLPDLVRFWPGERRYELIEVKGPGDRLQDNQTRWLAYCVAHGIPVRVVD 558


>gi|85059136|ref|YP_454838.1| hypothetical protein SG1158 [Sodalis glossinidius str.
          'morsitans']
 gi|84779656|dbj|BAE74433.1| hypothetical phage protein [Sodalis glossinidius str.
          'morsitans']
          Length = 95

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 38 RGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVS 87
           G PDRL++ P G + ++E K P  +    Q  E + LR  G  V VL  
Sbjct: 39 AGVPDRLVVLPGGRVLFVECKAPGQKARPSQRREHDRLRALGGEVIVLDD 88


>gi|115358550|ref|YP_775688.1| hypothetical protein Bamb_3800 [Burkholderia ambifaria AMMD]
 gi|115283838|gb|ABI89354.1| conserved hypothetical protein [Burkholderia ambifaria AMMD]
          Length = 564

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q   +      G  V+V+ 
Sbjct: 492 IRSNRSGLPDLVRFWPGERRYELIEVKGPGDRLQDNQTRWLAYCVAHGIPVRVVD 546


>gi|134293602|ref|YP_001117338.1| hypothetical protein Bcep1808_4916 [Burkholderia vietnamiensis G4]
 gi|134136759|gb|ABO57873.1| conserved hypothetical protein [Burkholderia vietnamiensis G4]
          Length = 565

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q   +      G  V+V+ 
Sbjct: 493 IRSNRSGLPDLVRFWPGERRYELIEVKGPGDRLQDNQTRWLAYCVAHGIPVRVVD 547


>gi|187478304|ref|YP_786328.1| hypothetical protein BAV1810 [Bordetella avium 197N]
 gi|115422890|emb|CAJ49418.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 537

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD +   P       IEVK P  RL   Q++ +    + G   +V 
Sbjct: 480 NRSGLPDLIRFWPAERRYELIEVKGPGDRLQDNQIAWLRYCAQHGIAARVC 530


>gi|168178707|ref|ZP_02613371.1| VRR-NUC domain superfamily [Clostridium botulinum NCTC 2916]
 gi|182671133|gb|EDT83107.1| VRR-NUC domain superfamily [Clostridium botulinum NCTC 2916]
          Length = 98

 Score = 67.1 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 35/91 (38%), Gaps = 5/91 (5%)

Query: 11 EKDVEKRLVTGAKKL-DCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
          EK  E  +      L   W  K       + G PD +    +G    IEVK P G+ S  
Sbjct: 4  EKKFENEIKKFLSDLPHTWFFKYWAGPYSKSGIPDIIACV-DGHFVGIEVKAPNGKPSEL 62

Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
          Q   +  ++       +L   ++ + F +++
Sbjct: 63 QKRNVRLIQECRGLGYILY-PKDFEQFKKDM 92


>gi|264678354|ref|YP_003278261.1| hypothetical protein CtCNB1_2219 [Comamonas testosteroni CNB-2]
 gi|262208867|gb|ACY32965.1| conserved hypothetical protein [Comamonas testosteroni CNB-2]
          Length = 580

 Score = 67.1 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 25/71 (35%), Gaps = 5/71 (7%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITP-----NGGLWWIEVKKPTGRLSHQQMSEIEE 74
              + L   +       R G PD +   P           +EVK P  +L   Q+  +  
Sbjct: 499 AHLRTLFARLLLDLKANRTGFPDLVRFWPLRSDTGSRYELVEVKAPGDKLQDNQIRWLAY 558

Query: 75  LRRRGQRVKVL 85
            + +G  V+V 
Sbjct: 559 CKDQGIPVRVC 569


>gi|167572649|ref|ZP_02365523.1| hypothetical protein BoklC_22628 [Burkholderia oklahomensis C6786]
          Length = 566

 Score = 67.1 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P+      IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 495 VRGNRSGLPDLVRFWPDARRYELIEVKGPGDRLQDNQIRWLDYCMRHRMPVRVLD 549


>gi|27366621|ref|NP_762148.1| hypothetical protein VV2_0165 [Vibrio vulnificus CMCP6]
 gi|27358187|gb|AAO07138.1| hypothetical protein VV2_0165 [Vibrio vulnificus CMCP6]
          Length = 542

 Score = 66.7 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 21/57 (36%), Gaps = 1/57 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN 93
           R G PD +    +G   WIEVK P  +L   Q   I   ++      V     +   
Sbjct: 485 RNGMPDLIAF-KDGEYQWIEVKGPGDKLQDNQWRWIHHFKQLAIPFAVCYVEHQAGE 540


>gi|77458914|ref|YP_348420.1| hypothetical protein Pfl01_2689 [Pseudomonas fluorescens Pf0-1]
 gi|77382917|gb|ABA74430.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 550

 Score = 66.7 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 29/89 (32%), Gaps = 5/89 (5%)

Query: 3   FYSFHYQTEKDVEKRLV----TGAKKLDCWVRKASFVGRRGCPDRLIITPNGG-LWWIEV 57
           F  +    E+ +E+ L        K     +       R G PD +   P       IEV
Sbjct: 454 FVFWGALNEELLEQALACLPAEHLKHWFSRLLLDIKANRAGMPDLIQFWPQHKTYRMIEV 513

Query: 58  KKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           K P  RL   Q+  +E        + V  
Sbjct: 514 KGPGDRLQDNQLRWLEFCHTHRMPIAVCY 542


>gi|163801611|ref|ZP_02195509.1| hypothetical protein 1103602000597_AND4_09162 [Vibrio sp. AND4]
 gi|159174528|gb|EDP59330.1| hypothetical protein AND4_09162 [Vibrio sp. AND4]
          Length = 538

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +G   WIEVK P  +L   Q   I+E  R      V  
Sbjct: 485 RNGMPDLIAF-KDGEFEWIEVKGPGDKLQDNQWRWIKEFNRLNVPFSVCY 533


>gi|153815133|ref|ZP_01967801.1| hypothetical protein RUMTOR_01358 [Ruminococcus torques ATCC 27756]
 gi|331089503|ref|ZP_08338402.1| hypothetical protein HMPREF1025_01985 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145847701|gb|EDK24619.1| hypothetical protein RUMTOR_01358 [Ruminococcus torques ATCC 27756]
 gi|330404871|gb|EGG84409.1| hypothetical protein HMPREF1025_01985 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 96

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/96 (18%), Positives = 34/96 (35%), Gaps = 6/96 (6%)

Query: 9   QTEKDVEKRLVTGAKKL--DCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP-TGRLS 65
             E + + +L+   K++   C V K      +G PD LI+  +     +E KK    +  
Sbjct: 1   MLESEFQNKLIQELKRMFKGCIVTKLDASHIQGIPDLLILYND-KWATLECKKSVRAKKQ 59

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
             Q   +  +        +    E  +  L +L   
Sbjct: 60  PNQEYYVGRMNEMSFSRFIC--PENKEEVLYDLQQA 93


>gi|283796844|ref|ZP_06345997.1| VRR-NUC domain protein [Clostridium sp. M62/1]
 gi|291075251|gb|EFE12615.1| VRR-NUC domain protein [Clostridium sp. M62/1]
          Length = 161

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 6/98 (6%)

Query: 3   FYSFHYQTEKDVEKRLVTGAK--KLDCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVK 58
           F       E   +K+++   K    +    K +     R+G PD +    NG  +  EVK
Sbjct: 58  FIREKMPKESYFQKKILDWIKDNAPNAIAWKEAAGPYSRQGIPD-ITCIINGRYYGFEVK 116

Query: 59  KP-TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           +P  G LS  Q   I+++RR G R  V+ S +EV   L
Sbjct: 117 RPFIGVLSKIQEQTIKQIRRAGGRAWVVTSEKEVAEIL 154


>gi|325522641|gb|EGD01166.1| hypothetical protein B1M_27926 [Burkholderia sp. TJI49]
          Length = 211

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q   +      G  V+V+ 
Sbjct: 139 IRSNRSGLPDLVRFWPGERRYELIEVKGPGDRLQDNQTRWLAYCVAHGMPVRVVD 193


>gi|328477412|gb|EGF47539.1| hypothetical protein AAULR_24141 [Lactobacillus rhamnosus MTCC
          5462]
          Length = 98

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 35/96 (36%), Gaps = 14/96 (14%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITP-NGGLWWI 55
          +E +++  ++    +  C + +                   +G PD       +G L  I
Sbjct: 3  SEHEIQSEIMLALSRAGCTIIRTNVGKVRTETGRIFVAGPPKGWPDLTGFRHHDGRLILI 62

Query: 56 EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
          EVK  TGRL   Q    E +++      V  S E+ 
Sbjct: 63 EVKNETGRLRQDQKHFAEFIKQFPVIYGVARSAEDA 98


>gi|255505711|ref|ZP_05347722.3| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
 gi|255266240|gb|EET59445.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
          Length = 121

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 39/108 (36%), Gaps = 14/108 (12%)

Query: 3   FYSFHY--------QTEKDVEKRLVTGAKKL--DCWVRKASFVGRRGCPDRLIITPNGGL 52
           F+  HY          E   + RL+   K L   C V K+     +G PD LI+      
Sbjct: 12  FFYRHYRLLEEVRNMLESKFQSRLIKDVKSLFPGCIVTKSDCNYIQGIPDLLILY-GSKW 70

Query: 53  WWIEVKKP-TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
             +E K+    +    Q   ++ +        +    E  +  LEEL+
Sbjct: 71  ATLECKQSLRAKKQPNQSYYVDRMNEMSFSRFIC--PENKEQVLEELS 116


>gi|167565543|ref|ZP_02358459.1| hypothetical protein BoklE_23509 [Burkholderia oklahomensis EO147]
          Length = 271

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P+      IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 200 VCGNRSGLPDLVRFWPDARRYELIEVKGPGDRLQDNQIRWLDYCMRHRMPVRVLD 254


>gi|229119307|ref|ZP_04248610.1| hypothetical protein bcere0017_55420 [Bacillus cereus Rock1-3]
 gi|228664173|gb|EEL19711.1| hypothetical protein bcere0017_55420 [Bacillus cereus Rock1-3]
          Length = 93

 Score = 66.7 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 32/81 (39%), Gaps = 4/81 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVG---RRGCPDRLIITPNGGLWWIEVKKPTGRLS 65
            E   +K+++   K+ D W  K        + G PD L    +     IE+K   G  S
Sbjct: 1  MRESAFQKQVIKFLKEQDVWHIKYWAGSQYTKEGIPDILACI-DSVFHGIELKTDVGVPS 59

Query: 66 HQQMSEIEELRRRGQRVKVLV 86
            Q+  I +++  G    +L 
Sbjct: 60 KLQLYNIRKIKDSGGEAYILR 80


>gi|37676334|ref|NP_936730.1| hypothetical protein VVA0674 [Vibrio vulnificus YJ016]
 gi|37200876|dbj|BAC96700.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 542

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 21/57 (36%), Gaps = 1/57 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN 93
           R G PD +    +G   WIEVK P  +L   Q   I   ++      V     +   
Sbjct: 485 RNGMPDLIAF-KDGEYQWIEVKGPGDKLQDNQWRWIHHFKQLAIPFAVCYVEHQAAE 540


>gi|317407000|gb|EFV87036.1| hypothetical protein HMPREF0005_05864 [Achromobacter xylosoxidans
           C54]
          Length = 210

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 30/88 (34%), Gaps = 5/88 (5%)

Query: 3   FYSFHYQTEKDVEKRL----VTGAKKLDCWVRKASFVGRRGCPDRLIITPNG-GLWWIEV 57
           F  +    E  +++ L        K     + +     R G PD +       G   IE+
Sbjct: 114 FVFWGALDESLLQRALDHFPPAHLKLFFTRLLRDVKANRSGLPDLIRFQAQAPGYELIEI 173

Query: 58  KKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           K P  +L   Q+  +      G  V+V 
Sbjct: 174 KGPGDKLQDNQIRWLAYCAEHGMPVRVC 201


>gi|312960974|ref|ZP_07775479.1| hypothetical protein PFWH6_2886 [Pseudomonas fluorescens WH6]
 gi|311284632|gb|EFQ63208.1| hypothetical protein PFWH6_2886 [Pseudomonas fluorescens WH6]
          Length = 549

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 35/89 (39%), Gaps = 5/89 (5%)

Query: 3   FYSFHYQTEKDVEKRL-VTGAKKLDCWVRKA---SFVGRRGCPDRLIITP-NGGLWWIEV 57
           F  ++  +E+ +E+ L    A  L CW  +        R G PD +   P       IEV
Sbjct: 453 FVFWNLLSEELLEQALECLPAAHLRCWFERLLLDIRANRAGMPDLIQFWPAQKTYRMIEV 512

Query: 58  KKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           K P  RL   Q+  +E   +    V V  
Sbjct: 513 KGPGDRLQDNQLRWLEFCAQYQMPVTVCY 541


>gi|78062481|ref|YP_372389.1| hypothetical protein Bcep18194_B1631 [Burkholderia sp. 383]
 gi|77970366|gb|ABB11745.1| hypothetical protein Bcep18194_B1631 [Burkholderia sp. 383]
          Length = 564

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       +EVK P  RL   Q   +      G  V+V+ 
Sbjct: 492 IRSNRSGLPDLVRFWPGERRYELVEVKGPGDRLQDNQTRWLAYCVAHGIPVRVID 546


>gi|310828795|ref|YP_003961152.1| VRR-NUC domain protein [Eubacterium limosum KIST612]
 gi|308740529|gb|ADO38189.1| VRR-NUC domain protein [Eubacterium limosum KIST612]
          Length = 183

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 35/93 (37%), Gaps = 5/93 (5%)

Query: 9  QTEK-DVEKRLVTGAKKL-DCWVRKASFVGR--RGCPDRLIITPNGGLWWIEVKKPTGRL 64
            EK DV  ++    K   D ++RK        +G PD       G     E K   GR 
Sbjct: 1  MNEKRDVSDKIEAYCKAHPDYFIRKIHCGAYQGKGLPDLWGCYK-GMFICCEAKTDKGRP 59

Query: 65 SHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
          S  Q   I+ +   G    +  S+E+    +E+
Sbjct: 60 SKLQEHYIKLINAAGGCAFIARSLEDFIQAVEK 92


>gi|253583964|ref|ZP_04861162.1| predicted protein [Fusobacterium varium ATCC 27725]
 gi|251834536|gb|EES63099.1| predicted protein [Fusobacterium varium ATCC 27725]
          Length = 110

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 44/110 (40%), Gaps = 21/110 (19%)

Query: 9   QTEKDVEKRLVTGA---KKLDCWVRK-----------------ASFVGRRGCPDRLIITP 48
             E D++ +++      +K      +                  +   ++G PD L++  
Sbjct: 1   MKESDIQSQIINYLQILEKQGKLFFQRINNTAIYDPVGKRWRSLAKGTKKGFPDILVL-K 59

Query: 49  NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
           +     +EVK   G+ S +Q      ++  G    V+ S+EEV N +E++
Sbjct: 60  DSKCIGLEVKTSKGKQSKEQEEMEILMKEHGAAYYVVRSLEEVINIVEKI 109


>gi|241767365|ref|ZP_04765078.1| VRR-NUC domain protein [Acidovorax delafieldii 2AN]
 gi|241361901|gb|EER58119.1| VRR-NUC domain protein [Acidovorax delafieldii 2AN]
          Length = 228

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/67 (20%), Positives = 22/67 (32%), Gaps = 1/67 (1%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRR 78
              K     + +     R G PD +   P       +EVK P  +L   Q+  ++     
Sbjct: 147 AHLKLFFARLLRDVQANRTGLPDLVRFWPAERRYALVEVKGPGDQLQDNQIRWLQYCAAH 206

Query: 79  GQRVKVL 85
           G    V 
Sbjct: 207 GIPASVC 213


>gi|238749559|ref|ZP_04611064.1| hypothetical protein yrohd0001_28770 [Yersinia rohdei ATCC 43380]
 gi|238712214|gb|EEQ04427.1| hypothetical protein yrohd0001_28770 [Yersinia rohdei ATCC 43380]
          Length = 178

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 35/98 (35%), Gaps = 12/98 (12%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKPT 61
           Y  H   E     +    AK L           R+G PD  +  P GG    WIE+K   
Sbjct: 56  YLIHIPNEGKHGPKAARDAKWLGL---------RKGVPDLFLALPRGGYAGLWIEMKTLN 106

Query: 62  GRLSHQQMSEIEELRRRGQRVKVLVS-MEEVDNFLEEL 98
           G+ +  Q   + ++   G    +  S +E      E +
Sbjct: 107 GKPTPDQNHWLNKMNEIGYLATIKFSCVETAKTITEYI 144


>gi|107101298|ref|ZP_01365216.1| hypothetical protein PaerPA_01002332 [Pseudomonas aeruginosa PACS2]
          Length = 559

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 20/53 (37%), Gaps = 1/53 (1%)

Query: 35  VGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             R G PD +   P       +EVK P  RL   Q+  ++    R   V V  
Sbjct: 500 GNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCCEREMPVAVCY 552


>gi|58261706|ref|XP_568263.1| hypothetical protein CNM02280 [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134118563|ref|XP_772055.1| hypothetical protein CNBM2120 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50254661|gb|EAL17408.1| hypothetical protein CNBM2120 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57230436|gb|AAW46746.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 988

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 4/68 (5%)

Query: 23  KKLDCWVRKASFVGR---RGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRR 78
           K L    R  +   R    G PD ++  P      ++EVK P   LS  Q   I+ L   
Sbjct: 829 KALSGVCRMLAEEYRHRASGVPDLIVWNPQTKDARFVEVKGPGDSLSETQKIWIDVLLSS 888

Query: 79  GQRVKVLV 86
           G +V+V  
Sbjct: 889 GIQVEVCR 896


>gi|21283135|ref|NP_646223.1| hypothetical protein MW1406 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|21204575|dbj|BAB95271.1| hypothetical protein [Staphylococcus aureus subsp. aureus MW2]
          Length = 65

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 34/62 (54%)

Query: 40  CPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
            PDR+II P G  +++E+K+  G+L   Q     +   R  +V VL + E+V+ F+  + 
Sbjct: 1   MPDRIIIMPEGKTYFVEMKQEKGKLHPLQKYVHRQFENRDHKVYVLWNKEQVNTFIRMVG 60

Query: 100 CT 101
            T
Sbjct: 61  GT 62


>gi|149410836|ref|XP_001509834.1| PREDICTED: similar to KIAA1018 protein [Ornithorhynchus anatinus]
          Length = 1036

 Score = 65.9 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 25   LDCWVRKASFVGRR---GCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQ 80
            L    RK     R    G PD ++    +     +EVK P  RLSH+QM  ++EL++ G 
Sbjct: 959  LSGVCRKLVTDLRHCRGGLPDLVVWNTQDKRFKLVEVKGPNDRLSHKQMIWLDELQKLGA 1018

Query: 81   RVKVL 85
             V+V 
Sbjct: 1019 EVEVC 1023


>gi|227431772|ref|ZP_03913799.1| phage protein [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
 gi|227352455|gb|EEJ42654.1| phage protein [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
          Length = 114

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/103 (15%), Positives = 36/103 (34%), Gaps = 14/103 (13%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKASF---------VGRRGCP----DRLIITP-NGGLWW 54
             E+ ++        K      + +            R G P    D +     +  +++
Sbjct: 1   MREQQIQNEARIALSKDGHTQFRINTGTVITRDGRPFRSGTPKGFFDLVGYRRQDKQIFF 60

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           I++K  TGR+   Q+    +L++      +  S E+    + E
Sbjct: 61  IDMKTKTGRIRDDQIKFSIKLKKDNVIHGIARSPEDALKIVNE 103


>gi|221067223|ref|ZP_03543328.1| VRR-NUC domain protein [Comamonas testosteroni KF-1]
 gi|220712246|gb|EED67614.1| VRR-NUC domain protein [Comamonas testosteroni KF-1]
          Length = 586

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 5/55 (9%)

Query: 36  GRRGCPDRLIITP-----NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD +   P           +EVK P  +L   Q+  +     +G  V+V 
Sbjct: 521 NRTGFPDLVRFWPLRSDAGSRYELVEVKAPGDKLQDNQIRWLAYCSEQGIPVRVC 575


>gi|301321600|gb|ADK68990.1| hypothetical protein KTR9_4909 [Gordonia sp. KTR9]
          Length = 139

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 4/73 (5%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGG----LWWIEVKKPTGRLSH 66
          E+ VE  LV   ++ D    K +   RR   DRL+I  +      + ++E+K+P      
Sbjct: 2  ERIVENHLVASCQRHDLLCLKVTSPARRAITDRLVIGHDDRSDPVVLFLELKRPGTVPRA 61

Query: 67 QQMSEIEELRRRG 79
           Q +    +R  G
Sbjct: 62 SQKAMFARMRVHG 74


>gi|54303111|ref|YP_133104.1| hypothetical protein PBPRB1438 [Photobacterium profundum SS9]
 gi|46916539|emb|CAG23304.1| hypothetical protein PBPRB1438 [Photobacterium profundum SS9]
          Length = 120

 Score = 65.5 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 41/103 (39%), Gaps = 14/103 (13%)

Query: 9   QTEKDVEKRLVTGAKKLDCW-------VRKASFVGR-------RGCPDRLIITPNGGLWW 54
            TE  +   ++  A    C        V       R       +G  D +  T NG    
Sbjct: 1   MTESQILTDIIRAAFSHPCVGVLLRNNVGAVKSGSRWIRYGLGKGSSDLIGWTTNGIFLA 60

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           +EVK   G++S +Q+  IE++R+ G    +  S +E D  + E
Sbjct: 61  VEVKTLNGKVSPEQIKFIEDVRKHGGIAFIATSRDEFDRLMTE 103


>gi|229590595|ref|YP_002872714.1| hypothetical protein PFLU3139 [Pseudomonas fluorescens SBW25]
 gi|229362461|emb|CAY49367.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 548

 Score = 65.5 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 19/55 (34%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  +E        V V  
Sbjct: 487 IRANRAGMPDLIQFWPAQKTYRMIEVKGPGDRLQDNQLRWLEFCGEYQMPVTVCY 541


>gi|89075882|ref|ZP_01162261.1| hypothetical protein SKA34_07458 [Photobacterium sp. SKA34]
 gi|89048411|gb|EAR53988.1| hypothetical protein SKA34_07458 [Photobacterium sp. SKA34]
          Length = 552

 Score = 65.5 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 23/59 (38%), Gaps = 1/59 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            + K     R G PD ++    G   W+EVK P  +L   Q+  +    + G    V  
Sbjct: 486 RLLKDLRHHRSGMPDLIMFNNTG-YQWVEVKGPGDKLQDHQLRWLAFFDQHGIPAHVAY 543


>gi|167578183|ref|ZP_02371057.1| Uvs005 [Burkholderia thailandensis TXDOH]
          Length = 566

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+V+ 
Sbjct: 494 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVID 548


>gi|83716242|ref|YP_439746.1| Uvs005 [Burkholderia thailandensis E264]
 gi|257142884|ref|ZP_05591146.1| Uvs005 [Burkholderia thailandensis E264]
 gi|83650067|gb|ABC34131.1| Uvs005 [Burkholderia thailandensis E264]
          Length = 566

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+V+ 
Sbjct: 494 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVID 548


>gi|299532194|ref|ZP_07045588.1| hypothetical protein CTS44_15393 [Comamonas testosteroni S44]
 gi|298719856|gb|EFI60819.1| hypothetical protein CTS44_15393 [Comamonas testosteroni S44]
          Length = 580

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 5/55 (9%)

Query: 36  GRRGCPDRLIITP-----NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD +   P           +EVK P  +L   Q+  +     +G  V V 
Sbjct: 515 NRTGFPDLVRFWPLRSDAGSRYELVEVKAPGDKLQDNQIRWLAYCTEQGIPVSVC 569


>gi|167616316|ref|ZP_02384951.1| Uvs005 [Burkholderia thailandensis Bt4]
          Length = 230

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+V+ 
Sbjct: 158 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVID 212


>gi|120552958|ref|YP_957309.1| hypothetical protein Maqu_0014 [Marinobacter aquaeolei VT8]
 gi|120322807|gb|ABM17122.1| conserved hypothetical protein [Marinobacter aquaeolei VT8]
          Length = 566

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 5/55 (9%)

Query: 37  RRGCPDRLII-----TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD + +      P      IEVK P  RL   Q+  ++   R+G    V  
Sbjct: 502 RSGFPDLIRLVPEADHPEQRYEMIEVKGPGDRLQDHQVRWLQFFARQGIPASVCY 556


>gi|254507913|ref|ZP_05120042.1| VRR-NUC domain family protein [Vibrio parahaemolyticus 16]
 gi|219549149|gb|EED26145.1| VRR-NUC domain family protein [Vibrio parahaemolyticus 16]
          Length = 536

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +G   WIEVK P  +L   Q    +E  R      V  
Sbjct: 485 RSGMPDLIAF-KDGTFEWIEVKGPGDKLQDNQWRWFKEFERLDVPFSVCY 533


>gi|296089618|emb|CBI39437.3| unnamed protein product [Vitis vinifera]
          Length = 951

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 32/95 (33%), Gaps = 18/95 (18%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDC-----WVRKASFVGRR---GCPDRLIIT----PNGG 51
           +  H  +E      L      +         R  +   R    G PD L+        G 
Sbjct: 857 WDRHSLSE------LRAAVTCIGGPCLASICRHLAQDYRSWSSGMPDLLLWRFHEDYKGE 910

Query: 52  LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
              +EVK P  RLS QQ + +  L   G  V+V  
Sbjct: 911 AKLVEVKGPRDRLSEQQRAWLLLLMDYGFNVEVCK 945


>gi|225433682|ref|XP_002265776.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 955

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 32/95 (33%), Gaps = 18/95 (18%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDC-----WVRKASFVGRR---GCPDRLIIT----PNGG 51
           +  H  +E      L      +         R  +   R    G PD L+        G 
Sbjct: 861 WDRHSLSE------LRAAVTCIGGPCLASICRHLAQDYRSWSSGMPDLLLWRFHEDYKGE 914

Query: 52  LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
              +EVK P  RLS QQ + +  L   G  V+V  
Sbjct: 915 AKLVEVKGPRDRLSEQQRAWLLLLMDYGFNVEVCK 949


>gi|321265299|ref|XP_003197366.1| hypothetical protein CGB_M3340W [Cryptococcus gattii WM276]
 gi|317463845|gb|ADV25579.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 976

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 4/68 (5%)

Query: 23  KKLDCWVRKASFVGR---RGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRR 78
           K L    R  +   R    G PD ++  P      ++EVK P   LS  Q   I+ L   
Sbjct: 820 KTLSGVCRMLAEEYRHRASGVPDLIVWNPETKDARFVEVKGPGDSLSETQKIWIDVLLST 879

Query: 79  GQRVKVLV 86
           G +V+V  
Sbjct: 880 GIQVEVCR 887


>gi|37222094|gb|AAP76490.1| Uvs005 [uncultured bacterium]
          Length = 555

 Score = 64.7 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 19/55 (34%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  +E        + V  
Sbjct: 493 IKANRAGMPDLIQFWPLQKTYRMIEVKGPGDRLQDNQLRWLEFCHEHQMPIAVCY 547


>gi|331701891|ref|YP_004398850.1| VRR-NUC domain-containing protein [Lactobacillus buchneri NRRL
           B-30929]
 gi|329129234|gb|AEB73787.1| VRR-NUC domain-containing protein [Lactobacillus buchneri NRRL
           B-30929]
          Length = 104

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 38/99 (38%), Gaps = 13/99 (13%)

Query: 10  TEKDVEKRLVTGAKKLDCWV-------RKASFVGR-----RGCPDRLII-TPNGGLWWIE 56
           +E +++  ++    + DC V        K     R     RG PD       +G +  IE
Sbjct: 3   SEHEIQTEILLALSRHDCTVCRSNAGKIKTDDGRRIMLFPRGWPDITGFEHHSGKMILIE 62

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           VK   G+L   Q    + +++      V  S+++    +
Sbjct: 63  VKNERGKLRDDQKRFAQFIKQYPVLYGVARSVDDALKII 101


>gi|320158509|ref|YP_004190887.1| hypothetical protein VVM_01371 [Vibrio vulnificus MO6-24/O]
 gi|319933821|gb|ADV88684.1| hypothetical protein restriction endonuclease-like VRR-NUC domain
           [Vibrio vulnificus MO6-24/O]
          Length = 542

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 21/57 (36%), Gaps = 1/57 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN 93
           R G PD +    +G   WIEVK P  +L   Q   I   ++      V     +   
Sbjct: 485 RNGMPDLIAFR-DGEYQWIEVKGPGDKLQGNQWRWIHHFKQLAIPFAVCYVEHQAAE 540


>gi|226197546|ref|ZP_03793121.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|225930155|gb|EEH26167.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
          Length = 564

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|217419185|ref|ZP_03450692.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|217398489|gb|EEC38504.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
          Length = 561

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 489 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 543


>gi|167906128|ref|ZP_02493333.1| hypothetical protein BpseN_28098 [Burkholderia pseudomallei NCTC
           13177]
          Length = 564

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|167819340|ref|ZP_02451020.1| hypothetical protein Bpse9_29685 [Burkholderia pseudomallei 91]
          Length = 564

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|134279407|ref|ZP_01766120.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|134249826|gb|EBA49907.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
          Length = 564

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|254183306|ref|ZP_04889898.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|184213839|gb|EDU10882.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
          Length = 564

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|53721882|ref|YP_110867.1| hypothetical protein BPSS0855 [Burkholderia pseudomallei K96243]
 gi|167897783|ref|ZP_02485185.1| hypothetical protein Bpse7_28864 [Burkholderia pseudomallei 7894]
 gi|167922349|ref|ZP_02509440.1| hypothetical protein BpseBC_27600 [Burkholderia pseudomallei
           BCC215]
 gi|254300208|ref|ZP_04967654.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|52212296|emb|CAH38318.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
 gi|157810041|gb|EDO87211.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
          Length = 564

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|254189939|ref|ZP_04896448.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|157937616|gb|EDO93286.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
          Length = 564

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|126442758|ref|YP_001062256.1| hypothetical protein BURPS668_A1259 [Burkholderia pseudomallei 668]
 gi|126222249|gb|ABN85754.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
          Length = 564

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|76818493|ref|YP_337603.1| Uvs005 [Burkholderia pseudomallei 1710b]
 gi|254263995|ref|ZP_04954860.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|76582966|gb|ABA52440.1| Uvs005 [Burkholderia pseudomallei 1710b]
 gi|254214997|gb|EET04382.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 564

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|167584470|ref|ZP_02376858.1| hypothetical protein BuboB_03986 [Burkholderia ubonensis Bu]
          Length = 224

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 25/70 (35%), Gaps = 2/70 (2%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
               R G PD +   P       IEVK P  RL   Q   +      G  V+V+  +E  
Sbjct: 152 IRSNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQTRWLGFCIGHGMPVRVVD-VEWA 210

Query: 92  DNFLEELACT 101
            + +   A  
Sbjct: 211 GDVVAPTAAA 220


>gi|260576810|ref|ZP_05844794.1| VRR-NUC domain protein [Rhodobacter sp. SW2]
 gi|259020953|gb|EEW24265.1| VRR-NUC domain protein [Rhodobacter sp. SW2]
          Length = 130

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
             G  D ++I  +G + ++E+K P GRL   Q +  + +  +G    ++ S+++    L 
Sbjct: 56  HAGFADLMVIC-DGRILFLELKSPKGRLRPDQEAFRDGVLAQGFGWALVRSLDDALGALA 114

Query: 97  ELACT 101
           +   T
Sbjct: 115 DHGFT 119


>gi|28900555|ref|NP_800210.1| hypothetical protein VPA0700 [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365436|ref|ZP_05777973.1| VRR-NUC domain protein [Vibrio parahaemolyticus K5030]
 gi|260877501|ref|ZP_05889856.1| VRR-NUC domain protein [Vibrio parahaemolyticus AN-5034]
 gi|260894827|ref|ZP_05903323.1| VRR-NUC domain protein [Vibrio parahaemolyticus Peru-466]
 gi|28808935|dbj|BAC62043.1| hypothetical protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085312|gb|EFO35007.1| VRR-NUC domain protein [Vibrio parahaemolyticus Peru-466]
 gi|308090762|gb|EFO40457.1| VRR-NUC domain protein [Vibrio parahaemolyticus AN-5034]
 gi|308114334|gb|EFO51874.1| VRR-NUC domain protein [Vibrio parahaemolyticus K5030]
          Length = 545

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +    WIEVK P  +L   Q   I+E  R      V  
Sbjct: 485 RNGMPDLIAFR-DNEFEWIEVKGPGDKLQDNQWRWIKEFSRLNVPFAVCY 533


>gi|237508103|ref|ZP_04520818.1| VRR-NUC domain protein [Burkholderia pseudomallei MSHR346]
 gi|235000308|gb|EEP49732.1| VRR-NUC domain protein [Burkholderia pseudomallei MSHR346]
          Length = 564

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|327284500|ref|XP_003226975.1| PREDICTED: fanconi-associated nuclease 1-like [Anolis carolinensis]
          Length = 1126

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 36   GRRGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
             R G PD ++    +G    +EVK P  RLSH+QM  + EL+  G  V+V 
Sbjct: 1063 SRGGLPDLVVWRTEDGQYKVVEVKGPNDRLSHKQMLWLAELQELGAAVEVC 1113


>gi|260901759|ref|ZP_05910154.1| VRR-NUC domain protein [Vibrio parahaemolyticus AQ4037]
 gi|308108839|gb|EFO46379.1| VRR-NUC domain protein [Vibrio parahaemolyticus AQ4037]
          Length = 545

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +    WIEVK P  +L   Q   I+E  R      V  
Sbjct: 485 RNGMPDLIAFR-DNEFEWIEVKGPGDKLQDNQWRWIKEFSRLNVPFAVCY 533


>gi|291165074|gb|ADD81102.1| gp104 [Rhodococcus phage ReqiPoco6]
          Length = 109

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 31/100 (31%), Gaps = 9/100 (9%)

Query: 9   QTEKDVEKRLVTGAKKL--DCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP----TG 62
             E   +  L+   +KL     V K      +G PD  I+  +     +EVK      + 
Sbjct: 2   PRESVYQANLIKKLRKLYPGAIVLKNDSGYMQGIPDLTILYRD-KWAALEVKAKEPNGSD 60

Query: 63  RLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
                Q   IE++        +    E     L  L   L
Sbjct: 61  IFQPNQEWFIEKMNDMSFAACIY--PENEKEVLRGLQQAL 98


>gi|254787359|ref|YP_003074788.1| VRR-NUC domain-containing protein [Teredinibacter turnerae T7901]
 gi|237686823|gb|ACR14087.1| VRR-NUC domain protein [Teredinibacter turnerae T7901]
          Length = 562

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 19/51 (37%)

Query: 36  GRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            R G PD +     GG   +EVK P  RL   Q+  +          +V  
Sbjct: 508 NRNGLPDLIYFPNTGGYELVEVKGPGDRLQKNQLRWLHYFAEHQIPCQVAY 558


>gi|91225498|ref|ZP_01260620.1| hypothetical protein V12G01_09225 [Vibrio alginolyticus 12G01]
 gi|91189861|gb|EAS76134.1| hypothetical protein V12G01_09225 [Vibrio alginolyticus 12G01]
          Length = 537

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +         WIEVK P  +L   Q   I+E  R      V  
Sbjct: 485 RNGMPDLIAF-KGNEFEWIEVKGPGDKLQDNQWRWIKEFTRLNVPFAVCY 533


>gi|153836351|ref|ZP_01989018.1| VRR-NUC domain family [Vibrio parahaemolyticus AQ3810]
 gi|149750253|gb|EDM60998.1| VRR-NUC domain family [Vibrio parahaemolyticus AQ3810]
          Length = 545

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +    WIEVK P  +L   Q   I+E  R      V  
Sbjct: 485 RNGMPDLIAFR-DNEFEWIEVKGPGDKLQDNQWRWIKEFSRLNVPFAVCY 533


>gi|315650311|ref|ZP_07903383.1| VRR-NUC domain protein [Eubacterium saburreum DSM 3986]
 gi|315487422|gb|EFU77732.1| VRR-NUC domain protein [Eubacterium saburreum DSM 3986]
          Length = 160

 Score = 64.4 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 6/96 (6%)

Query: 7   HYQTEKDVEKRLVTGAKKL--DCWVRKASFV--GRRGCPDRLIITPNGGLWWIEVKKP-T 61
           H   E   +K+++    K      V K +       G PD   I   G  +  E+K+P  
Sbjct: 60  HMPKESYFQKQIMDWINKNIPGAAVWKEAAGPYSVSGIPDITCIIR-GLYYGFEIKRPFI 118

Query: 62  GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           GRLS  Q   I+ +   G R  V+ S++EV   L++
Sbjct: 119 GRLSKIQKETIDRINESGGRAYVVTSVKEVAEILKD 154


>gi|198415862|ref|XP_002123827.1| PREDICTED: similar to Coiled-coil domain-containing protein MTMR15
           [Ciona intestinalis]
          Length = 823

 Score = 64.4 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 1/59 (1%)

Query: 27  CWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
             + K     R G PD ++   +     +EVK P  RLS  Q   I +L   G  V+V 
Sbjct: 754 GTMVKDFRHTRSGLPDLVVWN-DISYKLVEVKGPNDRLSTNQRVWIHKLMELGVDVEVC 811


>gi|126457844|ref|YP_001075220.1| hypothetical protein BURPS1106A_A1185 [Burkholderia pseudomallei
           1106a]
 gi|242311223|ref|ZP_04810240.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254192877|ref|ZP_04899312.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|126231612|gb|ABN95025.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|169649631|gb|EDS82324.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|242134462|gb|EES20865.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 564

 Score = 64.4 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 492 VRGNRSGLPDLVRFWPAECRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 546


>gi|218676811|ref|YP_002395630.1| hypothetical protein VS_II1051 [Vibrio splendidus LGP32]
 gi|218325079|emb|CAV26917.1| Conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 547

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +    WIEVK P  +L   Q   I+E  R      V  
Sbjct: 496 RNGMPDLIAF-KDDEFHWIEVKGPGDKLQDNQWRWIKEFERLSVPFSVCY 544


>gi|167759125|ref|ZP_02431252.1| hypothetical protein CLOSCI_01472 [Clostridium scindens ATCC 35704]
 gi|167663243|gb|EDS07373.1| hypothetical protein CLOSCI_01472 [Clostridium scindens ATCC 35704]
          Length = 163

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 31/97 (31%), Gaps = 11/97 (11%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKPT 61
           +  H        K+     K++           + G  D  +  P G     +IE+K   
Sbjct: 27  WLHHVPNGGSRNKQEAVKLKQMGV---------KAGVSDLCLPYPKGLYCGLYIEMKFGD 77

Query: 62  GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
            R    Q   + ++   G  V    S EE    +EE 
Sbjct: 78  NRQQETQKEFLADMAAAGHFVATCYSAEEAVKVIEEY 114


>gi|167742161|ref|ZP_02414935.1| hypothetical protein Bpse14_29090 [Burkholderia pseudomallei 14]
          Length = 253

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 181 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 235


>gi|167767010|ref|ZP_02439063.1| hypothetical protein CLOSS21_01528 [Clostridium sp. SS2/1]
 gi|167710985|gb|EDS21564.1| hypothetical protein CLOSS21_01528 [Clostridium sp. SS2/1]
          Length = 105

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 34/96 (35%), Gaps = 6/96 (6%)

Query: 9   QTEKDVEKRLVTGAKKL--DCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKK-PTGRLS 65
             E   +  L    K     C V KA     +G PD LI+  +     +EVKK       
Sbjct: 10  MLESKFQSDLKKELKNKFPGCIVMKADSADIQGIPDLLILYKD-KWASLEVKKNKKASHR 68

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
             Q   ++++        +    E  ++ L +L  T
Sbjct: 69  PNQDYYVDKMEDMSFSRFIY--PENKEDVLNDLEQT 102


>gi|90578407|ref|ZP_01234218.1| hypothetical protein VAS14_15189 [Vibrio angustum S14]
 gi|90441493|gb|EAS66673.1| hypothetical protein VAS14_15189 [Vibrio angustum S14]
          Length = 552

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 29/71 (40%), Gaps = 5/71 (7%)

Query: 16  KRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEEL 75
            +LV   ++L     K     R G PD ++    G   W+EVK P  +L   Q+  +   
Sbjct: 478 TQLVRMFRRL----LKDLRHHRSGMPDLIMFNNTG-YQWVEVKGPGDKLQDHQLRWLAFF 532

Query: 76  RRRGQRVKVLV 86
            + G   +V  
Sbjct: 533 DQHGIPAQVAY 543


>gi|167723185|ref|ZP_02406421.1| hypothetical protein BpseD_29463 [Burkholderia pseudomallei DM98]
          Length = 225

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 153 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 207


>gi|167849186|ref|ZP_02474694.1| hypothetical protein BpseB_28263 [Burkholderia pseudomallei B7210]
          Length = 239

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 167 VRGNRSGLPDLVRFWPAECRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 221


>gi|269967871|ref|ZP_06181914.1| hypothetical protein VMC_33440 [Vibrio alginolyticus 40B]
 gi|269827521|gb|EEZ81812.1| hypothetical protein VMC_33440 [Vibrio alginolyticus 40B]
          Length = 537

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +         WIEVK P  +L   Q   I+E  R      V  
Sbjct: 485 RNGMPDLIAF-KENEFEWIEVKGPGDKLQDNQWRWIKEFTRLNVPFAVCY 533


>gi|167914447|ref|ZP_02501538.1| hypothetical protein Bpse112_28429 [Burkholderia pseudomallei 112]
          Length = 265

 Score = 64.4 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 193 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 247


>gi|312977541|ref|ZP_07789289.1| phage protein [Lactobacillus crispatus CTV-05]
 gi|310895972|gb|EFQ45038.1| phage protein [Lactobacillus crispatus CTV-05]
          Length = 125

 Score = 64.4 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 38/100 (38%), Gaps = 13/100 (13%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKASFVG------------RRGCPDRLIIT-PNGGLWWIEV 57
           E  ++  ++       C V + +               + G PD +     +  +++IEV
Sbjct: 13  EHRIQNAIIATLNWRRCAVIRLNAGAIPTKNGGLFRGVKPGTPDLIGYRLKDRQVFFIEV 72

Query: 58  KKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           K P GR+S  Q     +L  +     +  S+E+    + E
Sbjct: 73  KAPKGRISQAQQLYHLDLMHKHVIHGIARSVEDAVKIVNE 112


>gi|261251368|ref|ZP_05943942.1| hypothetical protein VIA_001387 [Vibrio orientalis CIP 102891]
 gi|260938241|gb|EEX94229.1| hypothetical protein VIA_001387 [Vibrio orientalis CIP 102891]
          Length = 537

 Score = 64.4 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD ++   +G   W+EVK P  +L   Q   IE+  R      V  
Sbjct: 485 RNGMPDLMLF-KDGDYHWVEVKGPGDKLQDNQWRWIEQFHRLSVNFSVCY 533


>gi|156543241|ref|XP_001606613.1| PREDICTED: hypothetical protein [Nasonia vitripennis]
          Length = 802

 Score = 64.4 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD ++          +EVK P   LS +Q   ++ L R G  V+V 
Sbjct: 741 RSGFPDLILWNSLTAKCKIVEVKGPGDTLSEKQKLWLQYLERLGIDVEVC 790


>gi|167839450|ref|ZP_02466134.1| Uvs005 [Burkholderia thailandensis MSMB43]
          Length = 246

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+V+ 
Sbjct: 174 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVID 228


>gi|37676521|ref|NP_936917.1| hypothetical protein VVA0861 [Vibrio vulnificus YJ016]
 gi|37201063|dbj|BAC96887.1| hypothetical protein [Vibrio vulnificus YJ016]
          Length = 153

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 37/101 (36%), Gaps = 14/101 (13%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKPT 61
           +  H   E     +      +L          G +G PD ++  P        IE+K P 
Sbjct: 60  FLTHVPNEGKRGPQAQKDFVELG---------GSKGYPDLILDIPTKKYPGLRIEMKAPE 110

Query: 62  ---GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
                ++  Q +  E+LR  G RV++  S EE    + +  
Sbjct: 111 PYYSYVTSSQENWHEKLRAMGYRVEICNSYEEGKILIMDYL 151


>gi|186474090|ref|YP_001861432.1| VRR-NUC domain-containing protein [Burkholderia phymatum STM815]
 gi|184196422|gb|ACC74386.1| VRR-NUC domain protein [Burkholderia phymatum STM815]
          Length = 571

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  +    +    V+VL 
Sbjct: 497 IRANRSGLPDLIRFWPRERRYELIEVKGPGDRLQDNQIRWLAYCVQHDMPVRVLD 551


>gi|328470498|gb|EGF41409.1| hypothetical protein VP10329_06857 [Vibrio parahaemolyticus 10329]
          Length = 545

 Score = 64.0 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +    WIEVK P  +L   Q   I+E  R      V  
Sbjct: 485 RNGMPDLIAFR-DNEFEWIEVKGPGDKLQDNQWRWIKEFSRLNVPFVVCY 533


>gi|311245149|ref|XP_003121714.1| PREDICTED: fanconi-associated nuclease 1-like [Sus scrofa]
          Length = 1020

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++    N     +EVK P  RLSH+QM  ++ELRR G  V+V 
Sbjct: 958  RGGLPDLVVWNSQNHRFKLVEVKGPNDRLSHKQMIWLDELRRLGAEVEVC 1007


>gi|89094794|ref|ZP_01167728.1| hypothetical protein MED92_11859 [Oceanospirillum sp. MED92]
 gi|89080959|gb|EAR60197.1| hypothetical protein MED92_11859 [Oceanospirillum sp. MED92]
          Length = 561

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 27/67 (40%), Gaps = 1/67 (1%)

Query: 20  TGAKKLDCWVRKASFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRR 78
              + L  ++       RRG PD +           IEVK P  RL   Q   +E L ++
Sbjct: 486 ADLRALFEYMFLDLRNHRRGLPDLICFDKQANTYRMIEVKGPGDRLQDHQRLWLEYLHQK 545

Query: 79  GQRVKVL 85
           G  V+V 
Sbjct: 546 GIDVEVC 552


>gi|269955370|ref|YP_003325159.1| VRR-NUC domain-containing protein [Xylanimonas cellulosilytica DSM
           15894]
 gi|269304051|gb|ACZ29601.1| VRR-NUC domain protein [Xylanimonas cellulosilytica DSM 15894]
          Length = 123

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 33/88 (37%), Gaps = 11/88 (12%)

Query: 9   QTEKDVEKRLVTGAKKLDCWVRKAS--FVG--------RRGCPDRLIITPNGGLWWIEVK 58
            TE+ ++ ++    ++        +               G PD   +  +  + +IE+K
Sbjct: 14  MTERALQSQVEALMRETGWMFFHPADNRPNARGRVQSITAGYPDLHGVRRDREI-YIELK 72

Query: 59  KPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           +  GR+S  Q + +  L   G  V V  
Sbjct: 73  RQNGRVSDAQKTWLHALEALGHEVHVFR 100


>gi|167754375|ref|ZP_02426502.1| hypothetical protein ALIPUT_02669 [Alistipes putredinis DSM 17216]
 gi|167659000|gb|EDS03130.1| hypothetical protein ALIPUT_02669 [Alistipes putredinis DSM 17216]
          Length = 115

 Score = 64.0 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 5/70 (7%)

Query: 35  VGRRGCPDRLIITPNGGLWW--IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVD 92
              +G  D L++ P        IE+K PTGR    Q +  E     G +  +  S +E  
Sbjct: 48  GTMKGVADLLLLFPAKRFHGLCIEMKTPTGRQQPSQKAWQERAEWAGYKYVICRSFDE-- 105

Query: 93  NFLEELACTL 102
            F+ E+   L
Sbjct: 106 -FMAEIDAYL 114


>gi|148976727|ref|ZP_01813399.1| hypothetical protein VSWAT3_03731 [Vibrionales bacterium SWAT-3]
 gi|145963840|gb|EDK29099.1| hypothetical protein VSWAT3_03731 [Vibrionales bacterium SWAT-3]
          Length = 554

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +    WIEVK P  +L   Q   I+E  R      V  
Sbjct: 503 RTGMPDLIAF-KDDQFHWIEVKGPGDKLQDNQWRWIKEFERLSVPFSVCY 551


>gi|154504544|ref|ZP_02041282.1| hypothetical protein RUMGNA_02049 [Ruminococcus gnavus ATCC 29149]
 gi|260590096|ref|ZP_05856009.1| VRR-NUC domain protein [Blautia hansenii DSM 20583]
 gi|153795026|gb|EDN77446.1| hypothetical protein RUMGNA_02049 [Ruminococcus gnavus ATCC 29149]
 gi|260539608|gb|EEX20177.1| VRR-NUC domain protein [Blautia hansenii DSM 20583]
          Length = 136

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 34/98 (34%), Gaps = 11/98 (11%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLW--WIEVKKPT 61
           Y +H       +K      K+            + G PD ++     G    +IE+K   
Sbjct: 32  YMYHVPNGGKRDKATAAVLKRQGV---------KAGVPDIMLPAARAGYHGLYIELKAGE 82

Query: 62  GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
              + +Q   +E LR++G    V    +     +E+  
Sbjct: 83  NTTTKKQKEWLEYLRQQGYYTAVCYGWQPAAQLIEQYL 120


>gi|170738318|ref|YP_001779578.1| VRR-NUC domain-containing protein [Burkholderia cenocepacia MC0-3]
 gi|169820506|gb|ACA95088.1| VRR-NUC domain protein [Burkholderia cenocepacia MC0-3]
          Length = 564

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P+      IEVK P  RL   Q   +         V+V+ 
Sbjct: 492 IRSNRSGLPDLVRFWPDERRYELIEVKGPGDRLQDNQTRWLAYCIAHRMPVRVVD 546


>gi|254248408|ref|ZP_04941728.1| hypothetical protein BCPG_03239 [Burkholderia cenocepacia PC184]
 gi|124874909|gb|EAY64899.1| hypothetical protein BCPG_03239 [Burkholderia cenocepacia PC184]
          Length = 564

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P+      IEVK P  RL   Q   +         V+V+ 
Sbjct: 492 IRSNRSGLPDLVRFWPDERRYELIEVKGPGDRLQDNQTRWLAYCIAHRMPVRVVD 546


>gi|107026330|ref|YP_623841.1| hypothetical protein Bcen_3979 [Burkholderia cenocepacia AU 1054]
 gi|116692482|ref|YP_838015.1| hypothetical protein Bcen2424_4388 [Burkholderia cenocepacia
           HI2424]
 gi|105895704|gb|ABF78868.1| conserved hypothetical protein [Burkholderia cenocepacia AU 1054]
 gi|116650482|gb|ABK11122.1| conserved hypothetical protein [Burkholderia cenocepacia HI2424]
          Length = 564

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P+      IEVK P  RL   Q   +         V+V+ 
Sbjct: 492 IRSNRSGLPDLVRFWPDERRYELIEVKGPGDRLQDNQTRWLAYCIAHRMPVRVVD 546


>gi|291403999|ref|XP_002718265.1| PREDICTED: myotubularin related protein 15 [Oryctolagus cuniculus]
          Length = 1033

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++ +  +     +EVK P  RLS +Q+  ++EL+R G  V+V 
Sbjct: 971  RGGLPDLVVWSSRSHRFKLVEVKGPNDRLSPKQVIWLDELQRLGAAVEVC 1020


>gi|167827713|ref|ZP_02459184.1| hypothetical protein Bpseu9_28797 [Burkholderia pseudomallei 9]
          Length = 282

 Score = 63.6 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q+  ++   R    V+VL 
Sbjct: 210 VRGNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQIRWLDYCVRHRMPVRVLD 264


>gi|187933743|ref|YP_001886469.1| VRR-NUC domain protein [Clostridium botulinum B str. Eklund 17B]
 gi|187721896|gb|ACD23117.1| VRR-NUC domain protein [Clostridium botulinum B str. Eklund 17B]
          Length = 129

 Score = 63.6 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 34/91 (37%), Gaps = 11/91 (12%)

Query: 7   HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKPTGRL 64
           H    +  +KR   G K+            + G PD ++    GG    +IE+K    + 
Sbjct: 29  HVPNGEKRDKRTAVGLKRQGV---------KAGVPDVVLPCGRGGYFGLYIELKVGKNKT 79

Query: 65  SHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           S  Q   I +L+ +   V+V     E    L
Sbjct: 80  SDNQKQWIRDLKEQNYLVEVCYGWREAAEVL 110


>gi|160938993|ref|ZP_02086344.1| hypothetical protein CLOBOL_03887 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437956|gb|EDP15716.1| hypothetical protein CLOBOL_03887 [Clostridium bolteae ATCC
           BAA-613]
          Length = 249

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 32/99 (32%), Gaps = 16/99 (16%)

Query: 6   FHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLW--WIEVKKPTGR 63
           +H   E       +   K             + G PD  +   N G    +IE+K    +
Sbjct: 35  YHVPNEGKRSNGGI--LKAAGL---------KSGVPDICLPVANNGFHGLYIELKFGKNK 83

Query: 64  LSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
            +  Q   +  L  +G +  V    EE     EE+   L
Sbjct: 84  ATKAQEEYMAMLNAQGYKTAVCYGAEEAG---EEILSYL 119


>gi|86148723|ref|ZP_01066999.1| hypothetical protein MED222_04205 [Vibrio sp. MED222]
 gi|85833492|gb|EAQ51674.1| hypothetical protein MED222_04205 [Vibrio sp. MED222]
          Length = 554

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +    WIEVK P  +L   Q   I+E  R      V  
Sbjct: 503 RTGMPDLIAF-KDDEFHWIEVKGPGDKLQDNQWRWIKEFERLSVPFSVCY 551


>gi|262395598|ref|YP_003287451.1| hypothetical protein VEA_000298 [Vibrio sp. Ex25]
 gi|262339192|gb|ACY52986.1| hypothetical protein VEA_000298 [Vibrio sp. Ex25]
          Length = 537

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 19/50 (38%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +         WIEVK P  ++   Q   I+E  R      V  
Sbjct: 485 RNGMPDLIAF-KENEFEWIEVKGPGDKIQDNQWRWIKEFTRLNVPFAVCY 533


>gi|291525016|emb|CBK90603.1| VRR-NUC domain [Eubacterium rectale DSM 17629]
          Length = 249

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 32/99 (32%), Gaps = 16/99 (16%)

Query: 6   FHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLW--WIEVKKPTGR 63
           +H   E       +   K             + G PD  +   N G    +IE+K    +
Sbjct: 35  YHVPNEGKRSNGGI--LKAAGL---------KSGVPDICLPVANNGFHGLYIELKFGKNK 83

Query: 64  LSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
            +  Q   +  L  +G +  V    EE     EE+   L
Sbjct: 84  ATKAQEEYMAMLNAQGYKTAVCYGAEEAG---EEILAYL 119


>gi|323691270|ref|ZP_08105545.1| VRR-NUC domain-containing protein [Clostridium symbiosum WAL-14673]
 gi|323504610|gb|EGB20397.1| VRR-NUC domain-containing protein [Clostridium symbiosum WAL-14673]
          Length = 161

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 31/98 (31%), Gaps = 11/98 (11%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKPT 61
           +  H        K+     K++           + G  D  +  P G     +IE+K   
Sbjct: 33  WLHHVPNGGSRNKQEAVKLKQMGV---------KAGVSDLCLPYPKGLYCGLYIEMKFGD 83

Query: 62  GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
            R    Q   + ++   G  V    S EE    +EE  
Sbjct: 84  NRQQETQKEFLADMAAVGHFVATCYSAEEAIKVIEEYL 121


>gi|323493387|ref|ZP_08098509.1| hypothetical protein VIBR0546_13740 [Vibrio brasiliensis LMG 20546]
 gi|323312210|gb|EGA65352.1| hypothetical protein VIBR0546_13740 [Vibrio brasiliensis LMG 20546]
          Length = 537

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD ++   +G   W+EVK P  +L   Q   I   +R      V  
Sbjct: 485 RNGMPDLILF-KDGEFEWVEVKGPGDKLQDNQWRWISHFKRLKVPFSVAY 533


>gi|154502394|ref|ZP_02039454.1| hypothetical protein RUMGNA_00207 [Ruminococcus gnavus ATCC 29149]
 gi|153797019|gb|EDN79439.1| hypothetical protein RUMGNA_00207 [Ruminococcus gnavus ATCC 29149]
          Length = 148

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 30/97 (30%), Gaps = 11/97 (11%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKPT 61
           +  H        K      K++           + G  D  +  P G     +IE+K   
Sbjct: 33  WLHHIPNGGSRNKAEAVKLKQMGV---------KAGVSDLCLPYPKGIYCGLYIEMKFGD 83

Query: 62  GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
           G+    Q   + ++   G  V    + E+    L E 
Sbjct: 84  GKHQKSQKEFLTDMAAVGHYVATCYTSEDAVEVLREY 120


>gi|241698867|ref|XP_002411877.1| coiled-coil domain-containing protein MTMR15, putative [Ixodes
           scapularis]
 gi|215504808|gb|EEC14302.1| coiled-coil domain-containing protein MTMR15, putative [Ixodes
           scapularis]
          Length = 542

 Score = 63.2 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD ++  P +G L   EVK P   LS +Q+  + EL   G   +V 
Sbjct: 467 RSGLPDLVVWNPVDGRLKAAEVKGPGDTLSAKQVVWLRELLALGIDCEVC 516


>gi|239625893|ref|ZP_04668924.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239520123|gb|EEQ59989.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 216

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 32/99 (32%), Gaps = 16/99 (16%)

Query: 6   FHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLW--WIEVKKPTGR 63
           +H   E       +   K             + G PD  +   N G    +IE+K    +
Sbjct: 2   YHVPNEGKRSNGGI--LKAAGL---------KSGVPDICLPVANNGFHGLYIELKFGKNK 50

Query: 64  LSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
            +  Q   +  L  +G +  V    EE     EE+   L
Sbjct: 51  ATKAQEEYMAMLNAQGYKTAVCYGAEEAG---EEILAYL 86


>gi|291560630|emb|CBL39430.1| VRR-NUC domain [butyrate-producing bacterium SSC/2]
          Length = 151

 Score = 62.8 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 2/64 (3%)

Query: 37  RRGCPDRLIITPNGGL--WWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
           + G PD  +  P G     +IE+K   GRL  +Q   +++    G  V V  S E     
Sbjct: 61  KAGVPDLHLPVPKGQYASLYIEMKYGDGRLQKEQKEFLKQAADYGNFVAVCYSQEIALKV 120

Query: 95  LEEL 98
           +E+ 
Sbjct: 121 IEDY 124


>gi|126668204|ref|ZP_01739165.1| hypothetical protein MELB17_23820 [Marinobacter sp. ELB17]
 gi|126627353|gb|EAZ97989.1| hypothetical protein MELB17_23820 [Marinobacter sp. ELB17]
          Length = 569

 Score = 62.8 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 5/55 (9%)

Query: 37  RRGCPDRLIITPNGG-----LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +   P           IEVK P  RL   Q+  ++    +G    V  
Sbjct: 505 RSGFPDLVRFYPENSPPELCYEMIEVKGPGDRLQDHQVRWLQFFASQGIAASVCY 559


>gi|84390470|ref|ZP_00991481.1| hypothetical protein V12B01_11885 [Vibrio splendidus 12B01]
 gi|84376730|gb|EAP93606.1| hypothetical protein V12B01_11885 [Vibrio splendidus 12B01]
          Length = 116

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +    +    WIEVK P  +L   Q   I+E  R      V  
Sbjct: 65  RTGMPDLIAF-KDKEFHWIEVKGPGDKLQDNQWRWIKEFERLSVPFSVCY 113


>gi|296203919|ref|XP_002749127.1| PREDICTED: coiled-coil domain-containing protein MTMR15-like
            [Callithrix jacchus]
          Length = 1166

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++   P+     +EVK P+ RLSH+QM  ++EL++ G  V+V 
Sbjct: 1104 RGGLPDLVVWNTPSHRCKLVEVKGPSDRLSHKQMIWLDELQKLGAEVEVC 1153


>gi|321472208|gb|EFX83179.1| hypothetical protein DAPPUDRAFT_302110 [Daphnia pulex]
          Length = 918

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD  I  P       IEVK P  RLS +Q   ++ L   G   +V 
Sbjct: 816 RSGFPDLTIWNPQQKKWRIIEVKGPNDRLSTKQTLWLDFLVSLGVEAEVC 865


>gi|47220527|emb|CAG05553.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 986

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD ++          +EVK P+ RLS +Q   ++EL++ G  V+V 
Sbjct: 924 RAGLPDLVVWNTSENTYKLVEVKGPSDRLSQKQQIWLDELQKLGADVEVC 973


>gi|160409999|sp|Q1LWH4|FAN1_DANRE RecName: Full=Fanconi-associated nuclease 1; AltName:
           Full=FANCD2/FANCI-associated nuclease 1; AltName:
           Full=Myotubularin-related protein 15
          Length = 988

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD ++  T +     +EVK P  RLS +Q   ++ELR+ G  V+V 
Sbjct: 926 RGGLPDLVVWSTSSNKYKLVEVKGPNDRLSQKQQIWLDELRKLGADVEVC 975


>gi|157279721|ref|NP_001038546.2| fanconi-associated nuclease 1 [Danio rerio]
 gi|156229743|gb|AAI51827.1| Si:ch211-201b11.2 protein [Danio rerio]
          Length = 988

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD ++  T +     +EVK P  RLS +Q   ++ELR+ G  V+V 
Sbjct: 926 RGGLPDLVVWSTSSNKYKLVEVKGPNDRLSQKQQIWLDELRKLGADVEVC 975


>gi|148726022|emb|CAN88260.1| novel protein [Danio rerio]
          Length = 988

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD ++  T +     +EVK P  RLS +Q   ++ELR+ G  V+V 
Sbjct: 926 RGGLPDLVVWSTSSNKYKLVEVKGPNDRLSQKQQIWLDELRKLGADVEVC 975


>gi|94733114|emb|CAK04388.1| novel protein [Danio rerio]
          Length = 988

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD ++  T +     +EVK P  RLS +Q   ++ELR+ G  V+V 
Sbjct: 926 RGGLPDLVVWSTSSNKYKLVEVKGPNDRLSQKQQIWLDELRKLGADVEVC 975


>gi|224062325|ref|XP_002194696.1| PREDICTED: similar to KIAA1018 protein [Taeniopygia guttata]
          Length = 1099

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD L+   +      +EVK P  RLS +QM  + EL   G  V+V 
Sbjct: 1037 RGGLPDLLVWRSHSRHFKLVEVKGPNDRLSPKQMLWLSELHELGAAVEVC 1086


>gi|254441219|ref|ZP_05054712.1| VRR-NUC domain superfamily [Octadecabacter antarcticus 307]
 gi|198251297|gb|EDY75612.1| VRR-NUC domain superfamily [Octadecabacter antarcticus 307]
          Length = 138

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
             G  D LII  +G + ++E+K P GRL   Q +  + +  +G    ++ S+++    L 
Sbjct: 63  HAGFADLLIIC-DGRVLFLELKAPKGRLRSAQEAFRDAVFSQGFGWALVRSLDDALGALA 121

Query: 97  ELACTL 102
           +   T 
Sbjct: 122 DHGFTT 127


>gi|206563363|ref|YP_002234126.1| hypothetical protein BCAM1515 [Burkholderia cenocepacia J2315]
 gi|198039403|emb|CAR55369.1| conserved hypothetical protein [Burkholderia cenocepacia J2315]
          Length = 564

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 19/55 (34%), Gaps = 1/55 (1%)

Query: 33  SFVGRRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               R G PD +   P       IEVK P  RL   Q   +         V+V+ 
Sbjct: 492 IRSNRSGLPDLVRFWPAERRYELIEVKGPGDRLQDNQTRWLAYCIAHRMPVRVVD 546


>gi|182418913|ref|ZP_02950170.1| PmgM [Clostridium butyricum 5521]
 gi|237669030|ref|ZP_04529014.1| VRR-NUC domain protein [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182377196|gb|EDT74764.1| PmgM [Clostridium butyricum 5521]
 gi|237657378|gb|EEP54934.1| VRR-NUC domain protein [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 130

 Score = 62.4 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 35/96 (36%), Gaps = 11/96 (11%)

Query: 7   HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKPTGRL 64
           H       + R  T  K+            + G PD ++    GG    +IE+K    + 
Sbjct: 29  HVPNGGKRDARTATSLKRQGV---------KAGVPDIVLPVGRGGYFGLYIELKTGKNKT 79

Query: 65  SHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
           + +Q   I+ L+     V+V     E  + +E+   
Sbjct: 80  TVKQQGWIKRLKDNNYCVEVCYGWIEARDVVEKYLS 115


>gi|91790789|ref|YP_551740.1| hypothetical protein Bpro_4970 [Polaromonas sp. JS666]
 gi|91700669|gb|ABE46842.1| hypothetical protein Bpro_4970 [Polaromonas sp. JS666]
          Length = 177

 Score = 62.0 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 30/75 (40%), Gaps = 3/75 (4%)

Query: 24  KLDCWVRKASFVG-RRGCPDRLIITPNGGL--WWIEVKKPTGRLSHQQMSEIEELRRRGQ 80
           +      K   +G + G PD ++    G      IE+K  TGRL  +Q   +  L   G 
Sbjct: 84  RSKGEAGKLKAMGTKPGIPDFVLPRARGSWRGLAIELKSDTGRLKEEQKFWLRGLEAEGY 143

Query: 81  RVKVLVSMEEVDNFL 95
              V  S+E  +  +
Sbjct: 144 LTSVCRSLEAFEALV 158


>gi|255282178|ref|ZP_05346733.1| VRR-NUC domain protein [Bryantella formatexigens DSM 14469]
 gi|255267126|gb|EET60331.1| VRR-NUC domain protein [Bryantella formatexigens DSM 14469]
          Length = 133

 Score = 62.0 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 6/100 (6%)

Query: 3   FYSFHYQTEKDVEKRLVTGAKKLDCW--VRKASFV--GRRGCPDRLIITPNGGLWWIEVK 58
           +   +   E   + +++   +K+     V K +     R+G PD   +  NG  +  EVK
Sbjct: 31  YLQRNLPKESYYQDKIIKHIRKIFPLSVVWKEAAGAYSRQGIPDVTAVI-NGRYYGFEVK 89

Query: 59  KP-TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
           +P  G LS  Q   I+ +R  G R  V+    EV   L E
Sbjct: 90  RPFVGVLSKIQEQTIKRIRAAGGRAYVVTYPAEVTELLRE 129


>gi|89885951|ref|YP_516149.1| hypothetical protein Rfer_4465 [Rhodoferax ferrireducens T118]
 gi|89347949|gb|ABD72151.1| hypothetical protein Rfer_4465 [Rhodoferax ferrireducens T118]
          Length = 169

 Score = 62.0 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 34/81 (41%), Gaps = 4/81 (4%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITPNGGL--WWIEVKKPTGRLSHQQMSEIEELRRRG 79
           K+      K   +G + G PD L+   +       IE+K  TGRLS  Q + ++   + G
Sbjct: 75  KRPRGEAGKLKGMGTKPGVPDFLLPRRHRQWAGLAIELKSDTGRLSLDQKAWLDAFEQEG 134

Query: 80  QRVKVLVSMEEV-DNFLEELA 99
               V  +++E     +  L 
Sbjct: 135 YLTAVCRTLDEFTVAVMRYLK 155


>gi|268536836|ref|XP_002633553.1| Hypothetical protein CBG05421 [Caenorhabditis briggsae]
          Length = 862

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD  +  P    +  IEVK P  RLS +Q   +      G + +V 
Sbjct: 801 SRSGFPDLTLWNPEKKTVAVIEVKGPGDRLSTKQRLWLSFFADNGIKAEVC 851


>gi|306755803|sp|A8WZU5|FAN1_CAEBR RecName: Full=Fanconi-associated nuclease 1 homolog
 gi|309363791|emb|CAP25905.2| CBR-FAN-1 protein [Caenorhabditis briggsae AF16]
          Length = 878

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD  +  P    +  IEVK P  RLS +Q   +      G + +V 
Sbjct: 817 SRSGFPDLTLWNPEKKTVAVIEVKGPGDRLSTKQRLWLSFFADNGIKAEVC 867


>gi|291164966|gb|ADD80995.1| gp104 [Rhodococcus phage ReqiPepy6]
          Length = 109

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 30/99 (30%), Gaps = 9/99 (9%)

Query: 10  TEKDVEKRLVTGAKKL--DCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLS-- 65
            E   + RL+    +L   C V K      +G PD  I+        +EVK      S  
Sbjct: 3   RESVYQARLIKKLHQLYPGCIVLKNDSSYMQGIPDLTILY-QKNWAALEVKAKEPNSSTI 61

Query: 66  --HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
               Q   IE +        +    E     L  L   L
Sbjct: 62  FQPNQEWFIETMNDMSFAACIY--PENEKEVLRGLQQAL 98


>gi|91087593|ref|XP_972078.1| PREDICTED: similar to Sema-1a CG18405-PA [Tribolium castaneum]
          Length = 1326

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 4/62 (6%)

Query: 38  RGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL---VSMEEVDN 93
            G PD ++     G   ++EVK    +LS +Q   +  L   G  V+V     + ++V +
Sbjct: 503 SGFPDLIVWNVEEGRAKFVEVKGENDKLSIKQKLWLNYLCDSGASVEVCRVERAEDDVHH 562

Query: 94  FL 95
           F+
Sbjct: 563 FV 564


>gi|291232927|ref|XP_002736405.1| PREDICTED: Coiled-coil domain-containing protein MTMR15-like
           [Saccoglossus kowalevskii]
          Length = 983

 Score = 61.7 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 27/66 (40%), Gaps = 1/66 (1%)

Query: 22  AKKLDCWVRKASFVGRRGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQ 80
              +   + +     R G PD ++    N     +EVK P  RL+ +Q+  I+ L   G 
Sbjct: 904 ISSIGKRILRDHRHCRGGVPDLVVWNTENKTFRVVEVKGPNDRLAPKQLLWIDYLNSVGA 963

Query: 81  RVKVLV 86
             +V  
Sbjct: 964 TAEVCY 969


>gi|239995207|ref|ZP_04715731.1| DNA polymerase III, epsilon subunit [Alteromonas macleodii ATCC
           27126]
          Length = 711

 Score = 61.7 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 4/84 (4%)

Query: 3   FYSFHYQT--EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
            +S H  T  E  +E   +     L   + K     R G PD ++   +G L + E+K P
Sbjct: 449 MWSSHLLTPIEALIEHGSLDSIYALLRMMCKDFESLRDGFPDIMVF--DGALRFEEIKAP 506

Query: 61  TGRLSHQQMSEIEELRRRGQRVKV 84
             +L   Q+  I+ L++ G  V V
Sbjct: 507 GDQLRRNQLVSIQRLQQAGFDVAV 530


>gi|71018407|ref|XP_759434.1| hypothetical protein UM03287.1 [Ustilago maydis 521]
 gi|46099041|gb|EAK84274.1| hypothetical protein UM03287.1 [Ustilago maydis 521]
          Length = 1179

 Score = 61.7 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 38   RGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKV 84
             G PD ++    +  + ++EVK P  RLS  Q   I+ L R G +V V
Sbjct: 1126 SGMPDLVVWRIKDKVVRFVEVKGPGDRLSETQKVWIDVLLRAGIQVHV 1173


>gi|328860726|gb|EGG09831.1| hypothetical protein MELLADRAFT_103952 [Melampsora larici-populina
           98AG31]
          Length = 912

 Score = 61.7 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 40/103 (38%), Gaps = 16/103 (15%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCW----VRKASFV--GRR--GCPDRLII-TPNGGLWW 54
           +  +   E      L+   + L C     + K      G R  G PD  +       + +
Sbjct: 816 WERYGMNE------LLEILECLGCLEICKLLKVLSEEYGFRKGGVPDLCLWNHKEKKVLF 869

Query: 55  IEVKKPTGRLSHQQMSEIEELR-RRGQRVKVLVSMEEVDNFLE 96
           +EVK P  RLS  Q++ ++ LR   G  V+V    E+ D    
Sbjct: 870 VEVKGPGDRLSETQIAWLDLLRIGIGCEVEVCEVKEDEDQVFR 912


>gi|134288376|ref|YP_001110539.1| hypothetical protein Bcep1808_6849 [Burkholderia vietnamiensis G4]
 gi|134133026|gb|ABO59736.1| hypothetical protein Bcep1808_6849 [Burkholderia vietnamiensis G4]
          Length = 166

 Score = 61.7 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 11/65 (16%), Positives = 24/65 (36%)

Query: 31  KASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEE 90
           +       G  D +    +G    +EVK+P    +  Q + +  +   G     +    +
Sbjct: 85  RFVKFSEAGVSDIIGQLKDGRFLAVEVKRPGNTPTDDQWAFLRNVASGGGVAGWVDDPAQ 144

Query: 91  VDNFL 95
           + NF+
Sbjct: 145 LRNFI 149


>gi|301777496|ref|XP_002924164.1| PREDICTED: coiled-coil domain-containing protein MTMR15-like
            [Ailuropoda melanoleuca]
 gi|306755801|sp|D2HNY3|FAN1_AILME RecName: Full=Fanconi-associated nuclease 1; AltName:
            Full=FANCD2/FANCI-associated nuclease 1; AltName:
            Full=Myotubularin-related protein 15
          Length = 1025

 Score = 61.7 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P  RLSH+QM  ++EL++ G  V+V 
Sbjct: 963  RGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMLWLDELQKLGADVEVC 1012


>gi|281341974|gb|EFB17558.1| hypothetical protein PANDA_013441 [Ailuropoda melanoleuca]
          Length = 1026

 Score = 61.7 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P  RLSH+QM  ++EL++ G  V+V 
Sbjct: 964  RGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMLWLDELQKLGADVEVC 1013


>gi|260777771|ref|ZP_05886664.1| hypothetical protein VIC_003168 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605784|gb|EEX32069.1| hypothetical protein VIC_003168 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 547

 Score = 61.7 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 19/50 (38%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD ++   +    W+EVK P  RL   Q     E  +      V  
Sbjct: 495 RSGMPDLILF-KDDRFEWVEVKGPGDRLQDNQWRWFHEFIKLKVPFSVCY 543


>gi|86139831|ref|ZP_01058397.1| hypothetical protein MED193_12398 [Roseobacter sp. MED193]
 gi|85823460|gb|EAQ43669.1| hypothetical protein MED193_12398 [Roseobacter sp. MED193]
          Length = 131

 Score = 61.3 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
             G  D +I+   G   ++E+K   GRLS  Q +  + +  +G    ++ S+++    L 
Sbjct: 56  HPGFADLIILC-EGKALFLELKSLKGRLSPAQEAFRDAVTAQGFGWALVRSLDDALGALA 114

Query: 97  ELACTL 102
           +   T 
Sbjct: 115 DYGFTT 120


>gi|307195664|gb|EFN77506.1| Coiled-coil domain-containing protein MTMR15 [Harpegnathos
           saltator]
          Length = 459

 Score = 61.3 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 37  RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           + G PD ++  P+      +EVK P   LS +Q   ++ L + G   +V  
Sbjct: 392 KAGFPDLIVWNPHTKQYKIVEVKGPGDSLSTKQKLWLQYLNQLGLNTEVCY 442


>gi|260063424|ref|YP_003196504.1| hypothetical protein RB2501_01410 [Robiginitalea biformata
          HTCC2501]
 gi|88782868|gb|EAR14042.1| hypothetical protein RB2501_01410 [Robiginitalea biformata
          HTCC2501]
          Length = 84

 Score = 61.3 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 26/57 (45%)

Query: 38 RGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
           G  D + + P G    IE+K   G  S +Q++    +   G R  V+ S++E+   
Sbjct: 22 PGVSDMIYLKPGGRPLLIEIKTMRGTQSPKQVAWQARVVANGYRYYVVRSLDEMKEI 78


>gi|254450081|ref|ZP_05063518.1| hypothetical protein OA238_680 [Octadecabacter antarcticus 238]
 gi|198264487|gb|EDY88757.1| hypothetical protein OA238_680 [Octadecabacter antarcticus 238]
          Length = 129

 Score = 61.3 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 32/91 (35%), Gaps = 6/91 (6%)

Query: 12  KDVEKRLVTGAKKLDCW-----VRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
             +    V    +                   G  D +++  +G + ++E+K   GRLS 
Sbjct: 11  GAIVHHCVNEVTEAGPRGARRQAILVGMGVHPGFADLIVLC-DGRVLFLELKSLKGRLSP 69

Query: 67  QQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
            Q    + +   G    ++ +M++    L +
Sbjct: 70  AQEGFRDAVLALGFGWALVRTMDDALGALAD 100


>gi|242243117|ref|ZP_04797562.1| conserved hypothetical protein [Staphylococcus epidermidis
          W23144]
 gi|242233465|gb|EES35777.1| conserved hypothetical protein [Staphylococcus epidermidis
          W23144]
          Length = 103

 Score = 61.3 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 36/91 (39%), Gaps = 6/91 (6%)

Query: 8  YQTEKDVEKRLVTGAKKL-DCWVRKASFVGR---RGCPDRLIITPNGGLWWIEVKKPTGR 63
          Y+ E   +   +   K   + +  K     +    G PD L    NG    IE+K  TG 
Sbjct: 10 YKNEAAFQNDFMQFLKHNPNAFAVKYWAGNKFTVNGIPDVLACI-NGVFHGIELKTNTGV 68

Query: 64 LSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
          +   Q   +++++  G    VL   ++ + +
Sbjct: 69 VRGIQKERMKQIKLAGGEAYVLR-PKDFEEW 98


>gi|149691096|ref|XP_001491319.1| PREDICTED: similar to Coiled-coil domain-containing protein MTMR15
            [Equus caballus]
          Length = 1028

 Score = 61.3 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P  RLSH+QM  + EL++ G  V+V 
Sbjct: 966  RGGLPDLVVWNSQSHRFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVC 1015


>gi|109080444|ref|XP_001109813.1| PREDICTED: coiled-coil domain-containing protein MTMR15-like [Macaca
            mulatta]
          Length = 1016

 Score = 61.3 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P  RLSH+QM  + EL++ G  V+V 
Sbjct: 954  RGGLPDLVVWNSQSHRFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVC 1003


>gi|254452931|ref|ZP_05066368.1| VRR-NUC domain family [Octadecabacter antarcticus 238]
 gi|198267337|gb|EDY91607.1| VRR-NUC domain family [Octadecabacter antarcticus 238]
          Length = 150

 Score = 61.3 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 32/92 (34%), Gaps = 6/92 (6%)

Query: 12  KDVEKRLVTGAKKLDCW-----VRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
             +    V    +                   G  D +++  +G + ++E+K   GRLS 
Sbjct: 26  GAIVHHCVNEVTEAGPRGARRQAILVGMGVHPGFADLIVLC-DGRVLFLELKSLKGRLSP 84

Query: 67  QQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
            Q    + +   G    ++ +M++    L + 
Sbjct: 85  AQEGFRDAVLALGFGWALVRTMDDALGALADY 116


>gi|19552945|ref|NP_600947.1| hypothetical protein NCgl1671 [Corynebacterium glutamicum ATCC
          13032]
 gi|62390622|ref|YP_226024.1| hypothetical protein cg1961 [Corynebacterium glutamicum ATCC
          13032]
 gi|21324510|dbj|BAB99134.1| Hypothetical protein [Corynebacterium glutamicum ATCC 13032]
 gi|41325960|emb|CAF20123.1| hypothetical protein predicted by Glimmer [Corynebacterium
          glutamicum ATCC 13032]
          Length = 149

 Score = 61.3 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 33/83 (39%), Gaps = 5/83 (6%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLI--ITPNGGLW--WIEVKKPTGRLSH 66
          E  +E+ L       +    K +     G PDR++  I   G     ++E+K+P      
Sbjct: 18 ETVIEQALQDACAVHNIMYLKFTS-SVTGVPDRILQGINAAGQPLTVYVELKRPGTHPRT 76

Query: 67 QQMSEIEELRRRGQRVKVLVSME 89
          +Q   +  L   G  V V+ + +
Sbjct: 77 RQKEVMNRLINHGALVFVVDARD 99


>gi|307104714|gb|EFN52966.1| hypothetical protein CHLNCDRAFT_137359 [Chlorella variabilis]
          Length = 997

 Score = 61.3 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 5/87 (5%)

Query: 4   YSFHYQTEKDVEKRLV--TGAKKLDCWVRKASFVGRRG-CPDRLIITPNGG-LWWIEVKK 59
           +  H   E  V    V       + C +      G  G  PD L+  P        EVK 
Sbjct: 898 WDRHELEELQVVAECVGGRQLAAV-CRLLAIDHGGWSGGMPDLLLWRPARRDAKLAEVKG 956

Query: 60  PTGRLSHQQMSEIEELRRRGQRVKVLV 86
           P  RLS+QQ + I  LR  G   +VL 
Sbjct: 957 PRDRLSNQQRAWINALRDAGFHAEVLK 983


>gi|73951017|ref|XP_536169.2| PREDICTED: similar to C01G5.8 isoform 1 [Canis familiaris]
 gi|73951019|ref|XP_856650.1| PREDICTED: similar to C01G5.8 isoform 2 [Canis familiaris]
 gi|73951021|ref|XP_856688.1| PREDICTED: similar to C01G5.8 isoform 3 [Canis familiaris]
          Length = 1029

 Score = 60.9 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++       +  +EVK P  RLSH+QM  ++EL++ G  V+V 
Sbjct: 967  RGGLPDLVVWNSQSHRVKLVEVKGPNDRLSHKQMIWLDELQKLGAEVEVC 1016


>gi|291513663|emb|CBK62873.1| VRR-NUC domain [Alistipes shahii WAL 8301]
          Length = 121

 Score = 60.9 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 36/115 (31%), Gaps = 25/115 (21%)

Query: 9   QT--EKDVEKRLVTGAK----KLDCWVRKASFVG---------------RRGCPDRLIIT 47
               E  ++K  VT  +    K+   +      G                 G  D +++ 
Sbjct: 1   MRHIESQIQKDCVTWFRLQYPKIGRLLFAVPNGGARNAKEAAIMKGEGVTAGVADLILLY 60

Query: 48  PNGGLWW--IEVKKPTG--RLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
           P+GG     IE K P+   R +  Q          G +  V  S+E+    +   
Sbjct: 61  PSGGFHSLCIEFKTPSKSSRQTPTQKEWQALAEAHGNKYIVCRSLEDFQQVIRAY 115


>gi|299748040|ref|XP_001837417.2| hypothetical protein CC1G_01329 [Coprinopsis cinerea okayama7#130]
 gi|298407791|gb|EAU84333.2| hypothetical protein CC1G_01329 [Coprinopsis cinerea okayama7#130]
          Length = 992

 Score = 60.9 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 32/89 (35%), Gaps = 10/89 (11%)

Query: 15  EKRLVTGAKKLD-------CWVRKASFVGR-RGCPDRLIITPNGG-LWWIEVKKPTGRLS 65
           E+ LV   + L        C +    + GR  G PD +          +IEVK P     
Sbjct: 821 EQDLVEILECLGGKQLASICKLFCEDYTGRCSGAPDLIAWNAQHRICKFIEVKGPGDTPQ 880

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
             Q    + L      V++   + +V++ 
Sbjct: 881 ENQKLWFDSLLAANIDVEICR-VADVNDV 908


>gi|270010701|gb|EFA07149.1| hypothetical protein TcasGA2_TC010140 [Tribolium castaneum]
          Length = 868

 Score = 60.9 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 38  RGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD ++     G   ++EVK    +LS +Q   +  L   G  V+V  
Sbjct: 800 SGFPDLIVWNVEEGRAKFVEVKGENDKLSIKQKLWLNYLCDSGASVEVCR 849


>gi|147860548|emb|CAN81872.1| hypothetical protein VITISV_038070 [Vitis vinifera]
          Length = 320

 Score = 60.9 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 31/95 (32%), Gaps = 18/95 (18%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDC-----WVRKASFVGRR---GCPDRLIIT----PNGG 51
           +  H  +E      L      +            +   R    G PD L+        G 
Sbjct: 226 WDRHSLSE------LRAAVTCIGGPCLASICXHLAQDYRSWSSGMPDLLLWRFHEDYKGE 279

Query: 52  LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
              +EVK P  RLS QQ + +  L   G  V+V  
Sbjct: 280 AKLVEVKGPRDRLSEQQRAWLLLLMXYGFNVEVCK 314


>gi|17538392|ref|NP_500997.1| hypothetical protein C01G5.8 [Caenorhabditis elegans]
 gi|74961181|sp|P90740|FAN1_CAEEL RecName: Full=Fanconi-associated nuclease 1 homolog
 gi|1705491|gb|AAB37739.1| Hypothetical protein C01G5.8 [Caenorhabditis elegans]
          Length = 865

 Score = 60.9 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD  +  P    +  +EVK P  RLS +Q   +      G R +V 
Sbjct: 804 SRSGFPDLTLWNPETKRVAVVEVKGPGDRLSTKQRLWLAIFADSGIRAEVC 854


>gi|320166532|gb|EFW43431.1| predicted protein [Capsaspora owczarzaki ATCC 30864]
          Length = 896

 Score = 60.9 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 38  RGCPDRLIITPN----GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
            G PD ++ +        + +IEVK P   LS QQ   I++L R G  V+V   +E+V
Sbjct: 839 SGMPDLVVWSRPESSASFIRFIEVKGPNDTLSEQQRVWIDKLLRLGLDVQVCHVVEDV 896


>gi|290987483|ref|XP_002676452.1| predicted protein [Naegleria gruberi]
 gi|284090054|gb|EFC43708.1| predicted protein [Naegleria gruberi]
          Length = 1053

 Score = 60.5 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 15/91 (16%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRKASFV-----------GRRGCPDRLIIT--PNGGLWWI- 55
           TE    ++L       +C+  K +              R G PD ++     +G    + 
Sbjct: 891 TENKENEKLEALLAIAECFPIKVTTTILQTLAEDIKENRSGMPDLILWKIQQDGKHEHLL 950

Query: 56  -EVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            E+K P  +LS +Q+  I+ L + G  ++V 
Sbjct: 951 SEIKGPGDKLSEKQIIWIDLLTKAGCSIEVC 981


>gi|221369892|ref|YP_002520988.1| hypothetical protein RSKD131_4055 [Rhodobacter sphaeroides KD131]
 gi|221162944|gb|ACM03915.1| Hypothetical Protein RSKD131_4055 [Rhodobacter sphaeroides KD131]
          Length = 131

 Score = 60.5 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
             G  D +++  +G + + E+K   GRLS  Q +  + +  +G    ++ S+++    L 
Sbjct: 56  HPGFADLMVLC-DGRVLFFELKSLKGRLSPSQEAFRDAVLAQGHGWALVRSLDDALGALA 114

Query: 97  ELACTL 102
           +   T 
Sbjct: 115 DHGFTT 120


>gi|300390584|gb|ADK11100.1| fanconi anemia associated nuclease 1 [Homo sapiens]
          Length = 1017

 Score = 60.5 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P  RLSH+QM  + EL++ G  V+V 
Sbjct: 955  RGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVC 1004


>gi|226246523|ref|NP_055782.3| fanconi-associated nuclease 1 isoform a [Homo sapiens]
 gi|160410012|sp|Q9Y2M0|FAN1_HUMAN RecName: Full=Fanconi-associated nuclease 1; AltName:
            Full=FANCD2/FANCI-associated nuclease 1; AltName:
            Full=Myotubularin-related protein 15
 gi|119581661|gb|EAW61257.1| KIAA1018 [Homo sapiens]
          Length = 1017

 Score = 60.5 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P  RLSH+QM  + EL++ G  V+V 
Sbjct: 955  RGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVC 1004


>gi|114659867|ref|XP_510266.2| PREDICTED: similar to KIAA1018 protein [Pan troglodytes]
          Length = 1017

 Score = 60.5 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P  RLSH+QM  + EL++ G  V+V 
Sbjct: 955  RGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVC 1004


>gi|58257674|dbj|BAA76862.3| KIAA1018 protein [Homo sapiens]
          Length = 1040

 Score = 60.5 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P  RLSH+QM  + EL++ G  V+V 
Sbjct: 978  RGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVC 1027


>gi|168278791|dbj|BAG11275.1| myotubularin-related protein 15 [synthetic construct]
          Length = 1017

 Score = 60.5 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P  RLSH+QM  + EL++ G  V+V 
Sbjct: 955  RGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVC 1004


>gi|192292162|ref|YP_001992767.1| VRR-NUC domain protein [Rhodopseudomonas palustris TIE-1]
 gi|192285911|gb|ACF02292.1| VRR-NUC domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 161

 Score = 60.5 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 32/94 (34%), Gaps = 11/94 (11%)

Query: 6   FHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEV-KKPTGRL 64
           F          ++    K               G PD  ++     ++++E+ K   GR+
Sbjct: 61  FAIPNGGKRHAKVAAEIKAEGGAA---------GVPDIFVMWR-KQVYFLEMKKAKGGRV 110

Query: 65  SHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
           S +Q   +  LR  G   +V   + E    LE  
Sbjct: 111 SAEQRVMMARLRGAGAICEVAKGLHEAIAQLEAW 144


>gi|315497459|ref|YP_004086263.1| DNA polymerase iii, epsilon subunit [Asticcacaulis excentricus CB
           48]
 gi|315415471|gb|ADU12112.1| DNA polymerase III, epsilon subunit [Asticcacaulis excentricus CB
           48]
          Length = 717

 Score = 60.5 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV-----SMEEV 91
           R G PD L+I P G + +IEVK    ++   Q++ +  LR+ G    +L        ++V
Sbjct: 486 RDGFPDLLLIGPCG-VRFIEVKGEGDQVRRHQLARLNLLRQAGFEAGILRVTFHPDPDQV 544

Query: 92  DNFLE 96
              ++
Sbjct: 545 YTVVD 549


>gi|297696162|ref|XP_002825277.1| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing protein
            MTMR15-like [Pongo abelii]
          Length = 1017

 Score = 60.1 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P  RLSH+QM  + EL++ G  V+V 
Sbjct: 955  RGGLPDLVVWNSQSHSFKLVEVKGPNDRLSHKQMIWLAELQKLGADVEVC 1004


>gi|257467662|ref|NP_001158142.1| myotubularin related protein 15 [Bos taurus]
 gi|296475478|gb|DAA17593.1| myotubularin related protein 15 [Bos taurus]
          Length = 1023

 Score = 60.1 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++ +     +  +EVK P  RLS +QM  ++ELRR G  V+V 
Sbjct: 961  RGGLPDLVVWSSQSHHVKLVEVKGPHDRLSQKQMIWLDELRRLGADVEVC 1010


>gi|90961732|ref|YP_535648.1| hypothetical protein LSL_0755 [Lactobacillus phage Sal1]
 gi|301300720|ref|ZP_07206905.1| conserved hypothetical protein [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|90820926|gb|ABD99565.1| Hypothetical protein, phage associated [Lactobacillus phage Sal1]
 gi|300851658|gb|EFK79357.1| conserved hypothetical protein [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 137

 Score = 60.1 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 20/112 (17%), Positives = 35/112 (31%), Gaps = 21/112 (18%)

Query: 11  EKDVEKRLVTGAKKLD----------------CWVRKASFVGRR--GCPDRLIITPNGGL 52
           EK  EK++    +                    W  K    G +  G PD +    NG  
Sbjct: 4   EKRFEKKVEKYLESQGIYQNNTKKQDKTIKDNGWFFKVWGGGFQSGGIPDLI-CNINGFF 62

Query: 53  WWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV--SMEEVDNFLEELACTL 102
             IE+K   G+ S  Q+   + + +      +L     +     +E +    
Sbjct: 63  LSIELKDIRGQPSELQIRNTKLINQTNGIGLILYPQGFDTFKKIVEVMLACN 114


>gi|260576691|ref|ZP_05844677.1| VRR-NUC domain protein [Rhodobacter sp. SW2]
 gi|259021058|gb|EEW24368.1| VRR-NUC domain protein [Rhodobacter sp. SW2]
          Length = 131

 Score = 60.1 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
             G  D ++I   G + ++EVK  TGR+   Q    + +  +G    ++ S+++    L 
Sbjct: 56  HAGFADLIVIC-GGRVLFLEVKSETGRMRKSQEVFRDTVCAQGFGWALVRSVDDALGALA 114

Query: 97  E 97
           +
Sbjct: 115 D 115


>gi|312796159|ref|YP_004029081.1| hypothetical protein RBRH_03666 [Burkholderia rhizoxinica HKI 454]
 gi|312167934|emb|CBW74937.1| Hypothetical protein RBRH_03666 [Burkholderia rhizoxinica HKI 454]
          Length = 661

 Score = 60.1 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 20/54 (37%), Gaps = 1/54 (1%)

Query: 33  SFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
               R G PD +   P       IEVK P  RL   Q+  +     +G  V V 
Sbjct: 574 VSQNRSGFPDLVRFVPAVRSYELIEVKGPGDRLQDNQLRWLAYAHEKGLPVSVA 627


>gi|192290701|ref|YP_001991306.1| VRR-NUC domain protein [Rhodopseudomonas palustris TIE-1]
 gi|192284450|gb|ACF00831.1| VRR-NUC domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 160

 Score = 60.1 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 1/64 (1%)

Query: 35  VGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
            G  G PD  II   G  +++E+K   GR+   Q   +  LR  G    V   + E    
Sbjct: 81  GGSAGVPDICIIWR-GVTYFLEMKALKGRVRPAQHVMMARLRGAGAICAVAKGLHEAIAQ 139

Query: 95  LEEL 98
           LE+ 
Sbjct: 140 LEKW 143


>gi|225419969|ref|ZP_03762272.1| hypothetical protein CLOSTASPAR_06310 [Clostridium asparagiforme
           DSM 15981]
 gi|225041391|gb|EEG51637.1| hypothetical protein CLOSTASPAR_06310 [Clostridium asparagiforme
           DSM 15981]
          Length = 137

 Score = 60.1 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 34/106 (32%), Gaps = 21/106 (19%)

Query: 11  EKDVEKRLVTGAKKLD----------------CWVRKASFVG--RRGCPDRLIITPNGGL 52
           EK  E ++      +                  W  K    G  + G PD +    NG +
Sbjct: 4   EKLFEGQIKKYFHSVGIYPAGFPSDRMKVEMVGWYTKIWGGGFQKSGIPDLICCV-NGVM 62

Query: 53  WWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV--SMEEVDNFLE 96
             +EVK   GR S  Q   I  +   G     L     +E  N ++
Sbjct: 63  LAVEVKASNGRPSELQKLNINRINTSGGIGVFLYPEGFDEFKNLVK 108


>gi|126277238|ref|XP_001373737.1| PREDICTED: similar to novel lectin C-type domain containing protein
            [Monodelphis domestica]
          Length = 1112

 Score = 60.1 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 25   LDCWVRKASFV---GRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQ 80
            L    R+ +      R G PD ++          +EVK P  RLSH+QM  ++EL++ G 
Sbjct: 1035 LSGMCRRLATDLRHHRGGLPDLVVWNTQKNLFKLVEVKGPNDRLSHKQMIWLDELQQLGA 1094

Query: 81   RVKVL 85
            +V+V 
Sbjct: 1095 QVEVC 1099


>gi|88800504|ref|ZP_01116067.1| hypothetical protein MED297_04834 [Reinekea sp. MED297]
 gi|88776735|gb|EAR07947.1| hypothetical protein MED297_04834 [Reinekea sp. MED297]
          Length = 539

 Score = 60.1 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD       G   +IE+K P  +L   Q++ +    R G    VL 
Sbjct: 482 RSGFPDLFQAH-EGQHRFIEIKGPGDKLQDNQIAWLTVFARLGIPADVLY 530


>gi|229824153|ref|ZP_04450222.1| hypothetical protein GCWU000282_01457 [Catonella morbi ATCC
          51271]
 gi|229786507|gb|EEP22621.1| hypothetical protein GCWU000282_01457 [Catonella morbi ATCC
          51271]
          Length = 96

 Score = 60.1 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 33/83 (39%), Gaps = 4/83 (4%)

Query: 9  QTEKDVEKRLVTGAKKLDCWVRKASFVGR--RGCPDRLIITPNGGLWWIEVKKP-TGRLS 65
            EK VE  +      +  +  K         G PD L     G    IEVKKP  GR+S
Sbjct: 2  LPEKKVENEIKKYLDHIGAYHIKIHGSAFMPAGTPDILACVK-GVFVGIEVKKPKGGRVS 60

Query: 66 HQQMSEIEELRRRGQRVKVLVSM 88
            Q  +I+++ + G    V   +
Sbjct: 61 DLQKLKIKQIEQAGGIGIVANDV 83


>gi|224069088|ref|XP_002302897.1| predicted protein [Populus trichocarpa]
 gi|222844623|gb|EEE82170.1| predicted protein [Populus trichocarpa]
          Length = 1028

 Score = 60.1 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 30/95 (31%), Gaps = 18/95 (18%)

Query: 4    YSFHYQTEKDVEKRLVTGAKKLDC-----WVRKASFVGRR---GCPDRLIITPNGGLWW- 54
            +  H   E      L      +         R  +   R    G PD L+   +G     
Sbjct: 932  WDRHSLPE------LRAAVTCVGGPCLASLCRHLAQDYRSWSSGMPDLLLWRFHGEYKGE 985

Query: 55   ---IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
               +EVK P   LS QQ + +  L   G   +V  
Sbjct: 986  AKLVEVKGPRDCLSEQQRAWLLLLMDCGFNTEVCK 1020


>gi|56750814|ref|YP_171515.1| hypothetical protein syc0805_c [Synechococcus elongatus PCC 6301]
 gi|81299537|ref|YP_399745.1| hypothetical protein Synpcc7942_0726 [Synechococcus elongatus PCC
           7942]
 gi|56685773|dbj|BAD78995.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81168418|gb|ABB56758.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 120

 Score = 59.7 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 13/91 (14%)

Query: 16  KRLVTGAKKLDCWVRKASFVGRRGCPDRLI-----ITPN------GGLWWIEVKKPTGRL 64
           +  V   K  D    +       G  D +      ITP+           IEVK PTGR+
Sbjct: 26  RNNVGTCKAADGRFVRF--GLCPGSSDLIGLTRVTITPDMVGQTIALFTAIEVKTPTGRV 83

Query: 65  SHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           + +Q S I+ ++R G R  V  SM++ +  +
Sbjct: 84  TPEQQSFIDFVQRSGGRAGVARSMQDANKII 114


>gi|85710998|ref|ZP_01042059.1| hypothetical protein OS145_03185 [Idiomarina baltica OS145]
 gi|85695402|gb|EAQ33339.1| hypothetical protein OS145_03185 [Idiomarina baltica OS145]
          Length = 540

 Score = 59.7 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 18/47 (38%), Gaps = 1/47 (2%)

Query: 36  GRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRV 82
            R G PD  +   +  +  IEVK P   L   Q+  +  L   G   
Sbjct: 487 NRAGFPDLWL-YRDKQVMLIEVKGPGDTLRPNQIRWLRALNEIGVNA 532


>gi|300798539|ref|NP_001178562.1| coiled-coil domain-containing protein MTMR15 [Rattus norvegicus]
 gi|109462100|ref|XP_001058546.1| PREDICTED: myotubularin related protein 15-like [Rattus norvegicus]
          Length = 1020

 Score = 59.7 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P+ RLS +QM  ++EL++ G  V+V 
Sbjct: 958  RGGLPDLVVWNSQSHHCKLVEVKGPSDRLSCKQMIWLDELQKLGADVEVC 1007


>gi|284038012|ref|YP_003387942.1| VRR-NUC domain protein [Spirosoma linguale DSM 74]
 gi|283817305|gb|ADB39143.1| VRR-NUC domain protein [Spirosoma linguale DSM 74]
          Length = 578

 Score = 59.7 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 26/50 (52%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            RG PD LI    G   ++EVK PT  L  QQ+  +E  +  G + KV+ 
Sbjct: 524 TRGFPDLLIWNDQGDYSFVEVKSPTDHLGPQQLHWLEFFQTIGVQGKVVR 573


>gi|326926515|ref|XP_003209445.1| PREDICTED: fanconi-associated nuclease 1-like [Meleagris gallopavo]
          Length = 1041

 Score = 59.4 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++  T +     +EVK P  RLSH+QM  + EL++ G  V+V 
Sbjct: 979  RGGLPDLVVWSTHSNHFKLVEVKGPNDRLSHKQMIWLSELKKLGAAVEVC 1028


>gi|118095660|ref|XP_413768.2| PREDICTED: similar to KIAA1018 protein [Gallus gallus]
          Length = 1034

 Score = 59.4 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++  T +     +EVK P  RLSH+QM  + EL++ G  V+V 
Sbjct: 972  RGGLPDLVVWSTHSNHFKLVEVKGPNDRLSHKQMIWLSELKKLGAAVEVC 1021


>gi|323948952|gb|EGB44846.1| VRR-NUC domain-containing protein [Escherichia coli H252]
          Length = 102

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 28/75 (37%), Gaps = 3/75 (4%)

Query: 29  VRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
             K    G ++G PD  I    GG     IE+K    RL+ +Q+  +  L   G      
Sbjct: 26  AIKMVAEGQKKGYPDLSIDLACGGYHGMRIEMKHGRNRLTPEQLVWMTRLTEAGYYCFEA 85

Query: 86  VSMEEVDNFLEELAC 100
            S  E    + E  C
Sbjct: 86  RSAAEAIKAITEYVC 100


>gi|326789838|ref|YP_004307659.1| VRR-NUC domain-containing protein [Clostridium lentocellum DSM
           5427]
 gi|326540602|gb|ADZ82461.1| VRR-NUC domain-containing protein [Clostridium lentocellum DSM
           5427]
          Length = 128

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 33/83 (39%), Gaps = 6/83 (7%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGRLSHQQMSEIEELRRRG 79
           K+     +K    G + G PD ++    GG    +IE+K    + S +Q   +  L   G
Sbjct: 45  KRDIGTAKKFKLEGVKAGVPDIVLPVSRGGYHGLYIELKVGKNKPSKEQQEWLHRLEAEG 104

Query: 80  QRVKVLVSMEEVDNFLEELACTL 102
                 +  ++    +EE+   L
Sbjct: 105 YYTTWCIGSKQA---IEEIQNYL 124


>gi|308469261|ref|XP_003096869.1| hypothetical protein CRE_24731 [Caenorhabditis remanei]
 gi|308241284|gb|EFO85236.1| hypothetical protein CRE_24731 [Caenorhabditis remanei]
          Length = 860

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD  +  P    +  IEVK P  RLS +Q   +      G   +V 
Sbjct: 799 SRSGFPDLTLWNPEKKTVAVIEVKGPGDRLSTKQRLWLSVFADNGIESEVC 849


>gi|242094870|ref|XP_002437925.1| hypothetical protein SORBIDRAFT_10g004890 [Sorghum bicolor]
 gi|241916148|gb|EER89292.1| hypothetical protein SORBIDRAFT_10g004890 [Sorghum bicolor]
          Length = 920

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 5/54 (9%)

Query: 38  RGCPDRLIIT-----PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD L+         G    +EVK P  +LS QQ + I  L   G  V+V  
Sbjct: 859 SGMPDLLLWRFLDERGGGEAKLVEVKGPRDQLSEQQRAWILVLMDFGFDVEVCK 912


>gi|222635045|gb|EEE65177.1| hypothetical protein OsJ_20287 [Oryza sativa Japonica Group]
          Length = 848

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 5/54 (9%)

Query: 38  RGCPDRLIIT-----PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD L+         G    +EVK P  +LS QQ + I  L   G  V+V  
Sbjct: 787 SGMPDLLLWRFLDERGGGEAKLVEVKGPRDQLSEQQRAWILVLMDFGFDVEVCK 840


>gi|218197677|gb|EEC80104.1| hypothetical protein OsI_21850 [Oryza sativa Indica Group]
          Length = 949

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 5/54 (9%)

Query: 38  RGCPDRLIIT-----PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD L+         G    +EVK P  +LS QQ + I  L   G  V+V  
Sbjct: 888 SGMPDLLLWRFLDERGGGEAKLVEVKGPRDQLSEQQRAWILVLMDFGFDVEVCK 941


>gi|115466676|ref|NP_001056937.1| Os06g0171800 [Oryza sativa Japonica Group]
 gi|75108875|sp|Q5SNL7|FAN1_ORYSJ RecName: Full=Fanconi-associated nuclease 1 homolog
 gi|55773650|dbj|BAD72189.1| unknown protein [Oryza sativa Japonica Group]
 gi|113594977|dbj|BAF18851.1| Os06g0171800 [Oryza sativa Japonica Group]
          Length = 964

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 5/54 (9%)

Query: 38  RGCPDRLIIT-----PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD L+         G    +EVK P  +LS QQ + I  L   G  V+V  
Sbjct: 903 SGMPDLLLWRFLDERGGGEAKLVEVKGPRDQLSEQQRAWILVLMDFGFDVEVCK 956


>gi|26988286|ref|NP_743711.1| hypothetical protein PP_1554 [Pseudomonas putida KT2440]
 gi|24983031|gb|AAN67175.1|AE016345_10 hypothetical protein PP_1554 [Pseudomonas putida KT2440]
          Length = 140

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 26/82 (31%), Gaps = 5/82 (6%)

Query: 24  KLDCWVRKASFVG-RRGCPDRLIITPNGGL--WWIEVKKPTGR--LSHQQMSEIEELRRR 78
           +      K    G + G PD ++    GG    +IE K       +S  Q + I  L  +
Sbjct: 51  RHKGVALKLKAQGVKAGIPDLVLTMARGGYFGLYIEFKATVDPAPVSSSQQACIRRLNDQ 110

Query: 79  GQRVKVLVSMEEVDNFLEELAC 100
           G    V     +    L     
Sbjct: 111 GYLAVVCQGHFDAMACLRAYLA 132


>gi|308477401|ref|XP_003100914.1| hypothetical protein CRE_16875 [Caenorhabditis remanei]
 gi|308264258|gb|EFP08211.1| hypothetical protein CRE_16875 [Caenorhabditis remanei]
          Length = 860

 Score = 59.0 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD  +  P    +  IEVK P  RLS +Q   +      G   +V 
Sbjct: 799 SRSGFPDLTLWNPEKKTVAVIEVKGPGDRLSTKQRLWLSVFADNGIESEVC 849


>gi|312884144|ref|ZP_07743856.1| hypothetical protein VIBC2010_17315 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368192|gb|EFP95732.1| hypothetical protein VIBC2010_17315 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 542

 Score = 59.0 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 20/49 (40%), Gaps = 1/49 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD ++   +    W+EVK P  ++   Q     +  R G    V 
Sbjct: 485 RNGMPDLILF-KDSKYEWVEVKGPGDKIQDNQWRWFSQFLRIGVPFAVA 532


>gi|91976635|ref|YP_569294.1| hypothetical protein RPD_2158 [Rhodopseudomonas palustris BisB5]
 gi|91683091|gb|ABE39393.1| hypothetical protein RPD_2158 [Rhodopseudomonas palustris BisB5]
          Length = 160

 Score = 59.0 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 1/64 (1%)

Query: 35  VGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
            G  G PD  II   G  +++E+K   GR+   Q      LR  G    V   + E    
Sbjct: 81  GGSAGVPDICIIWR-GVTYFLEMKALKGRVRPAQHVMAARLRGAGAICAVAKGLHEAIAQ 139

Query: 95  LEEL 98
           LE+ 
Sbjct: 140 LEKW 143


>gi|322656975|gb|EFY53259.1| putative norphogenetic protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
          Length = 98

 Score = 59.0 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 28/75 (37%), Gaps = 3/75 (4%)

Query: 29  VRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
             K    G ++G PD  I    GG     IE+K    RL+ +Q+  +  L   G      
Sbjct: 22  AIKMVAEGQKKGYPDLSIDLACGGCHGMRIEMKHGRNRLTPEQLVWMTRLTEAGYYCFEA 81

Query: 86  VSMEEVDNFLEELAC 100
            S  E    + E  C
Sbjct: 82  RSAAEAIKAITEYVC 96


>gi|261599115|ref|YP_003257363.1| hypothetical protein BPLAN_p003 [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
 gi|261497772|gb|ACX84221.1| conserved hypothetical protein [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
          Length = 144

 Score = 59.0 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 37/103 (35%), Gaps = 17/103 (16%)

Query: 2   SFYSFHYQTEKDV---EKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITP--NGGLWWIE 56
           + + FH   E      E+ L+   +             R G PD L+  P        +E
Sbjct: 46  NVFYFHPHNEAKRTPYERFLMKVMR------------LRPGVPDILVPFPQQGNTGMALE 93

Query: 57  VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
            K    +L+  Q + I  L     +V V  + ++  N +++  
Sbjct: 94  FKIKPNKLTENQKNIISILNSYKWKVYVCYNFDQAKNNIDQYL 136


>gi|324509622|gb|ADY44042.1| Fanconi-associated nuclease 1 [Ascaris suum]
          Length = 488

 Score = 59.0 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD  I     G L   EVK P  +LS +Q   ++     G    V 
Sbjct: 426 RSGFPDLTIWNDESGKLAVAEVKGPGDKLSTKQRLWLQYFSEHGVTAHVC 475


>gi|332143320|ref|YP_004429058.1| DNA polymerase III, epsilon subunit [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327553342|gb|AEB00061.1| DNA polymerase III, epsilon subunit [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 715

 Score = 58.6 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 4/84 (4%)

Query: 3   FYSFHYQT--EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
            +S H  T  E  +E   ++    L   + K     R G PD +++  +      E+K P
Sbjct: 449 MWSSHLLTPIEALIEHGSLSAIYALLRMMSKDFESLRDGFPDIMVLDDSLRFE--EIKAP 506

Query: 61  TGRLSHQQMSEIEELRRRGQRVKV 84
             +L   Q+  I+ L++ G  V V
Sbjct: 507 GDQLRRNQLVSIQRLQQAGFDVAV 530


>gi|301610854|ref|XP_002934961.1| PREDICTED: coiled-coil domain-containing protein MTMR15-like
           [Xenopus (Silurana) tropicalis]
          Length = 865

 Score = 58.6 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 39  GCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           G PD ++          +EVK P  RLSH+Q+  + EL++ G  V+V 
Sbjct: 805 GLPDLVVWNGQTKQYKLVEVKGPNDRLSHKQIIWLHELQKLGASVEVC 852


>gi|186489458|ref|NP_001117447.1| hydrolase, acting on acid anhydrides, in phosphorus-containing
           anhydrides / nucleic acid binding / zinc ion binding
           [Arabidopsis thaliana]
 gi|306755802|sp|Q5XVJ4|FAN1_ARATH RecName: Full=Fanconi-associated nuclease 1 homolog
 gi|332194158|gb|AEE32279.1| fanconi-associated nuclease 1-like protein [Arabidopsis thaliana]
          Length = 891

 Score = 58.6 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 5/54 (9%)

Query: 38  RGCPDRLIIT-----PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD L+         G    +EVK    RLS QQ + +  L   G  V++  
Sbjct: 829 SGMPDLLVWRFKENGYEGEAKLVEVKSEKDRLSEQQRAWLLLLMDSGFNVEICK 882


>gi|8778959|gb|AAD49761.2|AC007932_9 Contains similarity to KIAA1018 protein from Homo sapiens
           gb|AB023235 [Arabidopsis thaliana]
          Length = 896

 Score = 58.6 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 5/54 (9%)

Query: 38  RGCPDRLIIT-----PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD L+         G    +EVK    RLS QQ + +  L   G  V++  
Sbjct: 834 SGMPDLLVWRFKENGYEGEAKLVEVKSEKDRLSEQQRAWLLLLMDSGFNVEICK 887


>gi|330974353|gb|EGH74419.1| VRR-NUC domain-containing protein [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 133

 Score = 58.2 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 31/100 (31%), Gaps = 14/100 (14%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKK--P 60
            +H        K++    K+            R G PD ++    GG    +IE K   P
Sbjct: 43  IYHVPNGGHRLKQVAVKLKEQGV---------RAGVPDLVLPMARGGYFGLYIEFKATPP 93

Query: 61  TGR-LSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
               +S  Q   I +L  +G    V     +    +    
Sbjct: 94  NDAAVSGSQYEWIRQLNLQGYLAIVCRGHFDAMEQIRAYL 133


>gi|256072887|ref|XP_002572765.1| hypothetical protein [Schistosoma mansoni]
 gi|238657929|emb|CAZ28997.1| expressed protein [Schistosoma mansoni]
          Length = 811

 Score = 58.2 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD L+ +P       +EVK P   LS QQ+  ++ L + G  V++ 
Sbjct: 746 RSGLPDLLLWSPTETRAKIVEVKGPGDHLSTQQIMWLDVLVQAGADVEIC 795


>gi|219363657|ref|NP_001137059.1| hypothetical protein LOC100217231 [Zea mays]
 gi|194698198|gb|ACF83183.1| unknown [Zea mays]
          Length = 386

 Score = 58.2 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 5/54 (9%)

Query: 38  RGCPDRLIIT-----PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD L+         G    +EVK P  +LS QQ + I  L   G  V+V  
Sbjct: 325 SGMPDLLLWRFLDERGGGEAKLVEVKGPRDQLSEQQRAWILVLMDFGFDVEVCK 378


>gi|319411650|emb|CBQ73694.1| conserved hypothetical protein [Sporisorium reilianum]
          Length = 933

 Score = 58.2 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 38  RGCPDRLIIT-PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRV 82
            G PD ++    +  + ++EVK P  RLS  Q   I+ L R G  V
Sbjct: 880 SGMPDLVVWRMRDKVVRFVEVKGPGDRLSETQKVWIDVLLRAGVEV 925


>gi|239834262|ref|ZP_04682590.1| p103 [Ochrobactrum intermedium LMG 3301]
 gi|239822325|gb|EEQ93894.1| p103 [Ochrobactrum intermedium LMG 3301]
          Length = 170

 Score = 58.2 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 21/49 (42%)

Query: 38  RGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD  I    G L  IE K   GRLS  Q      L+R G  V V+ 
Sbjct: 94  SGEPDLRIYGEYGRLLMIENKVGQGRLSPAQKDRHAALQRLGYTVLVIR 142


>gi|72006605|ref|XP_783783.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115683293|ref|XP_001202897.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 956

 Score = 57.8 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD  +  P       +EVK P  RLS +Q+  I+   R G   +V 
Sbjct: 874 RAGRPDLTMWNPETKKFKLVEVKGPGDRLSQKQILWIDFFLRHGIEAEVC 923


>gi|83643765|ref|YP_432200.1| hypothetical protein HCH_00883 [Hahella chejuensis KCTC 2396]
 gi|83631808|gb|ABC27775.1| conserved hypothetical protein [Hahella chejuensis KCTC 2396]
          Length = 554

 Score = 57.8 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 29/87 (33%), Gaps = 13/87 (14%)

Query: 1   MSFYSFHYQTEK--DVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVK 58
           +S        E    V +R++   ++              G PD +     GG   +EVK
Sbjct: 474 ISLALERIPREHWRAVFQRMLRDLRENG-----------SGFPDLIHFPEQGGYELLEVK 522

Query: 59  KPTGRLSHQQMSEIEELRRRGQRVKVL 85
            PT  L   Q   +    +     +++
Sbjct: 523 SPTDSLQPNQKRWMATFEKNDIPYQLV 549


>gi|148675312|gb|EDL07259.1| mCG11826 [Mus musculus]
          Length = 985

 Score = 57.8 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD ++          +EVK P+ RLS +QM  + EL++ G  V+V 
Sbjct: 923 RGGLPDLVVWNSQSHHCKLVEVKGPSDRLSCKQMIWLYELQKLGADVEVC 972


>gi|257467664|ref|NP_808561.2| fanconi-associated nuclease 1 [Mus musculus]
 gi|160409997|sp|Q69ZT1|FAN1_MOUSE RecName: Full=Fanconi-associated nuclease 1; AltName:
            Full=FANCD2/FANCI-associated nuclease 1; AltName:
            Full=Myotubularin-related protein 15
          Length = 1020

 Score = 57.8 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 37   RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            R G PD ++          +EVK P+ RLS +QM  + EL++ G  V+V 
Sbjct: 958  RGGLPDLVVWNSQSHHCKLVEVKGPSDRLSCKQMIWLYELQKLGADVEVC 1007


>gi|254482689|ref|ZP_05095927.1| VRR-NUC domain family protein [marine gamma proteobacterium
           HTCC2148]
 gi|214037048|gb|EEB77717.1| VRR-NUC domain family protein [marine gamma proteobacterium
           HTCC2148]
          Length = 540

 Score = 57.8 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 20/52 (38%), Gaps = 1/52 (1%)

Query: 36  GRRGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            RRG PD L +    G    IEVK P   L   Q   +   ++      ++ 
Sbjct: 483 NRRGFPDLLALGIEPGDYQMIEVKGPGDALQDSQKRWLRFFQQEDIPASIVW 534


>gi|330447631|ref|ZP_08311279.1| VRR-NUC domain protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491822|dbj|GAA05776.1| VRR-NUC domain protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 549

 Score = 57.8 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 29/71 (40%), Gaps = 5/71 (7%)

Query: 16  KRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEEL 75
            +LV   ++L     K     R G PD ++   +    W+EVK P  +L + Q+  +   
Sbjct: 478 SQLVAMFRRL----LKDLRHHRSGMPDLIMFN-DTSYQWVEVKGPGDKLQNHQLRWLAFF 532

Query: 76  RRRGQRVKVLV 86
            +     +V  
Sbjct: 533 EQHQIPAQVAY 543


>gi|242007663|ref|XP_002424650.1| conserved hypothetical protein [Pediculus humanus corporis]
 gi|212508124|gb|EEB11912.1| conserved hypothetical protein [Pediculus humanus corporis]
          Length = 718

 Score = 57.4 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 24/59 (40%), Gaps = 1/59 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
              K   + R G PD  +  P      ++EVK P  RLS  Q   ++ L +     +V 
Sbjct: 655 RFTKNFKLARVGFPDLTLWNPETQKYKFVEVKSPNDRLSSAQKIWLDYLIKNDIDCEVC 713


>gi|303276314|ref|XP_003057451.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226461803|gb|EEH59096.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 960

 Score = 57.4 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 7/55 (12%)

Query: 39  GCPDRLIITPNG-------GLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           G PD ++    G        +  +EVK    RLS QQ + +  LR  G  V V  
Sbjct: 904 GAPDLILWRRRGSGAGARAEVKCVEVKSANDRLSDQQRAWLLALRDAGVDVVVCK 958


>gi|242223580|ref|XP_002477396.1| predicted protein [Postia placenta Mad-698-R]
 gi|220723065|gb|EED77405.1| predicted protein [Postia placenta Mad-698-R]
          Length = 77

 Score = 57.4 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 5/52 (9%)

Query: 39 GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMS----EIEELRRRGQRVKVL 85
          G PD +I         +IEVK P  +L   Q +     I+ L + G  V+V 
Sbjct: 24 GVPDLIIWNAEAKECKFIEVKGPGDKLQENQKASFFVWIDVLLQAGIPVEVC 75


>gi|148653133|ref|YP_001280226.1| hypothetical protein PsycPRwf_1331 [Psychrobacter sp. PRwf-1]
 gi|148572217|gb|ABQ94276.1| VRR-NUC [Psychrobacter sp. PRwf-1]
          Length = 148

 Score = 57.4 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 35/96 (36%), Gaps = 4/96 (4%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKP 60
           Y  H         ++ +  K+      K   +G + G PD +I    G      IE+KK 
Sbjct: 34  YIHHSPNGGKRAAKIGSSGKRYSPEAAKFKRMGVKAGYPDLIIDIARGAYHGLRIEIKKD 93

Query: 61  TG-RLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
                +  Q   IE L + G    V   ++ V + +
Sbjct: 94  GNSYATPAQKERIEMLAKEGYCAVVAKGIDNVISVI 129


>gi|297847092|ref|XP_002891427.1| hypothetical protein ARALYDRAFT_473972 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297337269|gb|EFH67686.1| hypothetical protein ARALYDRAFT_473972 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 882

 Score = 57.4 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 5/54 (9%)

Query: 38  RGCPDRLIIT-----PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD L+         G    +EVK    RLS QQ + +  L   G  V++  
Sbjct: 820 SGMPDLLLWRFKENGYEGEAKLVEVKSERDRLSEQQRAWLLLLMDSGFNVEICK 873


>gi|308097734|gb|ADO14413.1| AB1gp42 [Acinetobacter phage AB1]
          Length = 101

 Score = 57.4 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 42/103 (40%), Gaps = 13/103 (12%)

Query: 1  MSFYSFHYQTEKDV---EKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEV 57
          M F          +   +  +V   +K+ C V+  S VG+ GCPD L+    G  + +E+
Sbjct: 1  MEFIEKTPMRAAKIDANQPEIVAALRKIGCTVQILSSVGK-GCPDILVGYR-GKNFLLEI 58

Query: 58 KKPTG-----RLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
          K         +L+  Q+   +       +V V+  +++    +
Sbjct: 59 KDGAKPVSAQKLTPDQIEWHDLWN---GQVNVVNCVDQAIQVV 98


>gi|149197339|ref|ZP_01874390.1| hypothetical protein LNTAR_00120 [Lentisphaera araneosa HTCC2155]
 gi|149139357|gb|EDM27759.1| hypothetical protein LNTAR_00120 [Lentisphaera araneosa HTCC2155]
          Length = 517

 Score = 57.4 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 27/65 (41%)

Query: 21  GAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQ 80
             K +   + K     ++G PD +     GG+  IE+K P  RL   Q + +     +  
Sbjct: 448 QIKSIFIELLKDLRNKKKGFPDLIHFPHQGGVELIEIKAPGDRLQKHQNTWLNFFEDKKI 507

Query: 81  RVKVL 85
           + +V 
Sbjct: 508 KARVA 512


>gi|302189704|ref|ZP_07266377.1| VRR-NUC domain-containing protein [Pseudomonas syringae pv.
           syringae 642]
          Length = 143

 Score = 57.4 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 31/100 (31%), Gaps = 14/100 (14%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKK--P 60
            +H        K++    K+            R G PD ++    GG    +IE K   P
Sbjct: 44  IYHVPNGGHRLKQVAVKLKEQGV---------RAGVPDLVLPMARGGYFGLYIEFKATPP 94

Query: 61  TGR-LSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
               +S  Q   I +L  +G    +     +    +    
Sbjct: 95  NDAAVSGSQYEWIRQLNLQGYLAIICRGHFDAMEQIRAYL 134


>gi|242803755|ref|XP_002484238.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500]
 gi|218717583|gb|EED17004.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500]
          Length = 825

 Score = 57.4 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +  P+   + + EVK    RLS  Q   I  L   G +V++  ++
Sbjct: 768 GIPDLFLWNPDKKEVMFAEVKSENDRLSDTQRLWIHVLTGAGVKVELCNAV 818


>gi|313123976|ref|YP_004034235.1| phage protein [Lactobacillus delbrueckii subsp. bulgaricus ND02]
 gi|312280539|gb|ADQ61258.1| Phage protein [Lactobacillus delbrueckii subsp. bulgaricus ND02]
          Length = 81

 Score = 57.0 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 42 DRLIITPNG-GLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
          D      +G  +++IE+K  TG+    Q+   E L R G    +  S E+    ++E
Sbjct: 16 DLYGFKHDGGKIFYIEMKDKTGKARDSQIRFHEMLSRWGVIHGIARSPEDALKIVDE 72


>gi|326201158|ref|ZP_08191030.1| VRR-NUC domain-containing protein [Clostridium papyrosolvens DSM
           2782]
 gi|325988726|gb|EGD49550.1| VRR-NUC domain-containing protein [Clostridium papyrosolvens DSM
           2782]
          Length = 601

 Score = 57.0 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 28  WVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            + +     R G PD L+   +  L+  EVK    +LS  Q + I+ L   G RV++ 
Sbjct: 193 RILRNISENRSGLPDLLV-YNDSILFMSEVKSEKDKLSEGQKNWIDFLESTGIRVELC 249


>gi|325292909|ref|YP_004278773.1| hypothetical protein AGROH133_06209 [Agrobacterium sp. H13-3]
 gi|325060762|gb|ADY64453.1| hypothetical protein AGROH133_06209 [Agrobacterium sp. H13-3]
          Length = 157

 Score = 57.0 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 22/55 (40%)

Query: 32  ASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            +     G  D  I    G L  IE K   GRLS  Q+     L R G  V+V+ 
Sbjct: 76  IATGMTPGEADLRIYLKGGKLRMIENKVGKGRLSPAQVERHASLARLGHPVEVVR 130


>gi|298486621|ref|ZP_07004679.1| hypothetical protein PSA3335_2061 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298158836|gb|EFH99898.1| hypothetical protein PSA3335_2061 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 143

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 29/100 (29%), Gaps = 14/100 (14%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKP-- 60
            +H        K +    K+            R G PD ++    GG    +IE K    
Sbjct: 44  IYHVPNGGHRHKLVAIKLKEQGV---------RAGVPDLVLPMARGGYFGLYIEFKATPP 94

Query: 61  -TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
               +S  Q   I +L  +G    V     +    +    
Sbjct: 95  HDAAVSGSQYEWIRQLGAQGYLAIVCRGHFDAMEQIRAYL 134


>gi|153806932|ref|ZP_01959600.1| hypothetical protein BACCAC_01208 [Bacteroides caccae ATCC 43185]
 gi|149131609|gb|EDM22815.1| hypothetical protein BACCAC_01208 [Bacteroides caccae ATCC 43185]
          Length = 135

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 11/64 (17%), Positives = 22/64 (34%), Gaps = 2/64 (3%)

Query: 38  RGCPDRLIITPNGGL--WWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
            G  D +++  N       IE K   G     Q     ++   G +  V  S+++    +
Sbjct: 69  PGVSDLILLKSNRFYGALLIETKTKKGVQRESQKEWEAKITADGYKYVVCRSLDDFIKVV 128

Query: 96  EELA 99
            +  
Sbjct: 129 TDYL 132


>gi|332017624|gb|EGI58321.1| Coiled-coil domain-containing protein MTMR15 [Acromyrmex
           echinatior]
          Length = 946

 Score = 56.7 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 22/56 (39%), Gaps = 1/56 (1%)

Query: 37  RRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
           + G PD ++   N      +EVK P   LS +Q   +  L R G   +V       
Sbjct: 876 KAGFPDIIVWNINTKQYKIVEVKGPNDTLSTKQTLWLNYLNRIGLNTEVCYCESNA 931


>gi|212539750|ref|XP_002150030.1| conserved hypothetical protein [Penicillium marneffei ATCC 18224]
 gi|210067329|gb|EEA21421.1| conserved hypothetical protein [Penicillium marneffei ATCC 18224]
          Length = 825

 Score = 56.7 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +  P+   + + EVK    RLS  Q   I  L   G  V++  ++
Sbjct: 768 GIPDLFLWNPDKKEVMFAEVKSENDRLSDTQRLWIHVLMGAGVNVELCNAV 818


>gi|255036461|ref|YP_003087082.1| VRR-NUC domain-containing protein [Dyadobacter fermentans DSM
           18053]
 gi|254949217|gb|ACT93917.1| VRR-NUC domain protein [Dyadobacter fermentans DSM 18053]
          Length = 578

 Score = 56.7 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             RG PD L+   +    +IE+K PT  LS +Q+         G + +++ 
Sbjct: 518 NTRGFPDLLVWNDD-DYAFIEIKSPTDHLSSRQLHWQHFFAEHGVQSRIVR 567


>gi|170577404|ref|XP_001893991.1| KIAA1018 protein [Brugia malayi]
 gi|158599640|gb|EDP37170.1| KIAA1018 protein, putative [Brugia malayi]
          Length = 455

 Score = 56.7 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLW-WIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD  I      L   +EVK P  +LS +Q   +   + +     V 
Sbjct: 395 RSGFPDLTIWNDEKKLLAVVEVKGPGDKLSTKQRLWLSFFKNQNIIAHVC 444


>gi|77360920|ref|YP_340495.1| hypothetical protein PSHAa1996 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76875831|emb|CAI87052.1| conserved protein of unknown function; putative enzyme
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 730

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           + G PD ++I  NG + + EVK P  +L   Q++ I+ L+  G  V + 
Sbjct: 508 KDGYPDLMVIH-NGKVHFEEVKAPGDKLRRNQLTTIDNLKSSGFEVHIA 555


>gi|258576347|ref|XP_002542355.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237902621|gb|EEP77022.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 838

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +  T    + ++EVK P  RLS  Q   I  L   G +V++  ++
Sbjct: 780 GVPDLFLWSTEKSEVMFVEVKSPNDRLSDSQRLWIHVLTGAGIKVELCNAV 830


>gi|255554375|ref|XP_002518227.1| conserved hypothetical protein [Ricinus communis]
 gi|223542632|gb|EEF44170.1| conserved hypothetical protein [Ricinus communis]
          Length = 188

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 20/53 (37%), Gaps = 4/53 (7%)

Query: 38  RGCPDRLIITPNGGL----WWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD  +    G        +EVK P   LS QQ + +  L   G   +V  
Sbjct: 128 SGMPDLFLWRFQGEYRGEAKLVEVKGPKDSLSEQQQAWLLLLMDCGFSTEVCK 180


>gi|170103484|ref|XP_001882957.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164642328|gb|EDR06585.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 1062

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 32/104 (30%), Gaps = 27/104 (25%)

Query: 15  EKRLVTGAKKLDCWVRKASF-------VGRR-GCPDRLIITPNGGLWWIEVKKPTGRLSH 66
           ++ LV   + L                 GR  G PD ++   +G   ++EVK P  RL  
Sbjct: 843 KQDLVEIVECLGGESLAIVCRLFCDDYGGRSSGVPDLIVW-KDGLCKFVEVKGPGDRLQE 901

Query: 67  QQMS------------------EIEELRRRGQRVKVLVSMEEVD 92
            Q                      + L R    V+V   ++   
Sbjct: 902 NQKVDSLVPLLSHAAKFPLSKLWSDTLLRANTEVEVCKVLDAAK 945


>gi|225155716|ref|ZP_03724204.1| hypothetical protein ObacDRAFT_9592 [Opitutaceae bacterium TAV2]
 gi|224803510|gb|EEG21745.1| hypothetical protein ObacDRAFT_9592 [Opitutaceae bacterium TAV2]
          Length = 130

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 27/65 (41%), Gaps = 6/65 (9%)

Query: 37  RRGCPDRLIITPN------GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEE 90
           R G PD  +  PN          ++E K   GR+  +Q   +  LR +G    V+ + ++
Sbjct: 55  RAGIPDICLAVPNITRGGKAHGLFLEFKTTIGRVREEQQQVMSALRGQGYEAVVVRTFDQ 114

Query: 91  VDNFL 95
               +
Sbjct: 115 AQQAV 119


>gi|328785107|ref|XP_003250543.1| PREDICTED: fanconi-associated nuclease 1-like [Apis mellifera]
          Length = 521

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           R G PD ++   +      IEVK P   LS +Q   +E L + G  ++V 
Sbjct: 466 RAGFPDLIVWNYDTKEHKIIEVKGPRDILSTKQKLWLEYLHQLGLNIEVC 515


>gi|119471121|ref|ZP_01613653.1| hypothetical protein ATW7_09096 [Alteromonadales bacterium TW-7]
 gi|119445777|gb|EAW27059.1| hypothetical protein ATW7_09096 [Alteromonadales bacterium TW-7]
          Length = 745

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           + G PD ++I  NG + + EVK P  +L   Q++ I+ L+  G  V + 
Sbjct: 520 KDGYPDLMVIN-NGQVHFEEVKAPGDKLRRNQLTTIDNLKNVGFTVHIA 567


>gi|332038297|gb|EGI74742.1| DNA polymerase III epsilon subunit [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 671

 Score = 56.3 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           + G PD ++I  NG + + EVK P  +L   Q++ I+ L++ G  V + 
Sbjct: 508 KDGYPDLMVIN-NGQVHFEEVKAPGDKLRRNQLTTIDNLKKVGFTVHIA 555


>gi|119774803|ref|YP_927543.1| hypothetical protein Sama_1667 [Shewanella amazonensis SB2B]
 gi|119767303|gb|ABL99873.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 600

 Score = 55.9 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 9/67 (13%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV--------SM 88
           R G PD  ++  +G L ++EVK P  RL+  Q   +  L  +    +VL         + 
Sbjct: 530 RSGFPDL-VLIRDGQLAFVEVKGPGDRLADHQKDWLSWLGNKEMASEVLWVTWRTEQATD 588

Query: 89  EEVDNFL 95
           EE  + +
Sbjct: 589 EEAKDVI 595


>gi|164657566|ref|XP_001729909.1| hypothetical protein MGL_2895 [Malassezia globosa CBS 7966]
 gi|159103803|gb|EDP42695.1| hypothetical protein MGL_2895 [Malassezia globosa CBS 7966]
          Length = 711

 Score = 55.9 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 20/52 (38%), Gaps = 1/52 (1%)

Query: 36  GRRGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
              G PD  +    +  +   EVK P  RL+  Q   I+ L   G  V +  
Sbjct: 639 NTSGFPDLTLWRYEDKQIRMAEVKSPKDRLNESQRVWIDALLSAGICVDLAK 690


>gi|303328400|ref|ZP_07358837.1| hypothetical protein HMPREF0326_03024 [Desulfovibrio sp.
          3_1_syn3]
 gi|302861394|gb|EFL84331.1| hypothetical protein HMPREF0326_03024 [Desulfovibrio sp.
          3_1_syn3]
          Length = 95

 Score = 55.9 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 15 EKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVK----KPTGR-LSHQQM 69
          ++ +V   ++  C V   S VGR GCPD  +    G  + +E+K     P+ R L+  Q 
Sbjct: 11 QRDIVAALRRAGCSVLILSGVGR-GCPDIAVGLR-GVTYMLEIKDGKKAPSDRGLTPDQK 68

Query: 70 SEIEELRRRGQRVKVLVSMEEVDNFL 95
              + R       V+ S+++    +
Sbjct: 69 DWHTKWR---GHAAVVQSVDDALRAV 91


>gi|308048398|ref|YP_003911964.1| VRR-NUC domain protein [Ferrimonas balearica DSM 9799]
 gi|307630588|gb|ADN74890.1| VRR-NUC domain protein [Ferrimonas balearica DSM 9799]
          Length = 546

 Score = 55.9 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD +++   G L  +EVK P   L   Q   + EL R G   +VL 
Sbjct: 489 RSGQPDLMVVDK-GALTLVEVKGPGDSLRDHQRRWLAELDRLGVASRVLW 537


>gi|237803705|ref|ZP_04591290.1| VRR-NUC domain-containing protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025687|gb|EGI05743.1| VRR-NUC domain-containing protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 143

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 29/100 (29%), Gaps = 14/100 (14%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKP-- 60
            +H        K +    K+            R G PD ++    GG    +IE K    
Sbjct: 44  IYHVPNGGHRHKLVAIKLKEQGV---------RAGVPDLVLPMARGGYFGLYIEFKATPP 94

Query: 61  -TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
               +S  Q   I +L  +G    +     +    +    
Sbjct: 95  HDAAVSGSQYEWIRQLNEQGYLAIICCGHFDAMEQIRAYL 134


>gi|317485522|ref|ZP_07944399.1| VRR-NUC domain-containing protein [Bilophila wadsworthia 3_1_6]
 gi|316923202|gb|EFV44411.1| VRR-NUC domain-containing protein [Bilophila wadsworthia 3_1_6]
          Length = 178

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 35/97 (36%), Gaps = 12/97 (12%)

Query: 3   FYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLW--WIEVKKP 60
           F  +H       +K      K               G PD  + +P  G    +IE+K+ 
Sbjct: 55  FVMYHIPNGGRRDKITGARLKAEGVVA---------GVPDIFLASPRQGFHGLYIEMKRQ 105

Query: 61  -TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
             G +   Q   I  LR+ G RV+V +   E    +E
Sbjct: 106 RGGTVQATQKELITALRQAGYRVEVCMGWWEAREAIE 142


>gi|300772205|ref|ZP_07082075.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300760508|gb|EFK57334.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 118

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 26/59 (44%), Gaps = 1/59 (1%)

Query: 34  FVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVD 92
                G PD  ++   G  +  E+K  +G++S +Q    +  +  G  V ++ S EE  
Sbjct: 45  SGVVAGIPD-CVLIHMGNAYGFEMKTQSGKVSPEQQKVHKVWQDDGTPVYIIRSFEEFQ 102


>gi|146341316|ref|YP_001206364.1| DNA-directed DNA polymerase [Bradyrhizobium sp. ORS278]
 gi|146194122|emb|CAL78141.1| hypothetical protein; putative DNA-directed DNA polymerase
           [Bradyrhizobium sp. ORS278]
          Length = 737

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV-----SMEEV 91
           R G PD + +  +G + ++EVK     +   Q++ + +L + G   ++         E+ 
Sbjct: 504 RDGFPDLMQVR-DGKVTFVEVKAEGDAIRRNQLTRLRQLEQAGIPAEIGRVDYRFDPEQ- 561

Query: 92  DNFLEELACT 101
           D  + ++  T
Sbjct: 562 DYVVVDIETT 571


>gi|167519094|ref|XP_001743887.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163777849|gb|EDQ91465.1| predicted protein [Monosiga brevicollis MX1]
          Length = 890

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 9/56 (16%)

Query: 39  GCPDRLIITPN---------GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           G PD L+             G   ++EVK P  RLS +Q   +  L+  G    V 
Sbjct: 814 GLPDLLLWRAEYDADGHLTSGQARFVEVKSPNDRLSDKQQIWLHVLQEVGAAAGVC 869


>gi|148549333|ref|YP_001269435.1| VRR-NUC domain-containing protein [Pseudomonas putida F1]
 gi|148513391|gb|ABQ80251.1| VRR-NUC domain protein [Pseudomonas putida F1]
          Length = 142

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 29/100 (29%), Gaps = 14/100 (14%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKK--P 60
            +H        K +    K             + G PD ++    GG    +IE K   P
Sbjct: 44  IYHVPNGGHRVKAVAAKLKGQGV---------KAGVPDLVLPMARGGYFGLYIEFKAMPP 94

Query: 61  TGRL-SHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
                S  Q + ++ L  +G    V     +    +    
Sbjct: 95  YDAPVSPSQDAYLQALADQGYLAIVCRGNIDAVEAIRAYL 134


>gi|213970579|ref|ZP_03398706.1| VRR-NUC domain protein [Pseudomonas syringae pv. tomato T1]
 gi|213924750|gb|EEB58318.1| VRR-NUC domain protein [Pseudomonas syringae pv. tomato T1]
          Length = 138

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 29/100 (29%), Gaps = 14/100 (14%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKP-- 60
            +H        K +    K+            R G PD ++    GG    +IE K    
Sbjct: 39  IYHVPNGGHRHKLVAIKLKEQGV---------RAGVPDLVLPMARGGYFGLYIEFKATPP 89

Query: 61  -TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
               +S  Q   I +L  +G    +     +    +    
Sbjct: 90  HDAAVSGSQYEWIRQLGEQGYLAIICRGHFDAMEQIRAYL 129


>gi|301381633|ref|ZP_07230051.1| VRR-NUC domain-containing protein [Pseudomonas syringae pv. tomato
           Max13]
          Length = 143

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 29/100 (29%), Gaps = 14/100 (14%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKP-- 60
            +H        K +    K+            R G PD ++    GG    +IE K    
Sbjct: 44  IYHVPNGGHRHKLVAIKLKEQGV---------RAGVPDLVLPMARGGYFGLYIEFKATPP 94

Query: 61  -TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
               +S  Q   I +L  +G    +     +    +    
Sbjct: 95  HDAAVSGSQYEWIRQLGEQGYLAIICRGHFDAMEQIRAYL 134


>gi|119476027|ref|ZP_01616379.1| hypothetical protein GP2143_05540 [marine gamma proteobacterium
           HTCC2143]
 gi|119450654|gb|EAW31888.1| hypothetical protein GP2143_05540 [marine gamma proteobacterium
           HTCC2143]
          Length = 560

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/46 (23%), Positives = 17/46 (36%), Gaps = 4/46 (8%)

Query: 36  GRRGCPDRLIITPNGG----LWWIEVKKPTGRLSHQQMSEIEELRR 77
            R G PD +    +         +EVK P  +L + Q   I+    
Sbjct: 499 NRSGFPDLICFNCDDKNGHSYLMVEVKGPGDKLQNNQKRWIKTFAS 544


>gi|71649453|ref|XP_813450.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70878333|gb|EAN91599.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 1004

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 6/58 (10%)

Query: 38  RGCPDRLIITP------NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSME 89
            G PD ++               +EVK P  RLS +QM+ I+ L R G  V V   +E
Sbjct: 913 SGFPDLVLWRETPLSLVETEFKLVEVKSPNDRLSDKQMAAIDALCRCGFDVTVARVVE 970


>gi|213408689|ref|XP_002175115.1| coiled-coil domain-containing protein MTMR15 [Schizosaccharomyces
           japonicus yFS275]
 gi|212003162|gb|EEB08822.1| coiled-coil domain-containing protein MTMR15 [Schizosaccharomyces
           japonicus yFS275]
          Length = 698

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%)

Query: 38  RGCPDRLIIT--PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN 93
            G PD  +    P      +EVK    RLS  Q   ++ L+  G  V V   + +VD 
Sbjct: 634 SGLPDLCLWREKPELAFCLVEVKSLNDRLSESQKVWLDVLQSNGISVSVCH-VHDVDG 690


>gi|303323195|ref|XP_003071589.1| hypothetical protein CPC735_071260 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240111291|gb|EER29444.1| hypothetical protein CPC735_071260 [Coccidioides posadasii C735
           delta SOWgp]
          Length = 822

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 1/52 (1%)

Query: 38  RGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
            G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 764 SGVPDLFLWSMERKEVMFVEVKSLNDRLSDSQRLWIHVLTGAGVRVELCNAV 815


>gi|119189293|ref|XP_001245253.1| hypothetical protein CIMG_04694 [Coccidioides immitis RS]
          Length = 822

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 1/52 (1%)

Query: 38  RGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
            G PD  +       + ++EVK    RLS  Q   I  L   G +V++  ++
Sbjct: 764 SGVPDLFLWSMERKEVMFVEVKSLNDRLSDSQRLWIHVLTGAGVKVELCNAV 815


>gi|313499028|gb|ADR60394.1| VRR-NUC domain-containing protein [Pseudomonas putida BIRD-1]
          Length = 142

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 29/100 (29%), Gaps = 14/100 (14%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKK--P 60
            +H        K +    K             + G PD ++    GG    +IE K   P
Sbjct: 44  IYHVPNGGHRVKAVAAKLKGQGV---------KAGVPDLVLPMARGGYFGLYIEFKAMPP 94

Query: 61  TGRL-SHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
                S  Q + ++ L  +G    V     +    +    
Sbjct: 95  FDAPVSPSQDAYLQALADQGYLAIVCRGNIDAVEAIRAYL 134


>gi|71665843|ref|XP_819887.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70885208|gb|EAN98036.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 1006

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 6/58 (10%)

Query: 38  RGCPDRLIITP------NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSME 89
            G PD ++               +EVK P  RLS +QM+ I+ L R G  V V   +E
Sbjct: 915 SGFPDLVLWREAPLSLVEPEFKLVEVKSPNDRLSDKQMAAIDALCRCGFDVTVARVVE 972


>gi|33323581|gb|AAQ07551.1|AF503408_75 Upf81.2 [Enterobacteria phage P7]
          Length = 192

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 4/82 (4%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGR-LSHQQMSEIEELRRR 78
           K+      K    G ++G PD  +    G      IE+K+P G+  + +Q++ +  LR  
Sbjct: 91  KRSKATAGKMKAEGQKKGYPDMSLDKACGIYHGMRIELKEPNGKAPTKEQIAWMRRLREE 150

Query: 79  GQRVKVLVSMEEVDNFLEELAC 100
           G  V +    E+    + E   
Sbjct: 151 GYYVVLAYGAEQAITAILEYIS 172


>gi|320033280|gb|EFW15228.1| hypothetical protein CPSG_07667 [Coccidioides posadasii str.
           Silveira]
          Length = 670

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 1/52 (1%)

Query: 38  RGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
            G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 612 SGVPDLFLWSMERKEVMFVEVKSLNDRLSDSQRLWIHVLTGAGVRVELCNAV 663


>gi|240279658|gb|EER43163.1| coiled-coil domain-containing protein MTMR15 [Ajellomyces
           capsulatus H143]
          Length = 820

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 759 GIPDLFLWSMERKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 809


>gi|154280020|ref|XP_001540823.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150412766|gb|EDN08153.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 750

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 689 GIPDLFLWSMERKEVMFVEVKSENDRLSDTQRLWIHMLTGAGVRVELCNAV 739


>gi|115400093|ref|XP_001215635.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114191301|gb|EAU33001.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 805

 Score = 54.7 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM-EEVDNF 94
           G PD  +   +   + ++EVK    RLS  Q   I  L   G RV++  ++ +EV   
Sbjct: 746 GIPDLFLWRMDTKEVMFVEVKSENDRLSDTQRLWIHVLIGAGLRVELCNAVAKEVRRV 803


>gi|325092791|gb|EGC46101.1| coiled-coil domain-containing protein MTMR15 [Ajellomyces
           capsulatus H88]
          Length = 820

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 759 GIPDLFLWSMERKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 809


>gi|168024880|ref|XP_001764963.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683772|gb|EDQ70179.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 784

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 24/68 (35%), Gaps = 11/68 (16%)

Query: 33  SFVGRRGCPDRLIITP-----------NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQR 81
                 G PD L+               G    +EVK P  RLS QQ + I  L   G  
Sbjct: 713 HAGYSAGMPDLLLWRTYKPEKTKGHVLRGEAKLVEVKGPRDRLSEQQRAWIVVLLNAGLS 772

Query: 82  VKVLVSME 89
           V+V    E
Sbjct: 773 VQVCKVFE 780


>gi|331655776|ref|ZP_08356765.1| VRR-NUC domain protein [Escherichia coli M718]
 gi|331046550|gb|EGI18639.1| VRR-NUC domain protein [Escherichia coli M718]
          Length = 192

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 4/82 (4%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGR-LSHQQMSEIEELRRR 78
           K+      K    G ++G PD  +    G      IE+K+P G+  + +Q++ +  LR  
Sbjct: 91  KRSKATAGKMKAEGQKKGYPDMSLDKACGIYHGMRIELKEPNGKAPTKEQIAWMRRLREE 150

Query: 79  GQRVKVLVSMEEVDNFLEELAC 100
           G  V +    E+    + E   
Sbjct: 151 GYYVVLAYGAEQAITAILEYIS 172


>gi|325495677|gb|EGC93541.1| pmgM [Escherichia fergusonii ECD227]
          Length = 192

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 35/82 (42%), Gaps = 4/82 (4%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGR-LSHQQMSEIEELRRR 78
           K+      K    G ++G PD  +    G      IE+K+P G+  +H+Q++ +  LR  
Sbjct: 91  KRSKATAGKMKAEGQKKGYPDMSLDKACGIYHGMRIELKEPNGKAPTHEQIAWMRRLREE 150

Query: 79  GQRVKVLVSMEEVDNFLEELAC 100
           G  V +    E+    + E   
Sbjct: 151 GYYVVLAYGAEQAITAILEYMS 172


>gi|225562844|gb|EEH11123.1| coiled-coil domain-containing protein MTMR15 [Ajellomyces
           capsulatus G186AR]
          Length = 826

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 765 GIPDLFLWSMERKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 815


>gi|323186496|gb|EFZ71842.1| VRR-NUC domain protein [Escherichia coli 1357]
 gi|323969229|gb|EGB64531.1| VRR-NUC domain-containing protein [Escherichia coli TA007]
          Length = 192

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 4/82 (4%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGR-LSHQQMSEIEELRRR 78
           K+      K    G ++G PD  +    G      IE+K+P G+  + +Q++ +  LR  
Sbjct: 91  KRSKATAGKMKAEGQKKGYPDMSLDKACGIYHGMRIELKEPNGKAPTKEQIAWMRRLREE 150

Query: 79  GQRVKVLVSMEEVDNFLEELAC 100
           G  V +    E+    + E   
Sbjct: 151 GYYVVLAYGAEQAITAILEYIS 172


>gi|46401706|ref|YP_006552.1| pmgM [Enterobacteria phage P1]
 gi|33338733|gb|AAQ14056.1| pmgM [Enterobacteria phage P1]
 gi|33338842|gb|AAQ14164.1| PmgM [Enterobacteria phage P1]
          Length = 192

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 4/82 (4%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGR-LSHQQMSEIEELRRR 78
           K+      K    G ++G PD  +    G      IE+K+P G+  + +Q++ +  LR  
Sbjct: 91  KRSKATAGKMKAEGQKKGYPDMSLDKACGIYHGMRIELKEPNGKAPTKEQIAWMRRLREE 150

Query: 79  GQRVKVLVSMEEVDNFLEELAC 100
           G  V +    E+    + E   
Sbjct: 151 GYYVVLAYGAEQAITAILEYIS 172


>gi|312131691|ref|YP_003999031.1| vrr-nuc domaiN-containing protein [Leadbetterella byssophila DSM
           17132]
 gi|311908237|gb|ADQ18678.1| VRR-NUC domain-containing protein [Leadbetterella byssophila DSM
           17132]
          Length = 546

 Score = 54.7 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 36  GRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             RG PD LI         IE+K P   LSHQQ+  ++  +  G + +VL 
Sbjct: 492 NSRGMPDLLIWDEE-TYELIEIKSPNDALSHQQLYWLKTFQELGIKARVLR 541


>gi|313885426|ref|ZP_07819176.1| conserved hypothetical protein [Eremococcus coleocola
          ACS-139-V-Col8]
 gi|312619156|gb|EFR30595.1| conserved hypothetical protein [Eremococcus coleocola
          ACS-139-V-Col8]
          Length = 66

 Score = 54.3 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 38 RGCPDRLIITPNGGLWWIEVKKP-TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
           G PD L     G    IEVKKP  G +S  Q  +I++++  G    V  S+E V   L 
Sbjct: 3  AGTPDILACLK-GRFIGIEVKKPKGGIVSPLQKLKIKQIQNAGGIAFVANSLEVVKRELS 61

Query: 97 E 97
          E
Sbjct: 62 E 62


>gi|289621442|emb|CBI52225.1| unnamed protein product [Sordaria macrospora]
          Length = 883

 Score = 54.3 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 27/73 (36%), Gaps = 15/73 (20%)

Query: 39  GCPDRLIIT---------------PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVK 83
           G PD ++                   G + ++EVK    RLS  Q   I  L   G RV 
Sbjct: 811 GVPDLILWRTAKEPSGDRKEQSENNKGEVMFVEVKSANDRLSDTQRLWIHVLSAAGVRVV 870

Query: 84  VLVSMEEVDNFLE 96
           +  ++ +    ++
Sbjct: 871 LCNAVAKGVKTID 883


>gi|239835203|ref|ZP_04683529.1| Hypothetical protein OINT_3000038 [Ochrobactrum intermedium LMG
           3301]
 gi|239821179|gb|EEQ92750.1| Hypothetical protein OINT_3000038 [Ochrobactrum intermedium LMG
           3301]
          Length = 137

 Score = 54.3 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 22/61 (36%), Gaps = 1/61 (1%)

Query: 38  RGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
            G  D  I     G   IE+K P GR S  Q    +          +  S +E +  L +
Sbjct: 74  PGASD-FIFMWGAGAAAIEIKAPDGRQSANQSDFQKWCEAENVPYHIAKSADEAEKILRD 132

Query: 98  L 98
           L
Sbjct: 133 L 133


>gi|260871206|ref|YP_003237986.1| putative norphogenetic protein [Escherichia coli O111:H- str.
           11128]
 gi|331649926|ref|ZP_08351002.1| VRR-NUC domain protein [Escherichia coli M605]
 gi|257767785|dbj|BAI39278.1| putative norphogenetic protein [Escherichia coli O111:H- str.
           11128]
 gi|331041183|gb|EGI13337.1| VRR-NUC domain protein [Escherichia coli M605]
          Length = 192

 Score = 54.3 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 4/82 (4%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGR-LSHQQMSEIEELRRR 78
           K+      K    G ++G PD  +    G      IE+K+P G+  + +Q++ +  LR  
Sbjct: 91  KRSKATAGKMKAEGQKKGYPDMSLDKACGIYHGMRIELKEPNGKAPTKEQIAWMRRLREE 150

Query: 79  GQRVKVLVSMEEVDNFLEELAC 100
           G  V +    E+    + E   
Sbjct: 151 GYYVVLAYGAEQAITAILEYIS 172


>gi|327350255|gb|EGE79112.1| VRR-NUC domain-containing protein [Ajellomyces dermatitidis ATCC
           18188]
          Length = 834

 Score = 54.3 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 773 GIPDLFLWSVERKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 823


>gi|239609514|gb|EEQ86501.1| VRR-NUC domain-containing protein [Ajellomyces dermatitidis ER-3]
          Length = 834

 Score = 54.3 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 773 GIPDLFLWSVERKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 823


>gi|261196582|ref|XP_002624694.1| coiled-coil domain-containing protein MTMR15 [Ajellomyces
           dermatitidis SLH14081]
 gi|239595939|gb|EEQ78520.1| coiled-coil domain-containing protein MTMR15 [Ajellomyces
           dermatitidis SLH14081]
          Length = 834

 Score = 54.3 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 773 GIPDLFLWSVERKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 823


>gi|119482886|ref|XP_001261471.1| hypothetical protein NFIA_026480 [Neosartorya fischeri NRRL 181]
 gi|119409626|gb|EAW19574.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181]
          Length = 822

 Score = 54.0 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 764 GIPDLFLWSVEKKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 814


>gi|70986991|ref|XP_748981.1| conserved hypothetical protein [Aspergillus fumigatus Af293]
 gi|66846611|gb|EAL86943.1| conserved hypothetical protein [Aspergillus fumigatus Af293]
          Length = 822

 Score = 54.0 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 764 GIPDLFLWSVEKKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 814


>gi|226287353|gb|EEH42866.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18]
          Length = 833

 Score = 54.0 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 772 GIPDLFLWSLERKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 822


>gi|225677907|gb|EEH16191.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 833

 Score = 54.0 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 772 GIPDLFLWSLERKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 822


>gi|159123250|gb|EDP48370.1| conserved hypothetical protein [Aspergillus fumigatus A1163]
          Length = 822

 Score = 54.0 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 764 GIPDLFLWSVEKKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 814


>gi|19112187|ref|NP_595395.1| VRR-NUC nuclease associated domain, human MTMR15 homolog
           [Schizosaccharomyces pombe 972h-]
 gi|74626358|sp|Q9Y804|FAN1_SCHPO RecName: Full=Fanconi-associated nuclease 1 homolog
 gi|5441488|emb|CAB46759.1| VRR-NUC nuclease associated domain, human MTMR15 homolog
           [Schizosaccharomyces pombe]
          Length = 703

 Score = 54.0 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 18/49 (36%), Gaps = 1/49 (2%)

Query: 38  RGCPDRLIITP-NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            G PD  +  P      + EVK    RLS  Q   I  L      V+V 
Sbjct: 647 SGIPDLCLWNPSKKKFMFSEVKSDNDRLSEAQKFWISLLISSEVDVEVC 695


>gi|109898663|ref|YP_661918.1| DNA polymerase III, epsilon subunit [Pseudoalteromonas atlantica
           T6c]
 gi|109700944|gb|ABG40864.1| DNA polymerase III, epsilon subunit [Pseudoalteromonas atlantica
           T6c]
          Length = 769

 Score = 54.0 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%)

Query: 31  KASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           K     + G PD ++I  N  L + EVK P  +L   Q+  I+ L+  G  V V 
Sbjct: 539 KNYQGLKDGYPDLMVI-ENQQLRFEEVKAPGDQLRANQLVSIDALQNAGFNVGVC 592


>gi|295663731|ref|XP_002792418.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb01]
 gi|226279088|gb|EEH34654.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb01]
          Length = 830

 Score = 54.0 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 769 GIPDLFLWSLERKEVMFVEVKSENDRLSDTQRLWIHVLTGAGVRVELCNAV 819


>gi|238482365|ref|XP_002372421.1| conserved hypothetical protein [Aspergillus flavus NRRL3357]
 gi|220700471|gb|EED56809.1| conserved hypothetical protein [Aspergillus flavus NRRL3357]
          Length = 814

 Score = 54.0 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 757 GIPDLFLWRVESREVMFVEVKSENDRLSDTQRLWIHVLGGAGVRVELCNAV 807


>gi|328712823|ref|XP_003244912.1| PREDICTED: fanconi-associated nuclease 1-like [Acyrthosiphon pisum]
          Length = 432

 Score = 54.0 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 1/63 (1%)

Query: 24  KLDCWVRKASFVGRRGCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRV 82
            +   + K   +   G PD ++         ++EVK P  +LS +Q S + +L   G  V
Sbjct: 347 AIGDQILKDGRIYLHGMPDLVVWDVFKHKCIFVEVKGPNDKLSERQYSWLLKLMEFGANV 406

Query: 83  KVL 85
           +V 
Sbjct: 407 EVC 409


>gi|121586132|ref|ZP_01675924.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|153802909|ref|ZP_01957495.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|121549798|gb|EAX59820.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|124121574|gb|EAY40317.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 183

 Score = 54.0 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRR-RGQRVKVLVSMEE 90
             G PD  +   +G + ++EVKK + RLS  Q+  + +++   G  V V+   EE
Sbjct: 105 TSGEPDLFLYKDDGSVLFVEVKKESDRLSKSQLVCLSQIKSILGCDVAVVYLSEE 159


>gi|310793968|gb|EFQ29429.1| hypothetical protein GLRG_04573 [Glomerella graminicola M1.001]
          Length = 749

 Score = 54.0 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 3/59 (5%)

Query: 39  GCPDRLIIT--PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM-EEVDNF 94
           G PD ++    P     + EVK    RLS  Q   I  L   G RV +  ++ +EV   
Sbjct: 690 GLPDLILWRTEPEKECMFAEVKSANDRLSDTQRLWIHVLTGAGVRVVLCNAVAKEVRAV 748


>gi|196001909|ref|XP_002110822.1| hypothetical protein TRIADDRAFT_54130 [Trichoplax adhaerens]
 gi|190586773|gb|EDV26826.1| hypothetical protein TRIADDRAFT_54130 [Trichoplax adhaerens]
          Length = 1087

 Score = 54.0 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 39   GCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            G PD ++       + + EVK P  RLS +Q+  I+ +   G  V V 
Sbjct: 1030 GLPDLVLWNKETKKVKFAEVKGPNDRLSTKQILWIDRIVNWGIDVDVC 1077


>gi|169765764|ref|XP_001817353.1| coiled-coil domain-containing protein MTMR15 [Aspergillus oryzae
           RIB40]
 gi|83765208|dbj|BAE55351.1| unnamed protein product [Aspergillus oryzae]
          Length = 809

 Score = 54.0 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G RV++  ++
Sbjct: 752 GIPDLFLWRVESREVMFVEVKSENDRLSDTQRLWIHVLGGAGVRVELCNAV 802


>gi|148255092|ref|YP_001239677.1| hypothetical protein BBta_3691 [Bradyrhizobium sp. BTAi1]
 gi|146407265|gb|ABQ35771.1| hypothetical protein BBta_3691 [Bradyrhizobium sp. BTAi1]
          Length = 720

 Score = 54.0 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV-----SMEEV 91
           R G PD + +  +G + ++EVK     +   Q++ + +L   G   ++         E+ 
Sbjct: 487 RDGFPDLMHVR-DGKVSFVEVKAEGDAIRRNQLTRLRQLEHAGIPAEIGRVDYRFDPEQ- 544

Query: 92  DNFLEELACT 101
           D  + ++  T
Sbjct: 545 DYVVVDIETT 554


>gi|320162834|gb|EFW39733.1| predicted protein [Capsaspora owczarzaki ATCC 30864]
          Length = 1064

 Score = 54.0 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 39   GCPDRLIITPNGGLW-WIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G PD L+  P+     ++EVK    +L+H+Q   I  LR  G +V V  
Sbjct: 1005 GLPDLLLWDPSRRAARFVEVKSENDKLAHKQHVWIHVLRMLGAQVDVCK 1053


>gi|302845901|ref|XP_002954488.1| hypothetical protein VOLCADRAFT_95362 [Volvox carteri f. nagariensis]
 gi|300260160|gb|EFJ44381.1| hypothetical protein VOLCADRAFT_95362 [Volvox carteri f. nagariensis]
          Length = 1449

 Score = 53.6 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 29/74 (39%), Gaps = 9/74 (12%)

Query: 19   VTGAKKLDCWVRKASFVGRRGCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRR 77
                +    W        R G PD L+  P  G     EVK P  RLS QQ + +  L  
Sbjct: 1243 RRLCEDAGGW--------RGGMPDLLLWRPERGDAMVSEVKGPRDRLSDQQRAWLAALAA 1294

Query: 78   RGQRVKVLVSMEEV 91
             G R +VL  +E  
Sbjct: 1295 AGVRAEVLRVVEAA 1308


>gi|324111170|gb|EGC05155.1| VRR-NUC domain-containing protein [Escherichia fergusonii B253]
          Length = 187

 Score = 53.6 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 33/82 (40%), Gaps = 4/82 (4%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGR-LSHQQMSEIEELRRR 78
           K+      K    G ++G PD  +    G      IE+K+P G+    +Q++ +  LR  
Sbjct: 91  KRSKATAGKMKAEGQKKGYPDMSLDKACGIYHGMRIELKEPNGKAPKKEQIAWMRRLREE 150

Query: 79  GQRVKVLVSMEEVDNFLEELAC 100
           G  V +    E+    + E   
Sbjct: 151 GYYVVLAYGAEQAITAILEYMS 172


>gi|329847967|ref|ZP_08262995.1| exonuclease, DNA polymerase III, epsilon subunit family domain
           protein [Asticcacaulis biprosthecum C19]
 gi|328843030|gb|EGF92599.1| exonuclease, DNA polymerase III, epsilon subunit family domain
           protein [Asticcacaulis biprosthecum C19]
          Length = 708

 Score = 53.6 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 10/50 (20%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           R G PD ++   +  + ++E+K    ++   Q++ ++ L+  G    +L 
Sbjct: 484 RDGFPDLMLTRAD-EVRFVEIKAEGDQIRRHQLARLKLLQEAGFDASILK 532


>gi|298376470|ref|ZP_06986425.1| VRR-NUC domain protein [Bacteroides sp. 3_1_19]
 gi|298266348|gb|EFI08006.1| VRR-NUC domain protein [Bacteroides sp. 3_1_19]
          Length = 159

 Score = 53.6 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 30/68 (44%), Gaps = 5/68 (7%)

Query: 37  RRGCPDRLIITPNGGLWWI--EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
           +RG  D ++  P  G   +  E K  TG+ S  Q     ++   G +  ++ S+E+    
Sbjct: 94  KRGVADVILQIPKKGYASLCLEFKTSTGKQSPDQKEYQRQVEMAGSKYVIVRSVEQA--- 150

Query: 95  LEELACTL 102
           + EL   L
Sbjct: 151 IRELQLYL 158


>gi|326483759|gb|EGE07769.1| VRR-NUC domain-containing protein [Trichophyton equinum CBS 127.97]
          Length = 804

 Score = 53.2 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +   +   + + EVK  + RLS  Q   I  L   G +V++  ++
Sbjct: 747 GIPDLFLWRMDTKEVMFSEVKSESDRLSDTQRLWIHVLTGAGVKVELCNAV 797


>gi|302511215|ref|XP_003017559.1| hypothetical protein ARB_04441 [Arthroderma benhamiae CBS 112371]
 gi|291181130|gb|EFE36914.1| hypothetical protein ARB_04441 [Arthroderma benhamiae CBS 112371]
          Length = 841

 Score = 53.2 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +   +   + + EVK  + RLS  Q   I  L   G +V++  ++
Sbjct: 784 GIPDLFLWRMDTKEVMFSEVKSESDRLSDTQRLWIHVLTGAGVKVELCNAV 834


>gi|298385400|ref|ZP_06994958.1| VRR-NUC domain protein [Bacteroides sp. 1_1_14]
 gi|298261541|gb|EFI04407.1| VRR-NUC domain protein [Bacteroides sp. 1_1_14]
          Length = 137

 Score = 53.2 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 38/113 (33%), Gaps = 22/113 (19%)

Query: 7   HYQTEKDVEKRLVTG--AK--KLDCWVRKASFVGRR---------------GCPDRLIIT 47
           H   E  ++   V     K  KL   +      GRR               G  D +++ 
Sbjct: 14  HNDEEHRIQCACVKYFNLKYPKLKGRLFAVPNGGRRDAVTASKLKAEGVIAGVSDLILLK 73

Query: 48  PNGGL--WWIEVKKPTGRLSHQQMSEIEEL-RRRGQRVKVLVSMEEVDNFLEE 97
            N       IE+KK  G  S  Q    + +   R  +  V  S+++    ++E
Sbjct: 74  SNRDYGALLIEMKKKGGYQSPSQKQWQKMICENREYKYVVCHSLDDFIREVDE 126


>gi|307564889|ref|ZP_07627414.1| VRR-NUC domain protein [Prevotella amnii CRIS 21A-A]
 gi|307346425|gb|EFN91737.1| VRR-NUC domain protein [Prevotella amnii CRIS 21A-A]
          Length = 136

 Score = 53.2 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 39/110 (35%), Gaps = 22/110 (20%)

Query: 11  EKDVEKRLVT----GAKKLDCWVRKASFVGRR---------------GCPDRLIITPNGG 51
           E  ++   V       +KL   +      G+R               G  D +++ PN  
Sbjct: 22  EHRIQCSCVRWFNLKHRKLKGRLFAVPNGGKRDALTGAKLKAEGVVAGVADLILLVPNRF 81

Query: 52  L--WWIEVKKPTGRLSHQQMSEIEELRRRG-QRVKVLVSMEEVDNFLEEL 98
                +E+K  TGR S  Q    + +   G  +  V  S+++    +++ 
Sbjct: 82  YGALLVEMKTLTGRQSKSQKDWEQIITSEGDYKYVVCHSLDDFIREVDDY 131


>gi|302655929|ref|XP_003025835.1| hypothetical protein TRV_06238 [Trichophyton verrucosum HKI 0517]
 gi|291183489|gb|EFE39100.1| hypothetical protein TRV_06238 [Trichophyton verrucosum HKI 0517]
          Length = 829

 Score = 53.2 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +   +   + + EVK  + RLS  Q   I  L   G +V++  ++
Sbjct: 772 GIPDLFLWRMDTKEVMFSEVKSESDRLSDTQRLWIHVLTGAGVKVELCNAV 822


>gi|329954231|ref|ZP_08295325.1| VRR-NUC domain protein [Bacteroides clarus YIT 12056]
 gi|328527937|gb|EGF54923.1| VRR-NUC domain protein [Bacteroides clarus YIT 12056]
          Length = 121

 Score = 53.2 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 38  RGCPDRLIITPNGGLWW--IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           RG  D +++ P  G     IE+K P G+   +Q+    E  +   +  +  S+++   F+
Sbjct: 57  RGVADLILLIPKKGFASLCIEMKTPKGQQREEQIEWQREAEKYRNKYVICRSLQD---FM 113

Query: 96  EELACTL 102
            E+   L
Sbjct: 114 NEVNSYL 120


>gi|121711499|ref|XP_001273365.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1]
 gi|119401516|gb|EAW11939.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1]
          Length = 824

 Score = 53.2 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLII-TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + ++EVK    RLS  Q   I  L   G +V++  ++
Sbjct: 766 GIPDLFLWSLERKEVMFVEVKSENDRLSDTQRLWIHVLVGAGVKVELCNAV 816


>gi|26990595|ref|NP_746020.1| hypothetical protein PP_3890 [Pseudomonas putida KT2440]
 gi|24985578|gb|AAN69484.1|AE016583_8 hypothetical protein PP_3890 [Pseudomonas putida KT2440]
          Length = 147

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/100 (15%), Positives = 28/100 (28%), Gaps = 14/100 (14%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL--WWIEVKKP-- 60
            +H        K +    K             + G PD ++    GG    +IE K    
Sbjct: 49  IYHVPNGGHRIKAVAAKLKGQGV---------KAGVPDLVLPMARGGYFGLYIEFKAKPP 99

Query: 61  -TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
               +S  Q + +++L        V     +    +    
Sbjct: 100 FDAPVSPSQDAYLQQLTNENYLAIVCRGSIDAVEAIRAYL 139


>gi|116192507|ref|XP_001222066.1| hypothetical protein CHGG_05971 [Chaetomium globosum CBS 148.51]
 gi|88181884|gb|EAQ89352.1| hypothetical protein CHGG_05971 [Chaetomium globosum CBS 148.51]
          Length = 773

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 21/57 (36%), Gaps = 10/57 (17%)

Query: 39  GCPDRLII----------TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           G PD ++              G + + EVK    RLS  Q   I  L   G RV + 
Sbjct: 707 GVPDLILWRAGGDDGEGGYRKGEVMFAEVKSANDRLSDTQRLWINVLTGAGVRVALC 763


>gi|326475617|gb|EGD99626.1| hypothetical protein TESG_06972 [Trichophyton tonsurans CBS 112818]
          Length = 808

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +   +   + + EVK  + RLS  Q   I  L   G +V++  ++
Sbjct: 751 GIPDLFLWRMDTKEVMFSEVKSESDRLSDTQRLWIHVLTGAGVKVELCNAV 801


>gi|327297174|ref|XP_003233281.1| hypothetical protein TERG_06274 [Trichophyton rubrum CBS 118892]
 gi|326464587|gb|EGD90040.1| hypothetical protein TERG_06274 [Trichophyton rubrum CBS 118892]
          Length = 829

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +   +   + + EVK  + RLS  Q   I  L   G +V++  ++
Sbjct: 772 GIPDLFLWRMDTKEVMFSEVKSESDRLSDTQRLWIHVLTGAGVKVELCNAV 822


>gi|315044431|ref|XP_003171591.1| coiled-coil domain-containing protein MTMR15 [Arthroderma gypseum
           CBS 118893]
 gi|311343934|gb|EFR03137.1| coiled-coil domain-containing protein MTMR15 [Arthroderma gypseum
           CBS 118893]
          Length = 830

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPN-GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +   +   + + EVK  + RLS  Q   I  L   G +V++  ++
Sbjct: 773 GIPDLFLWRMDTNEVMFSEVKSESDRLSDTQRLWIHVLTGAGVKVELCNAV 823


>gi|296811266|ref|XP_002845971.1| coiled-coil domain-containing protein MTMR15 [Arthroderma otae CBS
           113480]
 gi|238843359|gb|EEQ33021.1| coiled-coil domain-containing protein MTMR15 [Arthroderma otae CBS
           113480]
          Length = 817

 Score = 52.8 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +   +   + + EVK  + RLS  Q   I  L   G +V++  ++
Sbjct: 760 GIPDLFLWRMDTKEVMFSEVKSESDRLSDTQRLWIHVLTGAGVKVELCNAV 810


>gi|332173709|gb|AEE22963.1| DNA polymerase III, epsilon subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 788

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 1/55 (1%)

Query: 31  KASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           K     + G PD ++I     L + EVK P  +L   Q+  I+ L+  G  V V 
Sbjct: 558 KNYQGLKDGYPDLMVIEHQ-QLRFEEVKAPGDQLRANQLVSIDALQNAGFNVGVC 611


>gi|164427524|ref|XP_964041.2| hypothetical protein NCU03036 [Neurospora crassa OR74A]
 gi|157071779|gb|EAA34805.2| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 883

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 27/72 (37%), Gaps = 16/72 (22%)

Query: 39  GCPDRLIIT---------------PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVK 83
           G PD ++                   G + ++EVK    RLS  Q   I  L   G RV 
Sbjct: 811 GVPDLILWRTTHELSDDRKEQSENGKGEVMFVEVKSANDRLSDTQRLWIHVLSAAGVRVV 870

Query: 84  VLVSM-EEVDNF 94
           +  ++ +EV   
Sbjct: 871 LCNAVAKEVKTI 882


>gi|220925617|ref|YP_002500919.1| VRR-NUC domain-containing protein [Methylobacterium nodulans ORS
           2060]
 gi|219950224|gb|ACL60616.1| VRR-NUC domain protein [Methylobacterium nodulans ORS 2060]
          Length = 145

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 44/112 (39%), Gaps = 31/112 (27%)

Query: 11  EKDVEKRLVTGA-KKLDCWVRKASFVGRRG---------------CPDRLIITPNG--GL 52
           E+ ++  +VT   +  DC     +  G RG                PD  +   +G   L
Sbjct: 7   EQRIQTAIVTAMHRAFDCRCVHVANGGARGKLEAVAFKAMGVWAGHPDLNVYGRSGAAPL 66

Query: 53  WWIEVK---------KPTGR----LSHQQMSEIEELRRRGQRVKVLVSMEEV 91
           + IEVK          P  +    LS +Q   + ELR RG RV V+ S E+ 
Sbjct: 67  FMIEVKERIQARERAVPADQRFWSLSDEQKPVVSELRERGIRVFVVDSPEDA 118


>gi|126668704|ref|ZP_01739654.1| hypothetical protein MELB17_09898 [Marinobacter sp. ELB17]
 gi|126626804|gb|EAZ97451.1| hypothetical protein MELB17_09898 [Marinobacter sp. ELB17]
          Length = 201

 Score = 52.8 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 28/69 (40%), Gaps = 5/69 (7%)

Query: 37  RRGCPDRLIITPNGGL--WWIEVKKP---TGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
           R G  D L+    GG    WIE K        ++  Q   ++ +  +G +  + + ++E 
Sbjct: 120 RAGVSDLLLPVARGGYIGLWIEFKAAAPNNAAVTESQKEWVDLMAEQGYKAVICLGIDEA 179

Query: 92  DNFLEELAC 100
            + L +   
Sbjct: 180 MSVLIDYMA 188


>gi|315180272|gb|ADT87186.1| hypothetical protein vfu_A02035 [Vibrio furnissii NCTC 11218]
          Length = 183

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRR-RGQRVKVLVSMEE 90
             G PD  +   +G + ++EVKK + RLS  Q+  + +++      V V    EE
Sbjct: 105 TAGEPDLFLYKDDGSVLFVEVKKQSDRLSPSQLVCLAQIKSILNCDVGVAYLAEE 159


>gi|148734532|ref|YP_001285549.1| gp59 [Enterobacteria phage TLS]
 gi|38046791|gb|AAR09290.1| gp59 [Enterobacteria phage TLS]
          Length = 135

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 34/92 (36%), Gaps = 12/92 (13%)

Query: 18  LVTGAKKLD----CWVRKASFVG-RRGCPDRLIIT----PNGGLWWIEVKK---PTGRLS 65
           LV   K           K    G ++G  D LI+T           IE+K+      ++S
Sbjct: 41  LVWHTKNEGKKTIGTAVKDQQAGVKKGVSDILILTGFIGCKYSFIAIELKRANKKGTKVS 100

Query: 66  HQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
            +Q   +  +R  G    V   +E+V   + +
Sbjct: 101 DEQKEFLRRVRECGGFAAVCYGVEQVKLAIAD 132


>gi|255931761|ref|XP_002557437.1| Pc12g05930 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582056|emb|CAP80220.1| Pc12g05930 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 787

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGG-LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
           G PD  +       + + EVK    RLS  Q   I  L   G +V++  ++
Sbjct: 703 GIPDLFLWNHEKRTVMFAEVKSENDRLSDTQRLWIHVLLGAGVQVELCNAV 753


>gi|322708993|gb|EFZ00570.1| coiled-coil domain-containing protein MTMR15 [Metarhizium
           anisopliae ARSEF 23]
          Length = 842

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 25/72 (34%), Gaps = 16/72 (22%)

Query: 39  GCPDRLIIT---------------PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVK 83
           G PD ++                 P G + + EVK    RLS  Q   I  L   G  V 
Sbjct: 770 GVPDLILWRANDQSAEGARSTPEAPRGEVMFAEVKSANDRLSDTQRLWIHVLTGAGVTVA 829

Query: 84  VLVSME-EVDNF 94
           +  ++  EV   
Sbjct: 830 LCNAIAREVREV 841


>gi|322693988|gb|EFY85831.1| coiled-coil domain-containing protein MTMR15 [Metarhizium acridum
           CQMa 102]
          Length = 936

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 21/62 (33%), Gaps = 15/62 (24%)

Query: 39  GCPDRLIIT---------------PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVK 83
           G PD ++                 P G + + EVK    RLS  Q   I  L   G  V 
Sbjct: 845 GVPDLILWRANDQSAEGVPSRPEAPRGEVMFAEVKSANDRLSDTQRLWIHVLTGAGVTVA 904

Query: 84  VL 85
           + 
Sbjct: 905 LC 906


>gi|294868558|ref|XP_002765580.1| hypothetical protein Pmar_PMAR013643 [Perkinsus marinus ATCC 50983]
 gi|239865659|gb|EEQ98297.1| hypothetical protein Pmar_PMAR013643 [Perkinsus marinus ATCC 50983]
          Length = 707

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSME 89
           G PD  +      + ++EVK P   LS +Q   I EL R G   +    +E
Sbjct: 644 GMPDLTL-RQGQRVRFVEVKGPGDDLSARQRGWIAELMRCGADAEAAYIVE 693


>gi|330934845|ref|XP_003304735.1| hypothetical protein PTT_17384 [Pyrenophora teres f. teres 0-1]
 gi|311318617|gb|EFQ87236.1| hypothetical protein PTT_17384 [Pyrenophora teres f. teres 0-1]
          Length = 857

 Score = 52.4 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 6/53 (11%)

Query: 39  GCPDRLIIT------PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           G PD  +          G + + EVK    RLS  Q   I  L   G RV++ 
Sbjct: 792 GVPDLFLWKLPEEKGKKGEVKFAEVKSENDRLSDTQRMWIHVLSSAGVRVELC 844


>gi|189203241|ref|XP_001937956.1| coiled-coil domain-containing protein MTMR15 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187985055|gb|EDU50543.1| coiled-coil domain-containing protein MTMR15 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 908

 Score = 52.0 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 6/53 (11%)

Query: 39  GCPDRLIIT------PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           G PD  +          G + + EVK    RLS  Q   I  L   G RV++ 
Sbjct: 792 GVPDLFLWKLPEEEGKKGEVKFAEVKSENDRLSDTQRMWIHVLSGAGVRVELC 844


>gi|195546633|ref|YP_002117661.1| p103 [Rhizobium phage 16-3]
 gi|102642568|gb|ABF71349.1| p103 [Rhizobium phage 16-3]
          Length = 169

 Score = 51.6 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 20/50 (40%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             G  D  +    G L  IE K   GRLS  Q      L R G  V+V+ 
Sbjct: 88  TPGEADLRLYLVGGQLRMIENKVGRGRLSPAQAERHVALARLGFVVEVVR 137


>gi|127512822|ref|YP_001094019.1| hypothetical protein Shew_1894 [Shewanella loihica PV-4]
 gi|126638117|gb|ABO23760.1| conserved hypothetical protein [Shewanella loihica PV-4]
          Length = 643

 Score = 51.6 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 18/72 (25%), Gaps = 22/72 (30%)

Query: 37  RRGCPDRLIITPNGGLW----------------------WIEVKKPTGRLSHQQMSEIEE 74
           R G PD +                                IEVK P   L   Q   ++ 
Sbjct: 567 RAGFPDLICFHLTAEYLAIERHATDDGAPNLIDSRVTAELIEVKGPGDALRDNQTVWLDW 626

Query: 75  LRRRGQRVKVLV 86
             R G +  V  
Sbjct: 627 FNRNGVKASVCY 638


>gi|312069770|ref|XP_003137837.1| hypothetical protein LOAG_02251 [Loa loa]
 gi|307767005|gb|EFO26239.1| hypothetical protein LOAG_02251 [Loa loa]
          Length = 588

 Score = 51.3 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 19/48 (39%), Gaps = 1/48 (2%)

Query: 37  RRGCPDRLIITPNGGLW-WIEVKKPTGRLSHQQMSEIEELRRRGQRVK 83
           R G PD  +      L   +EVK P  +LS +Q   +   + +     
Sbjct: 485 RSGFPDLTVWNDEKKLLAVVEVKGPGDKLSTKQRLWLNFFQNQNITAH 532


>gi|312964287|ref|ZP_07778591.1| VRR-NUC domain protein [Escherichia coli 2362-75]
 gi|312291000|gb|EFR18874.1| VRR-NUC domain protein [Escherichia coli 2362-75]
          Length = 192

 Score = 51.3 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 33/82 (40%), Gaps = 4/82 (4%)

Query: 23  KKLDCWVRKASFVG-RRGCPDRLIITPNGGLW--WIEVKKPTGR-LSHQQMSEIEELRRR 78
           K+      K    G ++G PD  +    G      IE+K+  G+  + +Q++ +  LR  
Sbjct: 91  KRSKATAGKMKAEGQKKGYPDMSLDKACGIYHGMRIELKELNGKAPTKEQIAWMRRLREE 150

Query: 79  GQRVKVLVSMEEVDNFLEELAC 100
           G  V +    E+    + E   
Sbjct: 151 GYYVVLAYGAEQAITAILEYIS 172


>gi|302824953|ref|XP_002994114.1| hypothetical protein SELMODRAFT_432061 [Selaginella moellendorffii]
 gi|300138023|gb|EFJ04807.1| hypothetical protein SELMODRAFT_432061 [Selaginella moellendorffii]
          Length = 902

 Score = 51.3 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 20/51 (39%), Gaps = 1/51 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVS 87
             G PD L+          EVK P  RLS QQ++    L      V++   
Sbjct: 679 TAGMPDLLLW-KEKEAKLAEVKGPGDRLSEQQVAWFLILSDANVPVELCKD 728


>gi|169603221|ref|XP_001795032.1| hypothetical protein SNOG_04619 [Phaeosphaeria nodorum SN15]
 gi|111067259|gb|EAT88379.1| hypothetical protein SNOG_04619 [Phaeosphaeria nodorum SN15]
          Length = 863

 Score = 51.3 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 6/53 (11%)

Query: 39  GCPDRLIIT------PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           G PD  +          G + + EVK    RLS  Q   I  L   G +V++ 
Sbjct: 800 GVPDLFLWKVADEEGAKGEVKFAEVKSENDRLSDTQRLWIHVLSGAGVKVELC 852


>gi|302813750|ref|XP_002988560.1| hypothetical protein SELMODRAFT_427183 [Selaginella moellendorffii]
 gi|300143667|gb|EFJ10356.1| hypothetical protein SELMODRAFT_427183 [Selaginella moellendorffii]
          Length = 767

 Score = 51.3 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             G PD L+          EVK P  RLS QQ++    L      V++  
Sbjct: 710 TAGMPDLLLW-KEKEAKLAEVKGPGDRLSEQQVAWFLILSDANVPVELCK 758


>gi|302819287|ref|XP_002991314.1| hypothetical protein SELMODRAFT_429676 [Selaginella moellendorffii]
 gi|300140894|gb|EFJ07612.1| hypothetical protein SELMODRAFT_429676 [Selaginella moellendorffii]
          Length = 692

 Score = 51.3 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             G PD L+          EVK P  RLS QQ++    L      V++  
Sbjct: 635 TAGMPDLLLW-KEKEAKLAEVKGPGDRLSEQQVAWFLILSDANVPVELCK 683


>gi|255070817|ref|XP_002507490.1| hypothetical protein MICPUN_113925 [Micromonas sp. RCC299]
 gi|226522765|gb|ACO68748.1| hypothetical protein MICPUN_113925 [Micromonas sp. RCC299]
          Length = 863

 Score = 51.3 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 11/52 (21%), Positives = 21/52 (40%), Gaps = 4/52 (7%)

Query: 39  GCPDRLIITPN----GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           G PD ++          + ++EVK     L+ +Q + +  L   G  V +  
Sbjct: 809 GAPDLILWRKTTNSSAEVKFVEVKSSNDHLTERQQAWLSALYEAGVDVAICK 860


>gi|302819357|ref|XP_002991349.1| hypothetical protein SELMODRAFT_236265 [Selaginella moellendorffii]
 gi|300140929|gb|EFJ07647.1| hypothetical protein SELMODRAFT_236265 [Selaginella moellendorffii]
          Length = 827

 Score = 51.3 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             G PD L+          EVK P  RLS QQ++    L      V++  
Sbjct: 770 TAGMPDLLLW-KEKEAKLAEVKGPGDRLSEQQVAWFLILSDANVPVELCK 818


>gi|260174937|ref|ZP_05761349.1| VRR-NUC domain protein [Bacteroides sp. D2]
          Length = 157

 Score = 51.3 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/66 (19%), Positives = 24/66 (36%), Gaps = 2/66 (3%)

Query: 37  RRGCPDRLIITPNGGLWW--IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
           + G  D +++ P  G     IE K   G+ S  Q    ++      +  V+ S  +    
Sbjct: 92  KPGVSDVIVLIPKKGFASLCIEFKTKVGKQSEYQKEFQKQAESCRNKYVVVRSASQAIEE 151

Query: 95  LEELAC 100
           L +   
Sbjct: 152 LRKYLS 157


>gi|302813748|ref|XP_002988559.1| hypothetical protein SELMODRAFT_427181 [Selaginella moellendorffii]
 gi|300143666|gb|EFJ10355.1| hypothetical protein SELMODRAFT_427181 [Selaginella moellendorffii]
          Length = 774

 Score = 51.3 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             G PD L+          EVK P  RLS QQ++    L      V++  
Sbjct: 717 TAGMPDLLLW-KEKEARLAEVKGPGDRLSEQQVAWFLILSDANVPVELCK 765


>gi|39975005|ref|XP_368893.1| hypothetical protein MGG_00351 [Magnaporthe oryzae 70-15]
 gi|145018759|gb|EDK03038.1| hypothetical protein MGG_00351 [Magnaporthe oryzae 70-15]
          Length = 853

 Score = 51.3 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 2/47 (4%)

Query: 39  GCPDRLIIT--PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVK 83
           G PD ++    P   + + EVK    RLS  Q   I  L   G RV 
Sbjct: 795 GIPDLVLWRTEPRPEVMFAEVKSANDRLSDTQRLWIHVLTGAGVRVA 841


>gi|315923176|ref|ZP_07919416.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313697051|gb|EFS33886.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 134

 Score = 50.9 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/66 (19%), Positives = 24/66 (36%), Gaps = 2/66 (3%)

Query: 37  RRGCPDRLIITPNGGLWW--IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
           + G  D +++ P  G     IE K   G+ S  Q    ++      +  V+ S  +    
Sbjct: 69  KPGVSDVIVLIPKKGFASLCIEFKTKVGKQSEYQKEFQKQAESCRNKYVVVRSASQAIEE 128

Query: 95  LEELAC 100
           L +   
Sbjct: 129 LRKYLS 134


>gi|312215335|emb|CBX95287.1| similar to coiled-coil domain-containing protein MTMR15
           [Leptosphaeria maculans]
          Length = 860

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 6/53 (11%)

Query: 39  GCPDRLIITP------NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           G PD  +          G + + EVK    RLS  Q   I  L   G RV++ 
Sbjct: 798 GVPDLFLWKVAKEDGLKGQVKFAEVKSENDRLSDTQRLWIHVLSSAGVRVELC 850


>gi|302794989|ref|XP_002979258.1| hypothetical protein SELMODRAFT_418853 [Selaginella moellendorffii]
 gi|300153026|gb|EFJ19666.1| hypothetical protein SELMODRAFT_418853 [Selaginella moellendorffii]
          Length = 839

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             G PD L+          EVK P  RLS QQ++    L      V++  
Sbjct: 782 TAGMPDLLLW-KEKEARLAEVKGPGDRLSEQQVAWFLILSDANVPVELCK 830


>gi|294486137|gb|ADE87953.1| conserved phage protein [Escherichia phage vB_EcoM_ECO1230-10]
          Length = 137

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 23/75 (30%), Gaps = 11/75 (14%)

Query: 32  ASFVGRRGCPDRLIITPN-------GGLWWI----EVKKPTGRLSHQQMSEIEELRRRGQ 80
                  G  D              G    I    EVK   G+ S  Q + I  +   G 
Sbjct: 60  FDTGLPPGFTDLFGYVVEEITADMVGQKVAIFIGPEVKDENGKPSPLQKTFISVVNADGG 119

Query: 81  RVKVLVSMEEVDNFL 95
           R  V+ S+ + +  +
Sbjct: 120 RAGVVRSVADAEKLV 134


>gi|302916591|ref|XP_003052106.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256733045|gb|EEU46393.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 850

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 26/71 (36%), Gaps = 15/71 (21%)

Query: 39  GCPDRLIIT--------------PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKV 84
           G PD ++                  G + + EVK    RLS  Q   I  L   G +V +
Sbjct: 779 GIPDLILWRTRDTTGNGGDGPAKSKGEVMFSEVKSANDRLSDTQRLWIHVLTGAGVKVAL 838

Query: 85  LVSM-EEVDNF 94
             ++ +EV   
Sbjct: 839 CNAVAKEVREV 849


>gi|294935346|ref|XP_002781397.1| hypothetical protein Pmar_PMAR020783 [Perkinsus marinus ATCC 50983]
 gi|239891978|gb|EER13192.1| hypothetical protein Pmar_PMAR020783 [Perkinsus marinus ATCC 50983]
          Length = 142

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 39  GCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSME 89
           G PD  +      + ++EVK P   LS +Q   I EL R G   +    +E
Sbjct: 79  GMPDLTL-RQGQRVRFVEVKGPGDDLSARQRGWIAELMRCGADAEAAYIVE 128


>gi|304399089|ref|ZP_07380957.1| VRR-NUC domain protein [Pantoea sp. aB]
 gi|304353329|gb|EFM17708.1| VRR-NUC domain protein [Pantoea sp. aB]
          Length = 196

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 35  VGRRGCPDRLIITPNGGLW--WIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVD 92
             +RG PD  +  P G      +E K      S  Q++ +  L+ +G  V +  S EE  
Sbjct: 111 GAKRGVPDMSLEIPAGIYHGMRVEQKHGKNMPSEFQLTWMRRLKEQGYYVLLSFSPEETI 170

Query: 93  NFLEELA 99
           + +E+ A
Sbjct: 171 SVIEQYA 177


>gi|302812576|ref|XP_002987975.1| hypothetical protein SELMODRAFT_127073 [Selaginella moellendorffii]
 gi|300144364|gb|EFJ11049.1| hypothetical protein SELMODRAFT_127073 [Selaginella moellendorffii]
          Length = 478

 Score = 50.5 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 1/49 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
             G PD L+          EVK P  RLS QQ++    L      V++ 
Sbjct: 421 TAGMPDLLLW-KEKEAKLAEVKGPGDRLSEQQVAWFLILSDANVPVELC 468


>gi|302812482|ref|XP_002987928.1| hypothetical protein SELMODRAFT_426730 [Selaginella moellendorffii]
 gi|300144317|gb|EFJ11002.1| hypothetical protein SELMODRAFT_426730 [Selaginella moellendorffii]
          Length = 657

 Score = 50.5 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             G PD L+          EVK P  RLS QQ++    L      V++  
Sbjct: 600 TAGMPDLLLW-KEKEAKLAEVKGPGDRLSEQQVAWFLILSDANVPVELCK 648


>gi|325284520|ref|YP_004257059.1| VRR-NUC domain-containing protein [Deinococcus proteolyticus MRP]
 gi|324316694|gb|ADY27805.1| VRR-NUC domain-containing protein [Deinococcus proteolyticus MRP]
          Length = 178

 Score = 50.5 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 25/64 (39%), Gaps = 4/64 (6%)

Query: 31  KASFVG-RRGCPDRLIITPNGGLW--WIEVKK-PTGRLSHQQMSEIEELRRRGQRVKVLV 86
           K   +G R G PD L+  P  G     IE+K       S +Q   I   R++G    V  
Sbjct: 81  KFKRMGTRAGYPDLLLDVPLHGYHGLRIELKDLKGNTPSPEQRGWIVAHRQKGYAADVAR 140

Query: 87  SMEE 90
              +
Sbjct: 141 GWRQ 144


>gi|71834151|ref|YP_277509.1| hypothetical protein JK_69 [Enterobacteria phage JK06]
 gi|71149581|gb|AAZ29319.1| JK_69P [Enterobacteria phage JK06]
          Length = 91

 Score = 50.1 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 30/78 (38%), Gaps = 5/78 (6%)

Query: 27  CWVRKASFVGR-RGCPDRLIITPNGGLWWIEVKKP---TGRLSHQQMSEIEELRRRGQRV 82
               K    G  +G  D L+I PNG    IE+K+      ++S +Q   +E++   G   
Sbjct: 10  GTAMKDKQEGVIKGVSDILLIGPNG-FAAIELKRAIKSDSKVSKEQKEFLEKVSETGGYA 68

Query: 83  KVLVSMEEVDNFLEELAC 100
            +    E     + +   
Sbjct: 69  AICYGFEMFKLAITDYLS 86


>gi|153212011|ref|ZP_01947828.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124116807|gb|EAY35627.1| conserved hypothetical protein [Vibrio cholerae 1587]
          Length = 133

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/105 (21%), Positives = 34/105 (32%), Gaps = 15/105 (14%)

Query: 4   YSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLW--WIEVKKP- 60
           Y  H   E     +      ++          G  G PD +     GG     IE+K P 
Sbjct: 38  YLAHIPNEGKRGPKAQRDFSEMG---------GTSGYPDYVFDVARGGYHGLRIEMKAPE 88

Query: 61  --TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN-FLEELACTL 102
                +S  QM   E L ++G  V      E      ++ +A  L
Sbjct: 89  PNRSVISDSQMKMAERLTQQGYLVLFTKGFEIAKQAIIDYMAGKL 133


>gi|46125337|ref|XP_387222.1| hypothetical protein FG07046.1 [Gibberella zeae PH-1]
          Length = 855

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 26/70 (37%), Gaps = 15/70 (21%)

Query: 39  GCPDRLIIT--------------PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKV 84
           G PD ++                  G + + EVK    RLS  Q   I  L   G +V +
Sbjct: 785 GIPDLILWRIADTPEQQTKEPGKAKGEVMFSEVKSANDRLSDTQRLWIHVLTGAGVKVAL 844

Query: 85  LVSM-EEVDN 93
             ++ +EV  
Sbjct: 845 CNAVAKEVRE 854


>gi|94501331|ref|ZP_01307852.1| hypothetical protein RED65_02924 [Oceanobacter sp. RED65]
 gi|94426602|gb|EAT11589.1| hypothetical protein RED65_02924 [Oceanobacter sp. RED65]
          Length = 738

 Score = 49.7 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 39  GCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKV 84
           G PD +II  NG + + E+K P  +L   Q+  ++ L+R G  V+V
Sbjct: 516 GYPDLMIIDDNG-IRFEEIKAPGDQLRRNQLISLQSLKRNGFDVRV 560


>gi|302812478|ref|XP_002987926.1| hypothetical protein SELMODRAFT_426726 [Selaginella moellendorffii]
 gi|300144315|gb|EFJ11000.1| hypothetical protein SELMODRAFT_426726 [Selaginella moellendorffii]
          Length = 167

 Score = 49.0 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 1/57 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN 93
             G PD L+          EVK P   LS QQ++    L      V++    + V++
Sbjct: 105 TAGVPDLLLW-KEKEAKLAEVKGPGDLLSEQQVAWFLILSDANVPVELCKVFKTVND 160


>gi|182637545|ref|YP_001828716.1| hypothetical protein LaP1706_gp68 [Lactococcus phage 1706]
 gi|157884984|gb|ABV91275.1| unknown [Lactococcus phage 1706]
          Length = 99

 Score = 48.6 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/100 (19%), Positives = 38/100 (38%), Gaps = 7/100 (7%)

Query: 9   QTEKDVEKRLVT-GAKKL--DCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP-TGRL 64
             E     +++    K +   C + K      +G PD  ++   G +  +E KK  T + 
Sbjct: 1   MIENKWVTKVLKPRLKHMFPGCIIMKNDPNDNQGIPDITVVW-GGTVAMLEAKKKATAKR 59

Query: 65  SHQQMSEIEELR-RRGQRVKVLVSMEEVDNFLEELACTLY 103
              Q   I+  +       +V+   E +D  +++L    Y
Sbjct: 60  QPNQEWYIDHCKHDLSIFAEVVY-PENLDEVMDDLYDYFY 98


>gi|171684591|ref|XP_001907237.1| hypothetical protein [Podospora anserina S mat+]
 gi|170942256|emb|CAP67908.1| unnamed protein product [Podospora anserina S mat+]
          Length = 864

 Score = 48.6 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 26/77 (33%), Gaps = 20/77 (25%)

Query: 39  GCPDRLIIT-------------------PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRG 79
           G PD ++                       G + + EVK    RLS  Q   I  L   G
Sbjct: 788 GVPDLVLWRTAGDEAQTNRDGIINNNIDRKGEVMFAEVKSANDRLSDTQRLWIHVLTGAG 847

Query: 80  QRVKVLVSME-EVDNFL 95
            RV +  ++  EV   L
Sbjct: 848 VRVALCNAVAREVRTLL 864


>gi|312114234|ref|YP_004011830.1| VRR-NUC domain-containing protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219363|gb|ADP70731.1| VRR-NUC domain-containing protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 139

 Score = 47.8 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 1/55 (1%)

Query: 41  PDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           PD ++          EVK  +GRLS  Q   +E +   G    V+ S++E    +
Sbjct: 81  PD-MVGRTVAIFHAWEVKDGSGRLSTSQRRFLEHVEDCGGVAAVVRSVDEALQAV 134


>gi|330792612|ref|XP_003284382.1| hypothetical protein DICPUDRAFT_148139 [Dictyostelium purpureum]
 gi|325085728|gb|EGC39130.1| hypothetical protein DICPUDRAFT_148139 [Dictyostelium purpureum]
          Length = 1126

 Score = 47.8 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 52   LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            + ++EVK P  RL  QQ   I+ L   G  V++  
Sbjct: 1088 IKFVEVKGPGDRLRDQQRVWIDLLISFGCDVELCY 1122


>gi|281204196|gb|EFA78392.1| myotubularin related protein 15 [Polysphondylium pallidum PN500]
          Length = 933

 Score = 47.8 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 25/68 (36%), Gaps = 12/68 (17%)

Query: 27  CWVRKASFVGRR----GCPDRLIITPNGG--------LWWIEVKKPTGRLSHQQMSEIEE 74
            +  K           G PD L+ + N          + ++EVK     LS+QQ   I+ 
Sbjct: 842 GYCSKLITEDYTCFSHGMPDLLLWSRNPDDQLEESYFIKFVEVKGAGDTLSNQQKVWIDM 901

Query: 75  LRRRGQRV 82
           L   G  V
Sbjct: 902 LLNFGCDV 909


>gi|302824983|ref|XP_002994129.1| hypothetical protein SELMODRAFT_432067 [Selaginella moellendorffii]
 gi|300138038|gb|EFJ04822.1| hypothetical protein SELMODRAFT_432067 [Selaginella moellendorffii]
          Length = 976

 Score = 47.8 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 20/51 (39%), Gaps = 1/51 (1%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVS 87
             G PD L+          EVK P  RLS QQ++    L      V++   
Sbjct: 708 TAGMPDLLLW-KEKEAKLAEVKGPGDRLSEQQVACFLILSDANVPVELCKD 757


>gi|326434936|gb|EGD80506.1| hypothetical protein PTSG_01097 [Salpingoeca sp. ATCC 50818]
          Length = 1113

 Score = 47.8 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 4/51 (7%)

Query: 39   GCPDRLIIT--PNGG--LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            G PD L+    P G     ++EVK P   L+ +Q   I  L   G  V + 
Sbjct: 1042 GLPDLLLWKQQPTGERLATFVEVKSPNDTLAEKQKIWIHVLVTLGANVALC 1092


>gi|291559649|emb|CBL38449.1| hypothetical protein CL2_15080 [butyrate-producing bacterium SSC/2]
          Length = 73

 Score = 47.8 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 28/73 (38%), Gaps = 4/73 (5%)

Query: 30  RKASFVGRRGCPDRLIITPNGGLWWIEVKK-PTGRLSHQQMSEIEELRRRGQRVKVLVSM 88
            KA     +G PD LI+  +     +EVKK         Q   ++++        +    
Sbjct: 1   MKADSADIQGIPDLLILYKD-KWASLEVKKNKKASHRPNQDYYVDKMEDMSFSRFIY--P 57

Query: 89  EEVDNFLEELACT 101
           E  ++ L +L  T
Sbjct: 58  ENKEDVLNDLEQT 70


>gi|313223049|emb|CBY43339.1| unnamed protein product [Oikopleura dioica]
          Length = 374

 Score = 47.8 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 3/42 (7%)

Query: 37  RRGCPDRLII---TPNGGLWWIEVKKPTGRLSHQQMSEIEEL 75
           R G PD +       +G   + EVK P   LS+ Q   ++ L
Sbjct: 318 RSGMPDLIAWSSTGEDGRYLFCEVKAPNDTLSYGQKLWLKYL 359


>gi|326692837|ref|ZP_08229842.1| hypothetical protein LargK3_03678 [Leuconostoc argentinum KCTC
          3773]
          Length = 100

 Score = 47.4 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 45/94 (47%), Gaps = 5/94 (5%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRKA---SFVGRRGCPDRLIITPNGGLWWIEVKKP--TGRL 64
          +E  ++ +++   +    +V K    +     G PD + I P+G    +E+K+P   G +
Sbjct: 3  SEAILQTKIIKFLRHEGRFVIKTQGGTPGTDTGTPDVITIYPDGRFIGLEIKRPDGGGVV 62

Query: 65 SHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
          S +Q +  ++++R      V+ S E+ +    ++
Sbjct: 63 SPEQNAVGKQIQRNQGLWYVIDSWEKFEEVWRDV 96


>gi|302819363|ref|XP_002991352.1| hypothetical protein SELMODRAFT_429674 [Selaginella moellendorffii]
 gi|300140932|gb|EFJ07650.1| hypothetical protein SELMODRAFT_429674 [Selaginella moellendorffii]
          Length = 265

 Score = 47.4 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 19/50 (38%), Gaps = 1/50 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
             G PD L+          EVK P   LS QQ++    L      V++  
Sbjct: 124 TAGMPDLLLW-KEEEAKLAEVKGPGDHLSQQQVAWFLILSDANVPVELCK 172


>gi|320176446|gb|EFW51497.1| hypothetical protein SDB_01039 [Shigella dysenteriae CDC 74-1112]
 gi|323179609|gb|EFZ65172.1| hypothetical protein ECOK1180_1572 [Escherichia coli 1180]
          Length = 50

 Score = 47.4 bits (112), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 18/48 (37%)

Query: 53  WWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
             IE+K    RL+ +Q+  +  L   G       S  E    + E  C
Sbjct: 1   MRIEMKHGRNRLTPEQLVWMTRLTEAGYYCFEARSAAEAIKAITEYVC 48


>gi|315127113|ref|YP_004069116.1| hypothetical protein PSM_A2044 [Pseudoalteromonas sp. SM9913]
 gi|315015627|gb|ADT68965.1| conserved hypothetical protein [Pseudoalteromonas sp. SM9913]
          Length = 718

 Score = 47.0 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           + G PD +I   N  + + EVK P  +L   Q+  I+ L+  G +V + 
Sbjct: 495 KDGYPDLMI-VDNSAVHFEEVKAPGDKLKRNQLVSIDNLKNSGFKVNIA 542


>gi|73951023|ref|XP_856727.1| PREDICTED: similar to C01G5.8 isoform 4 [Canis familiaris]
          Length = 733

 Score = 46.6 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           +EVK P  RLSH+QM  ++EL++ G  V+V 
Sbjct: 690 VEVKGPNDRLSHKQMIWLDELQKLGAEVEVC 720


>gi|66828121|ref|XP_647415.1| myotubularin related protein 15 [Dictyostelium discoideum AX4]
 gi|74859362|sp|Q55FW8|FAN1_DICDI RecName: Full=Fanconi-associated nuclease 1 homolog; AltName:
            Full=Protein MTMR15 homolog
 gi|60475476|gb|EAL73411.1| myotubularin related protein 15 [Dictyostelium discoideum AX4]
          Length = 1087

 Score = 46.6 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 17/34 (50%)

Query: 52   LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
            + ++EVK    RL  QQ   I+ L   G  V+V 
Sbjct: 1047 IKFVEVKGTGDRLRDQQRIWIDMLISFGCDVEVC 1080


>gi|146329976|ref|YP_001210284.1| BcepGomrgp64 [Burkholderia phage BcepGomr]
 gi|145321152|gb|ABP63635.1| BcepGomrgp64 [Burkholderia phage BcepGomr]
          Length = 155

 Score = 46.3 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 4/59 (6%)

Query: 37  RRGCPDRLIITPNGGLW--WIEVKKPT--GRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
           ++G  D     P  G     IE+K+P      S +Q   IE LR +G  V V  +  + 
Sbjct: 71  KKGVCDIHWPYPQWGFHGLMIEMKRPGQLKATSPEQDEYIEYLRSQGYWVDVCDNWAKA 129


>gi|319642259|ref|ZP_07996918.1| VRR-NUC domain-containing protein [Bacteroides sp. 3_1_40A]
 gi|317386115|gb|EFV67035.1| VRR-NUC domain-containing protein [Bacteroides sp. 3_1_40A]
          Length = 157

 Score = 46.3 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 25/65 (38%), Gaps = 2/65 (3%)

Query: 37  RRGCPDRLIITPNGGLWW--IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
             G  D +++ P  G     IE K   G  S +Q     +      +  +  S+++  + 
Sbjct: 92  TSGVSDVILLIPKKGYASLCIEFKTKKGIQSEEQKEFQRQAENCRNKYVIARSVKQGIDA 151

Query: 95  LEELA 99
           L+E  
Sbjct: 152 LKEYL 156


>gi|198276232|ref|ZP_03208763.1| hypothetical protein BACPLE_02423 [Bacteroides plebeius DSM 17135]
 gi|198271044|gb|EDY95314.1| hypothetical protein BACPLE_02423 [Bacteroides plebeius DSM 17135]
          Length = 168

 Score = 45.9 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 25/65 (38%), Gaps = 2/65 (3%)

Query: 37  RRGCPDRLIITPNGGLWW--IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
             G  D +++ P  G     IE K   G  S +Q     +      +  +  S+++  + 
Sbjct: 103 TSGVSDVILLIPKKGYASLCIEFKTKKGIQSEEQKEFQRQAENCRNKYVIARSVKQGIDA 162

Query: 95  LEELA 99
           L+E  
Sbjct: 163 LKEYL 167


>gi|325953895|ref|YP_004237555.1| VRR-NUC domain-containing protein [Weeksella virosa DSM 16922]
 gi|323436513|gb|ADX66977.1| VRR-NUC domain-containing protein [Weeksella virosa DSM 16922]
          Length = 124

 Score = 45.9 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 26/92 (28%), Gaps = 11/92 (11%)

Query: 5   SFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLW--WIEVKKPTG 62
            F         ++ V   K               G  D  I+  + G    +IE+K    
Sbjct: 35  IFSIPNGGSRHQKEVAKIKAEGVVA---------GVSDLFIMKASRGFHGLFIEMKYGKN 85

Query: 63  RLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
             + +Q   + + R       V  S EE    
Sbjct: 86  TTTEKQDVFLAKARSERYATAVCYSFEEFVKI 117


>gi|298706863|emb|CBJ25827.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 1134

 Score = 45.5 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 1/48 (2%)

Query: 44   LIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
            ++        W+EVK P   LS  Q + I+ L   G    VL  +E+ 
Sbjct: 1082 VLPRKEACCKWVEVKGPGDSLSCAQEAWIDALVGAGADFAVLR-VEDA 1128


>gi|325120420|emb|CBZ55974.1| Proteophosphoglycan 5, related [Neospora caninum Liverpool]
          Length = 2446

 Score = 45.1 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 17/37 (45%)

Query: 50   GGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            G + + EVK P  RLS +Q   +    R G   +V  
Sbjct: 2183 GEILFAEVKGPRDRLSEKQKCWLAHFLRAGVPCEVCK 2219


>gi|325479526|gb|EGC82622.1| hypothetical protein HMPREF9290_1237 [Anaerococcus prevotii
          ACS-065-V-Col13]
          Length = 43

 Score = 45.1 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 37 RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELR 76
            G PDR+I+   G +  IEVK+P       Q   ++ L+
Sbjct: 1  MTGIPDRIILLTKGKIEIIEVKRPGREPRPIQKKNMDILK 40


>gi|302411246|ref|XP_003003456.1| conserved hypothetical protein [Verticillium albo-atrum VaMs.102]
 gi|261357361|gb|EEY19789.1| conserved hypothetical protein [Verticillium albo-atrum VaMs.102]
          Length = 752

 Score = 45.1 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 30/89 (33%), Gaps = 11/89 (12%)

Query: 15  EKRLVTGAKKLDCWVRKASFVGRR---GCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSE 71
           ++R V   +     V       RR   G PD     P     + EVK    R+S  Q   
Sbjct: 653 QQRTVHDLQGDGARV----TPARRWHPG-PDLWRTEPQKECMFAEVKSAKDRISDTQRLW 707

Query: 72  IEELRRRGQRVK---VLVSMEEVDNFLEE 97
           I  L   G RV+      + ++      E
Sbjct: 708 ILVLTGTGVRVRALQCCRARDQGGRLRRE 736


>gi|134075852|emb|CAL00231.1| unnamed protein product [Aspergillus niger]
          Length = 850

 Score = 44.7 bits (105), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 22/73 (30%), Gaps = 28/73 (38%)

Query: 39  GCPDRLIIT----------------------------PNGGLWWIEVKKPTGRLSHQQMS 70
           G PD L+                                G + ++EVK    RLS  Q  
Sbjct: 769 GVPDLLVWRVYNQEDGGGEGVDGGEEGKSDADAEGKEGYGEVMFVEVKSANDRLSDSQRL 828

Query: 71  EIEELRRRGQRVK 83
            I  L   G RV+
Sbjct: 829 WIHVLASAGVRVE 841


>gi|187251384|ref|YP_001875866.1| hypothetical protein Emin_0976 [Elusimicrobium minutum Pei191]
 gi|186971544|gb|ACC98529.1| hypothetical protein Emin_0976 [Elusimicrobium minutum Pei191]
          Length = 160

 Score = 44.3 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 29/88 (32%), Gaps = 20/88 (22%)

Query: 24  KLDCWVRKASFVG-RRGCPDRLII--TPNGGLWWIE-----------------VKKPTGR 63
           ++    +K    G + G PD  +I       + + E                 +K P G+
Sbjct: 63  RIGAAYKKMVAEGFKPGAPDLCVIVQHNGLKVGFFEQKKPEVKEISPLTGKLRIKSPKGQ 122

Query: 64  LSHQQMSEIEELRRRGQRVKVLVSMEEV 91
           +S  Q   + E    G    V  + E+ 
Sbjct: 123 VSDNQQKFLAEAVNMGIFCAVSYTFEDF 150


>gi|298712072|emb|CBJ26652.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 1005

 Score = 43.6 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 10/46 (21%), Positives = 18/46 (39%)

Query: 49  NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
              +  +EVK     +S +Q + + EL   G    V   + E +  
Sbjct: 952 GWEVEVVEVKSKGDTISKEQKAWLAELEDIGVPAMVSRVVAENEAV 997


>gi|330858501|ref|YP_004414876.1| hypothetical protein Shfl1p60 [Shigella phage Shfl1]
 gi|327397435|gb|AEA72938.1| hypothetical protein Shfl1p60 [Shigella phage Shfl1]
          Length = 138

 Score = 43.6 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 34/106 (32%), Gaps = 21/106 (19%)

Query: 3   FYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPD---RLIITPNGGLWWIEVKK 59
           F+    + EK +   L                   +G  D    + +        IE+K+
Sbjct: 42  FWHTVNEGEKTITSALRDE-----------QAGLLKGVSDFVILIGVNSRHPFAAIELKR 90

Query: 60  ----PTGRLSH---QQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
                 G+ S    +Q   + ++R RG    V    E+    + E+
Sbjct: 91  VNKSGKGKASPVSDKQKEFLRKVRERGGFSAVAYGFEQFKIAIYEM 136


>gi|114773251|ref|ZP_01450486.1| hypothetical protein OM2255_00307 [alpha proteobacterium HTCC2255]
 gi|114546370|gb|EAU49279.1| hypothetical protein OM2255_00307 [alpha proteobacterium HTCC2255]
          Length = 313

 Score = 43.6 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 31/81 (38%), Gaps = 9/81 (11%)

Query: 12  KDVEKRLVTGAKKLD----CWVRKASFVGRR----GCPDRLIITPNGGLWWIEVKKPTGR 63
           K + KRLV   +         V KA          G PD ++I  N  + + E+K     
Sbjct: 50  KQILKRLVLFIEHAKAASLGNVLKAMAQDYAMYSDGFPDIMVID-NQQVRFEEIKATGDS 108

Query: 64  LSHQQMSEIEELRRRGQRVKV 84
           +   Q+  +  L + G  V +
Sbjct: 109 VRKNQLLTLSMLSKAGISVGI 129


>gi|298374680|ref|ZP_06984638.1| conserved hypothetical protein [Bacteroides sp. 3_1_19]
 gi|298269048|gb|EFI10703.1| conserved hypothetical protein [Bacteroides sp. 3_1_19]
          Length = 168

 Score = 43.6 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 28/74 (37%), Gaps = 6/74 (8%)

Query: 27  CWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
              RK       G  D  +    G ++  E+K    R S  Q +    +++ G    V+ 
Sbjct: 90  GRWRK--SGTTTGIADVQVTH-EGRVYNFEIKIGRDRQSDVQKAVETRIKKAGGHYAVIK 146

Query: 87  SMEEVDNFLEELAC 100
             ++   FL+E+  
Sbjct: 147 CYDD---FLKEIIH 157


>gi|256839134|ref|ZP_05544644.1| predicted protein [Parabacteroides sp. D13]
 gi|256740053|gb|EEU53377.1| predicted protein [Parabacteroides sp. D13]
          Length = 143

 Score = 43.6 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 28/74 (37%), Gaps = 6/74 (8%)

Query: 27  CWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
              RK       G  D  +    G ++  E+K    R S  Q +    +++ G    V+ 
Sbjct: 65  GRWRK--SGTTTGIADVQVTH-EGRVYNFEIKIGRDRQSDVQKAVETRIKKAGGHYAVIK 121

Query: 87  SMEEVDNFLEELAC 100
             ++   FL+E+  
Sbjct: 122 CYDD---FLKEIIH 132


>gi|221506178|gb|EEE31813.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 2760

 Score = 43.6 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 18/38 (47%)

Query: 49   NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            +  + + EVK P  RLS +Q   +  L R G   ++  
Sbjct: 2501 DPEILFAEVKGPRDRLSEKQRYWLAHLLRAGVPCEMCK 2538


>gi|221485319|gb|EEE23600.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 2757

 Score = 43.6 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 18/38 (47%)

Query: 49   NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            +  + + EVK P  RLS +Q   +  L R G   ++  
Sbjct: 2498 DPEILFAEVKGPRDRLSEKQRYWLAHLLRAGVPCEMCK 2535


>gi|237835697|ref|XP_002367146.1| hypothetical protein TGME49_047790 [Toxoplasma gondii ME49]
 gi|211964810|gb|EEB00006.1| hypothetical protein TGME49_047790 [Toxoplasma gondii ME49]
          Length = 2760

 Score = 43.6 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 18/38 (47%)

Query: 49   NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
            +  + + EVK P  RLS +Q   +  L R G   ++  
Sbjct: 2501 DPEILFAEVKGPRDRLSEKQRYWLAHLLRAGVPCEMCK 2538


>gi|325958859|ref|YP_004290325.1| VRR-NUC domain-containing protein [Methanobacterium sp. AL-21]
 gi|325330291|gb|ADZ09353.1| VRR-NUC domain-containing protein [Methanobacterium sp. AL-21]
          Length = 218

 Score = 43.6 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 42/108 (38%), Gaps = 20/108 (18%)

Query: 7   HYQTE------KDVEK-RLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKK 59
           HY  E      K +EK +L+   K+L     K +     G PD ++       ++ EVK 
Sbjct: 118 HYLIEDYLIPLKFIEKEKLLEFIKRL---AFKNT-----GLPDLIV-YNEENFFFSEVKS 168

Query: 60  PTGRLSHQQMSEIEEL-RRRGQRVKVL---VSMEEVDNFLEELACTLY 103
              R+S  Q      L  +    V++L    S ++++N         +
Sbjct: 169 ENDRISDDQFEWHMFLSEKLNLNVEILLINNSQKKIENIKNRYQKCGF 216


>gi|224368290|ref|YP_002602453.1| hypothetical protein HRM2_11770 [Desulfobacterium autotrophicum
           HRM2]
 gi|223691006|gb|ACN14289.1| hypothetical protein HRM2_11770 [Desulfobacterium autotrophicum
           HRM2]
          Length = 331

 Score = 43.2 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRR 77
           R+G PD  I   +G + ++EVK P   +   Q + I ++  
Sbjct: 275 RKGWPDLTIW-KDGEVKFLEVKSPNDTMRKSQETIISKIMN 314


>gi|154345932|ref|XP_001568903.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134066245|emb|CAM44035.1| conserved hypothetical protein [Leishmania braziliensis
            MHOM/BR/75/M2904]
          Length = 1744

 Score = 43.2 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 31/95 (32%), Gaps = 29/95 (30%)

Query: 27   CWVRKASFVG----RRGCPDRLIITPNG------------------------GLWWIEVK 58
            C        G      G PD +     G                            +EVK
Sbjct: 1640 CLYLSPVTEGVPLEFSGFPDLVFWRTGGCGGGNYRYAAIQPSAEESSTVLRASFCLMEVK 1699

Query: 59   KPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN 93
             P   LS +Q++  + LRR G  V V+  ++EV +
Sbjct: 1700 SPNDCLSTKQIAVNDLLRRCGFEVFVVH-VDEVHD 1733


>gi|37679936|ref|NP_934545.1| hypothetical protein VV1752 [Vibrio vulnificus YJ016]
 gi|37198682|dbj|BAC94516.1| hypothetical protein [Vibrio vulnificus YJ016]
          Length = 237

 Score = 43.2 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 37  RRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEEL 75
           R+G  D  I   +G + ++EVK P  R+   Q   IE+ 
Sbjct: 184 RKGWADLTIW-KDGCVKFLEVKAPGDRVQSSQKVIIEKF 221


>gi|327198108|ref|YP_004306638.1| hypothetical protein EnPhEFRM31_gp10 [Enterococcus phage EFRM31]
 gi|297179203|gb|ADI23904.1| hypothetical protein [Enterococcus phage EFRM31]
          Length = 124

 Score = 43.2 bits (101), Expect = 0.013,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 25/75 (33%), Gaps = 5/75 (6%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRKASFVG---RRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
           E +  + +V   K     V   +      R G  D       G    +E+K    +   
Sbjct: 3  REANFSREVVKYLKSRGALV-NVNTANIYDRVGRADIEACYK-GYYIALELKTGNYKADK 60

Query: 67 QQMSEIEELRRRGQR 81
           Q+  ++E+R  G  
Sbjct: 61 LQIRYLQEIRCAGGY 75


>gi|156061675|ref|XP_001596760.1| hypothetical protein SS1G_02983 [Sclerotinia sclerotiorum 1980]
 gi|154700384|gb|EDO00123.1| hypothetical protein SS1G_02983 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 867

 Score = 42.8 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 20/49 (40%)

Query: 48  PNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
               + ++EVK    RLS  Q   I  L   G RV++   +      ++
Sbjct: 817 RKKEVRFVEVKSGNDRLSDTQRMWIHVLMGAGIRVELCNVVAREVRIID 865


>gi|237721130|ref|ZP_04551611.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|298480930|ref|ZP_06999125.1| VRR-NUC domain protein [Bacteroides sp. D22]
 gi|229449965|gb|EEO55756.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|298272953|gb|EFI14519.1| VRR-NUC domain protein [Bacteroides sp. D22]
          Length = 149

 Score = 42.8 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 24/64 (37%), Gaps = 8/64 (12%)

Query: 38  RGCPDRLIITPNGG--LWWIEVKKPT------GRLSHQQMSEIEELRRRGQRVKVLVSME 89
            G  D +++ P GG     IE+K P       G  S +Q      + + G    V   + 
Sbjct: 61  AGVADLILLFPRGGKSSLCIEMKTPHVKGKRAGTQSDEQKEWQALVEKYGSVYVVCHGLI 120

Query: 90  EVDN 93
           E  N
Sbjct: 121 EFIN 124


>gi|317498257|ref|ZP_07956556.1| VRR-NUC domain-containing protein [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316894466|gb|EFV16649.1| VRR-NUC domain-containing protein [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 135

 Score = 42.4 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 24/106 (22%), Positives = 43/106 (40%), Gaps = 6/106 (5%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKL--DCWVRKASFVG--RRGCPDRLIITPNGGLWWIE 56
           M       + E   + ++  G +K   + ++RK       + G PD L+I   G  +  E
Sbjct: 31  MKDLRKQIKKESYYQDKIKRGLQKKYPEAFIRKVPQGAYCQAGIPDILMIYK-GHYFGFE 89

Query: 57  VKKPT-GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           VK+P  G  S  Q   + ++R  G   + +   EE    +E+    
Sbjct: 90  VKRPVVGIRSKLQEQTVLKIREAGGTAEFVTWPEEAIAEVEKYEQK 135


>gi|148912871|ref|YP_001293450.1| hypothetical protein ORF043 [Pseudomonas phage 73]
          Length = 179

 Score = 42.4 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 29/83 (34%), Gaps = 23/83 (27%)

Query: 37  RRGCPDRLIITP--------------NGGLWWIEVKKPTGRL---------SHQQMSEIE 73
           R+G  D  +  P                   +IE+KKPT R          S +Q S  E
Sbjct: 89  RQGVADTFLPWPVYEQCPADSQIMMMKWAGLYIEMKKPTERPKSETAKGGVSDEQRSFGE 148

Query: 74  ELRRRGQRVKVLVSMEEVDNFLE 96
             +R G    V    E+  ++L 
Sbjct: 149 YAKRVGYGWAVCYDWEQAASYLR 171


>gi|164414592|emb|CAJ28487.1| hypothetical protein [Yersinia phage PY100]
          Length = 167

 Score = 42.0 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 22/69 (31%), Gaps = 3/69 (4%)

Query: 38  RGCPDRLIIT--PNGGLWWIEVK-KPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNF 94
            G  D +++    N  +   E+K    G LS  Q   +  +   G  V V          
Sbjct: 99  NGVSDIIVLRAGKNHSVGIFELKRANGGTLSRAQKGFLYNMSHCGHFVAVCYGSAAFKQA 158

Query: 95  LEELACTLY 103
            ++     Y
Sbjct: 159 FKDYVEGTY 167


>gi|293372915|ref|ZP_06619284.1| VRR-NUC domain protein [Bacteroides ovatus SD CMC 3f]
 gi|292631983|gb|EFF50592.1| VRR-NUC domain protein [Bacteroides ovatus SD CMC 3f]
          Length = 149

 Score = 42.0 bits (98), Expect = 0.030,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 23/64 (35%), Gaps = 8/64 (12%)

Query: 38  RGCPDRLIITPNGG--LWWIEVKKPT------GRLSHQQMSEIEELRRRGQRVKVLVSME 89
            G  D +++ P GG     IE+K P       G  S  Q      + + G    V   + 
Sbjct: 61  AGVADLILLFPRGGKSSLCIEMKTPHVKGKRAGTQSDGQKEWQALVEKYGSVYVVCHGLI 120

Query: 90  EVDN 93
           E  N
Sbjct: 121 EFIN 124


>gi|62362404|ref|YP_224269.1| hypothetical protein LPPPVgp38 [Listonella phage phiHSIC]
 gi|58220026|gb|AAW67538.1| hypothetical protein [Listonella phage phiHSIC]
          Length = 127

 Score = 41.6 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 30/95 (31%), Gaps = 13/95 (13%)

Query: 7   HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVK--KPTGRL 64
           H + E       V   K               G  D +I  P      IE+K      ++
Sbjct: 39  HIKNEGKRNINQVNEDKANGMV---------TGAVDIVI--PGAPTLLIELKKRSKRAKV 87

Query: 65  SHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           S  Q++ +E   ++G    V    E     +EE  
Sbjct: 88  SEAQVNYMESAAKQGAMCYVCYGWESAMQAVEEWE 122


>gi|328868568|gb|EGG16946.1| myotubularin related protein 15 [Dictyostelium fasciculatum]
          Length = 920

 Score = 41.2 bits (96), Expect = 0.051,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 20/59 (33%), Gaps = 14/59 (23%)

Query: 38  RGCPDRLII--------------TPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRV 82
            G PD  +                 +  + + EVK    RL+  Q   I+ L   G +V
Sbjct: 854 SGAPDLFLWKNNNNDNDNNNNNNNNSYTIKFCEVKGEGDRLAAHQKIWIDVLLSYGCQV 912


>gi|313633606|gb|EFS00379.1| gp61 [Listeria seeligeri FSL N1-067]
          Length = 46

 Score = 40.9 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 21/45 (46%)

Query: 52 LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96
          +++IEVK   G+L  +Q +  + +        V  S EE    +E
Sbjct: 1  MFFIEVKNEIGKLRQEQKNFQQAMEITPAICGVARSAEEALRIVE 45


>gi|115375090|ref|ZP_01462359.1| hypothetical protein STIAU_3189 [Stigmatella aurantiaca DW4/3-1]
 gi|310825438|ref|YP_003957796.1| hypothetical protein STAUR_8214 [Stigmatella aurantiaca DW4/3-1]
 gi|115367928|gb|EAU66894.1| hypothetical protein STIAU_3189 [Stigmatella aurantiaca DW4/3-1]
 gi|309398510|gb|ADO75969.1| uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 459

 Score = 40.9 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 22/81 (27%), Gaps = 10/81 (12%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQM 69
            EK  E       K++           + G  D L+         +E K   G       
Sbjct: 307 REKKFEAAFEALMKRVGIPCTLFDSGQKPGAFDYLLRIEGRPPVIVECKTKQG------- 359

Query: 70  SEIEELRRRGQRVKVLVSMEE 90
              + L        VL S E+
Sbjct: 360 ---DHLVDLNAARTVLSSSEQ 377


>gi|167751786|ref|ZP_02423913.1| hypothetical protein ALIPUT_00026 [Alistipes putredinis DSM 17216]
 gi|167753332|ref|ZP_02425459.1| hypothetical protein ALIPUT_01606 [Alistipes putredinis DSM 17216]
 gi|167659263|gb|EDS03393.1| hypothetical protein ALIPUT_01606 [Alistipes putredinis DSM 17216]
 gi|167660684|gb|EDS04814.1| hypothetical protein ALIPUT_00026 [Alistipes putredinis DSM 17216]
          Length = 118

 Score = 40.9 bits (95), Expect = 0.065,   Method: Composition-based stats.
 Identities = 11/63 (17%), Positives = 23/63 (36%), Gaps = 4/63 (6%)

Query: 37  RRGCPDRLIITPNGGL--WWIEVKK--PTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVD 92
             G  D L++ P  G     +E K      R +  Q    +   + G +  ++ ++ E  
Sbjct: 50  TAGAADLLLLVPRDGFGVLGLEFKTQVKGSRQTPAQKQWQKSFEQVGNKYVLVRTLNEAI 109

Query: 93  NFL 95
             +
Sbjct: 110 TAV 112


>gi|219118658|ref|XP_002180097.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217408354|gb|EEC48288.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 1418

 Score = 40.5 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 23/59 (38%), Gaps = 7/59 (11%)

Query: 40   CPDRLIITPNGG-----LWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN 93
             P+RL +  NG         +EVK    RL  +Q   +  L + G   +V    E+   
Sbjct: 1347 VPERLELCCNGRNIKAECMMVEVKSSNDRLDPRQEDWLNILDQHG-NARVCK-FEDSKK 1403


>gi|307318964|ref|ZP_07598395.1| adhesin HecA family [Sinorhizobium meliloti AK83]
 gi|306895378|gb|EFN26133.1| adhesin HecA family [Sinorhizobium meliloti AK83]
          Length = 1862

 Score = 40.1 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 28/75 (37%), Gaps = 6/75 (8%)

Query: 7    HYQTEKDVEKRLVTGAKKLDCWVRK--ASFVGRRGC----PDRLIITPNGGLWWIEVKKP 60
            HY+  K +   L    +     V K   SF    G     PD +   P+G    IEVK  
Sbjct: 1744 HYKHHKAMTDDLKAQLESQGYRVSKEELSFGSSCGTGRCRPDIVYQAPDGKWGIIEVKTG 1803

Query: 61   TGRLSHQQMSEIEEL 75
               L+ +Q     ++
Sbjct: 1804 DASLTFRQEEIYPQI 1818


>gi|315426339|dbj|BAJ47979.1| conserved hypothetical protein [Candidatus Caldiarchaeum
           subterraneum]
 gi|315426366|dbj|BAJ48005.1| conserved hypothetical protein [Candidatus Caldiarchaeum
           subterraneum]
          Length = 96

 Score = 40.1 bits (93), Expect = 0.093,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 40/95 (42%), Gaps = 5/95 (5%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
           Y+  +  E  +    +     V +A+    R  P  L+   +G +  +E K   GRL  +
Sbjct: 3   YRRGRRFEYEVRDFFEDRGWLVIRAA----RSKPVDLVCIKDGRVMLVECKYAGGRLLKE 58

Query: 68  QMSEIEEL-RRRGQRVKVLVSMEEVDNFLEELACT 101
           +   +E++ +R G  V V    +  +  LE L  +
Sbjct: 59  ERKALEKIGKRYGVDVVVARRKKRGETELETLHHS 93


>gi|45686339|ref|YP_003924.1| hypothetical protein T1p21 [Enterobacteria phage T1]
 gi|37787974|gb|AAP49978.1| unknown [Enterobacteria phage T1]
          Length = 138

 Score = 40.1 bits (93), Expect = 0.099,   Method: Composition-based stats.
 Identities = 17/106 (16%), Positives = 34/106 (32%), Gaps = 21/106 (19%)

Query: 3   FYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPD---RLIITPNGGLWWIEVKK 59
           F+    + EK +   L                   +G  D    + +        IE+K+
Sbjct: 42  FWHTVNEGEKTITSALRDE-----------QAGLLKGVSDFVILIGVNSRYPFAAIELKR 90

Query: 60  ----PTGRLSH---QQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98
                 G+ S    +Q   ++++R RG    V     +    + E+
Sbjct: 91  VNKSGKGKASPVSDKQREFLQKVRERGGFSAVAYGFGQFKIAIYEM 136


>gi|313633558|gb|EFS00355.1| gp61 [Listeria seeligeri FSL N1-067]
          Length = 45

 Score = 39.7 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 19/44 (43%)

Query: 54 WIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEE 97
          +IEVK   G+L  +Q +  + +        V  S  E    +EE
Sbjct: 1  FIEVKNEIGKLRQEQKNFQQAMEITPAICGVARSAAEAVRIVEE 44


>gi|328470258|gb|EGF41169.1| hypothetical protein VP10329_05657 [Vibrio parahaemolyticus 10329]
          Length = 739

 Score = 39.7 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 37/93 (39%), Gaps = 11/93 (11%)

Query: 13  DVEKRLVTGAKKLDCWVRKASFVGRRGCPDR----LIITPNGGLWWIEVKKPTGRLSHQQ 68
            +E +L    K     V K   V   G  D     LI   +  +  IEVK    R +  +
Sbjct: 539 RIENQLGDEFKLRGFSVLKNFTVKSCGGSDVGEIDLICVIDNIVIVIEVKSTYCRTTKSE 598

Query: 69  MSEIEE--LRRRGQRVKVLVSMEEVDNFLEELA 99
           +    +  LR+ G +V+     ++VD  + E+ 
Sbjct: 599 IIYHRDKTLRKAGMQVR-----KKVDAIIREIQ 626


>gi|313621717|gb|EFR92473.1| hypothetical protein NT06LI_3335 [Listeria innocua FSL J1-023]
          Length = 48

 Score = 39.7 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 19/47 (40%)

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +E K P   L   Q     ++  +G     + + E+VDN +     +
Sbjct: 1   METKAPKKELRKLQEKRKAQIEAQGLLHYAVDTKEQVDNLMSHFGAS 47


>gi|288947746|ref|YP_003445129.1| hypothetical protein Alvin_3201 [Allochromatium vinosum DSM 180]
 gi|288898262|gb|ADC64097.1| hypothetical protein Alvin_3201 [Allochromatium vinosum DSM 180]
          Length = 139

 Score = 39.7 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 32/87 (36%), Gaps = 2/87 (2%)

Query: 12 KDVEKRLVTGAKKLD--CWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQM 69
          +D+   ++   K      W         RGC D L     G    ++VK+    L     
Sbjct: 13 RDIRAEILRYLKSDGRVAWAAGVHVRAFRGCSDILGQLETGHFMAVKVKRLGEPLGSGHA 72

Query: 70 SEIEELRRRGQRVKVLVSMEEVDNFLE 96
          + ++++   G    +   +E+V   LE
Sbjct: 73 AFLDQVGTAGGLGILAHGIEDVRQALE 99


>gi|330888354|gb|EGH21015.1| VRR-NUC domain-containing protein [Pseudomonas syringae pv. mori
          str. 301020]
          Length = 67

 Score = 39.3 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 9/50 (18%), Positives = 15/50 (30%), Gaps = 3/50 (6%)

Query: 53 WWIEVKKP---TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           +IE K        +S  Q   I +L  +G    V     +    +    
Sbjct: 9  LYIEFKATPPHDAVVSGSQYEWIRQLGEQGYLAIVCRGHFDAIEQIRAYL 58


>gi|322503627|emb|CBZ38713.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 1735

 Score = 39.3 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 30/93 (32%), Gaps = 29/93 (31%)

Query: 27   CWVRKASFVG----RRGCPDRLIITPNGG------------------------LWWIEVK 58
            C        G      G PD +     G                            +EVK
Sbjct: 1631 CLYLSPVTEGVPLAFSGFPDLVFWRTGGSGGGECSNAALQPSVGGDSAVLRTSFCLMEVK 1690

Query: 59   KPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
             P+  LS +Q++  + L R G  V V+  ++EV
Sbjct: 1691 GPSDFLSTKQIAVNDLLHRCGFEVCVVR-VDEV 1722


>gi|146102891|ref|XP_001469437.1| hypothetical protein [Leishmania infantum]
 gi|134073807|emb|CAM72546.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 1735

 Score = 39.3 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 30/93 (32%), Gaps = 29/93 (31%)

Query: 27   CWVRKASFVG----RRGCPDRLIITPNGG------------------------LWWIEVK 58
            C        G      G PD +     G                            +EVK
Sbjct: 1631 CLYLSPVTEGVPLAFSGFPDLVFWRTGGSGGGECSNAALQPSVGGDSAVLRTSFRLMEVK 1690

Query: 59   KPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
             P+  LS +Q++  + L R G  V V+  ++EV
Sbjct: 1691 GPSDFLSTKQIAVNDLLHRCGFEVCVVR-VDEV 1722


>gi|260595904|ref|YP_003208475.1| hypothetical protein CTU_01120 [Cronobacter turicensis z3032]
 gi|260215081|emb|CBA26815.1| hypothetical protein CTU_01120 [Cronobacter turicensis z3032]
          Length = 1523

 Score = 38.9 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 32/76 (42%), Gaps = 8/76 (10%)

Query: 15   EKRLVTGAKKLDCWVRKASFVGRR--GCPDRLIITPNGGLWWIEVKKPT----GRLSHQQ 68
            E  + +  ++   +    S   +   G  D + +  +G   + EVK  T    G+LS +Q
Sbjct: 1402 ESHVKSQLERSGNYADVFSVQNKSNNGI-DLVGLRHDGKYDFFEVKTNTTGSVGKLSDRQ 1460

Query: 69   MSEIEELRR-RGQRVK 83
            +S  + +    G  V+
Sbjct: 1461 LSSKDFIETVLGTDVR 1476


>gi|170676320|ref|YP_001742081.1| hypothetical protein VIP0044 [Salmonella phage E1]
 gi|170321630|emb|CAM33149.1| conserved hypothetical phage protein [Salmonella phage Vi II-E1]
          Length = 141

 Score = 38.9 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 35/93 (37%), Gaps = 12/93 (12%)

Query: 6   FHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITP--NGGLWWIEVKKP--- 60
           FH   E     R+    K+            + G  D +I+TP  N     IE K+    
Sbjct: 43  FHVPNETGTSSRVQFVLKRQ-------KMGVKSGIGDNVIMTPGANHSCGMIEAKRRDKS 95

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN 93
             R+S +Q   + E+ R G    +   ++E+  
Sbjct: 96  KSRVSKEQSVVLTEMCRLGHYAAIAYGIDELKK 128


>gi|157876999|ref|XP_001686839.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68129914|emb|CAJ09220.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 1725

 Score = 38.9 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 30/93 (32%), Gaps = 29/93 (31%)

Query: 27   CWVRKASFVG----RRGCPDRLIITPNGG------------------------LWWIEVK 58
            C        G      G PD +     G                            +EVK
Sbjct: 1621 CLYLSPVTEGVPLAFSGFPDLVFWLTGGSGGSECGNAAVQPSVGSDSAALRTSFCLMEVK 1680

Query: 59   KPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
             P+  LS +Q++  + L R G  V V+  ++EV
Sbjct: 1681 GPSDFLSTKQIAVNDLLHRCGFEVCVVR-VDEV 1712


>gi|300741872|ref|ZP_07071893.1| helicase, UvrD/Rep family [Rothia dentocariosa M567]
 gi|300381057|gb|EFJ77619.1| helicase, UvrD/Rep family [Rothia dentocariosa M567]
          Length = 1172

 Score = 38.6 bits (89), Expect = 0.32,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%), Gaps = 2/51 (3%)

Query: 42   DRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVD 92
            DRL  T +G    +++K    + +  Q++E  +L     +V V     +  
Sbjct: 1012 DRLEKTEDGRYVIVDLKTGKTKPNKNQIAEHAQLAA--YQVAVEAGAGDAM 1060


>gi|311111763|ref|YP_003982985.1| UvrD/REP helicase family protein [Rothia dentocariosa ATCC 17931]
 gi|310943257|gb|ADP39551.1| UvrD/REP helicase family protein [Rothia dentocariosa ATCC 17931]
          Length = 1172

 Score = 38.6 bits (89), Expect = 0.32,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%), Gaps = 2/51 (3%)

Query: 42   DRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVD 92
            DRL  T +G    +++K    + +  Q++E  +L     +V V     +  
Sbjct: 1012 DRLEKTEDGRYVIVDLKTGKTKPNKNQIAEHAQLAA--YQVAVEAGAGDAM 1060


>gi|269795202|ref|YP_003314657.1| stress response protein, TerZ- and CABP1 [Sanguibacter keddieii DSM
           10542]
 gi|269097387|gb|ACZ21823.1| uncharacterized stress response protein, TerZ- and CABP1
           [Sanguibacter keddieii DSM 10542]
          Length = 689

 Score = 38.6 bits (89), Expect = 0.33,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 4/62 (6%)

Query: 32  ASFVGRRGCPD-RLIITPNGGLWW--IEVKKPTGRLSHQQ-MSEIEELRRRGQRVKVLVS 87
                RR  PD  + +   G +W   +EVK  TG+L  +Q  S ++  R  G    V +S
Sbjct: 318 FVLGERRVVPDGMIRVARGGKVWTALVEVKTGTGQLRKEQVESYLDAARENGYDAVVTIS 377

Query: 88  ME 89
            E
Sbjct: 378 NE 379


>gi|156937915|ref|YP_001435711.1| holliday junction resolvase [Ignicoccus hospitalis KIN4/I]
 gi|156566899|gb|ABU82304.1| holliday junction resolvase [Ignicoccus hospitalis KIN4/I]
          Length = 142

 Score = 38.2 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 32/87 (36%), Gaps = 14/87 (16%)

Query: 14 VEKRLVTGAKKLDCWVRKASFVGRRG----CPDRLIITPNGGLWWIEVKKPTGR----LS 65
           E+ L     ++   V +A   G        PD + +   G    IEVK    +    L 
Sbjct: 7  FERELAGKLYQMGWAVMRAPASGAAAKRYLYPDLVAL-KKGRAVAIEVKTTKDKKYIYLE 65

Query: 66 HQQMSEIEELRRRGQ-----RVKVLVS 87
           +Q   ++E   RG       VKVL S
Sbjct: 66 RRQYEILKEWEERGGADAWVAVKVLYS 92


>gi|322490849|emb|CBZ26113.1| conserved hypothetical protein [Leishmania mexicana
            MHOM/GT/2001/U1103]
          Length = 1736

 Score = 37.8 bits (87), Expect = 0.50,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 29/93 (31%), Gaps = 29/93 (31%)

Query: 27   CWVRKASFVG----RRGCPDRLIITPNGG------------------------LWWIEVK 58
            C        G      G PD +     G                            +EVK
Sbjct: 1632 CLYLSPVTEGVPLAFSGFPDLVFWRTGGSGGGDCSNAAVQPSVEGGSAVRRTSFCLMEVK 1691

Query: 59   KPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
             P+  LS  Q++  + L R G  V V+  ++EV
Sbjct: 1692 SPSDLLSTTQIAVNDLLHRCGFEVCVVH-VDEV 1723


>gi|296393521|ref|YP_003658405.1| hypothetical protein Srot_1101 [Segniliparus rotundus DSM 44985]
 gi|296180668|gb|ADG97574.1| conserved hypothetical protein [Segniliparus rotundus DSM 44985]
          Length = 537

 Score = 37.8 bits (87), Expect = 0.51,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 40  CPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVK 83
            PD L   P+G    +EVK  +  L+  Q +  +++  RG+ V 
Sbjct: 466 YPDGLAKKPDGTYEAVEVKSGSASLTPNQQALRDQI-ARGEPVY 508


>gi|254513464|ref|ZP_05125529.1| hypothetical protein RKLH11_4141 [Rhodobacteraceae bacterium KLH11]
 gi|221532468|gb|EEE35464.1| hypothetical protein RKLH11_4141 [Rhodobacteraceae bacterium KLH11]
          Length = 200

 Score = 37.4 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 28/77 (36%), Gaps = 6/77 (7%)

Query: 7   HYQTEKDVEKRLVTGAKKLDCWVR-KASFVGRR-GC----PDRLIITPNGGLWWIEVKKP 60
           HY+  K +   L    +     V  K    G   G     PD +  TP+G    IEVK  
Sbjct: 82  HYEHHKAMTDDLKLQLRDQGYRVSDKEISFGSSCGTGRCRPDIVYETPDGKWGIIEVKTG 141

Query: 61  TGRLSHQQMSEIEELRR 77
              L+ +Q     ++  
Sbjct: 142 NADLTIRQSEIYPQINS 158


>gi|86604939|ref|YP_473702.1| phycobilisome rod-core linker polypeptide cpcG1 [Synechococcus sp.
           JA-3-3Ab]
 gi|86553481|gb|ABC98439.1| phycobilisome rod-core linker polypeptide cpcG1 [Synechococcus sp.
           JA-3-3Ab]
          Length = 241

 Score = 37.4 bits (86), Expect = 0.69,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 34/97 (35%), Gaps = 11/97 (11%)

Query: 3   FYSFHYQTEKDVEKRLVTGAKKLDCWVRK--ASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
            +S H   E   +K L +  +       K     +G+      L++ PN    ++E+   
Sbjct: 50  IFSEHLMLESYRQKALESQLRN-GAISVKEFIRGLGKSEVYRDLVMVPNDNYRFVEITFQ 108

Query: 61  T--GRLSHQQMSEIEELRRR------GQRVKVLVSME 89
              GR ++ Q   I+           G    V+ S E
Sbjct: 109 RFLGRPTYSQQERIKYSIILATRGLNGFIDAVVDSEE 145


>gi|218295787|ref|ZP_03496583.1| transposase IS116/IS110/IS902 family protein [Thermus aquaticus
          Y51MC23]
 gi|218243946|gb|EED10473.1| transposase IS116/IS110/IS902 family protein [Thermus aquaticus
          Y51MC23]
          Length = 301

 Score = 37.0 bits (85), Expect = 0.76,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 27/76 (35%), Gaps = 9/76 (11%)

Query: 24 KLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVK 83
           L   V         G PD L + P G +  +E     GR     ++    L R G RV 
Sbjct: 15 ALGDRVYHF--PNPDGIPDILSLLPQGAIVGMESTGVYGRP----LAF--ALHRAGFRVY 66

Query: 84 VLVSMEEVDNFLEELA 99
          VL +   V  +   L 
Sbjct: 67 VL-NPAAVKAYARSLL 81


>gi|171186027|ref|YP_001794946.1| hypothetical protein Tneu_1576 [Thermoproteus neutrophilus V24Sta]
 gi|170935239|gb|ACB40500.1| conserved hypothetical protein [Thermoproteus neutrophilus V24Sta]
          Length = 185

 Score = 37.0 bits (85), Expect = 0.86,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 3/45 (6%)

Query: 42  DRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLV 86
           D      +G  + +EVK   GR+S  Q  +   LR  G R  ++ 
Sbjct: 128 DLFAF-KDGVFYAVEVKTNGGRVSETQREKAAVLR--GIRHLLVR 169


>gi|298707697|emb|CBJ26014.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 358

 Score = 37.0 bits (85), Expect = 0.87,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 19/41 (46%)

Query: 53  WWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDN 93
           W +EVK P+ RLS +Q + +  L R    V V    E    
Sbjct: 294 WLLEVKGPSDRLSDRQTAWLRILDRGRALVGVCHVTEGAGG 334


>gi|218670633|ref|ZP_03520304.1| hypothetical protein RetlG_02769 [Rhizobium etli GR56]
          Length = 345

 Score = 37.0 bits (85), Expect = 0.88,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 27/85 (31%), Gaps = 10/85 (11%)

Query: 28  WVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS-----EIEELRRRGQ-- 80
                +   RR  PD L+    G +  +EVK  T     +         I  +   G   
Sbjct: 201 IYYMWAGSRRRYVPDFLVRLTGGTMLALEVK-GTDSPQDKAKRLALDEWIGAINASGGFG 259

Query: 81  --RVKVLVSMEEVDNFLEELACTLY 103
                V  +  ++++ +   A   +
Sbjct: 260 RWDWDVAFAPHQIEDIIRRTAGHRF 284


>gi|197301844|ref|ZP_03166913.1| hypothetical protein RUMLAC_00570 [Ruminococcus lactaris ATCC
           29176]
 gi|197299074|gb|EDY33605.1| hypothetical protein RUMLAC_00570 [Ruminococcus lactaris ATCC
           29176]
          Length = 299

 Score = 37.0 bits (85), Expect = 0.88,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 28/86 (32%), Gaps = 15/86 (17%)

Query: 10  TEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQM 69
            E+ +E+++    +K                PD L    N     IE+K      S +Q 
Sbjct: 72  KERQIEQKVKESLEKEGLLCE---------IPDLLGCDLNYYSSGIELKSYR---SEEQT 119

Query: 70  SEIEELRRRGQRVKVLVSMEEVDNFL 95
                +R    R ++L   E     L
Sbjct: 120 YF--RIREC-LRAEILDDGEITMECL 142


>gi|86608424|ref|YP_477186.1| phycobilisome rod-core linker polypeptide cpcG1 [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556966|gb|ABD01923.1| phycobilisome rod-core linker polypeptide cpcG1 [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 241

 Score = 37.0 bits (85), Expect = 0.89,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 35/96 (36%), Gaps = 9/96 (9%)

Query: 3   FYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFV-GRRGCPDRLIITPNGGLWWIEVKKPT 61
            +S H   E   +K L +  +     V++     G+      L++ PN    +IEV    
Sbjct: 50  IFSEHLMLESYRQKALESQLRNGAISVKEFVRGLGKSEVYRDLVMVPNDNYRFIEVTFQR 109

Query: 62  --GRLSHQQMSEIEELRR------RGQRVKVLVSME 89
             GR ++ Q   I+           G    V+ S E
Sbjct: 110 FLGRPTYSQQERIKYSIIVATKGLDGFIDAVVDSEE 145


>gi|327188049|gb|EGE55277.1| hypothetical protein RHECNPAF_970015 [Rhizobium etli CNPAF512]
          Length = 988

 Score = 36.6 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 27/85 (31%), Gaps = 10/85 (11%)

Query: 28  WVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS-----EIEELRRRGQ-- 80
                +   RR  PD L+    G +  +EVK  T     +         I  +   G   
Sbjct: 844 IYYMWAGSRRRYVPDFLVRLTGGTMLALEVK-GTDSPQDKAKRLALDEWIGAINASGGFG 902

Query: 81  --RVKVLVSMEEVDNFLEELACTLY 103
                V  +  ++++ +   A   +
Sbjct: 903 RWDWDVAFAPHQIEDIIRRTAGHRF 927


>gi|240142354|ref|YP_002966864.1| hypothetical protein MexAM1_META2p0676 [Methylobacterium extorquens
           AM1]
 gi|240012298|gb|ACS43523.1| Hypothetical protein MexAM1_META2p0676 [Methylobacterium extorquens
           AM1]
          Length = 330

 Score = 36.6 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 25/66 (37%), Gaps = 4/66 (6%)

Query: 22  AKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRR-RGQ 80
            ++           G+ G PD  I      L ++EVK    R+   Q S I ++    G 
Sbjct: 266 IRRYHEHCYSVGANGQGGHPDLTI--SGSELRFVEVKGK-DRMHANQASWIVDIAEPLGL 322

Query: 81  RVKVLV 86
            V VL 
Sbjct: 323 DVTVLK 328


>gi|304407954|ref|ZP_07389604.1| conserved hypothetical protein [Paenibacillus curdlanolyticus YK9]
 gi|304342973|gb|EFM08817.1| conserved hypothetical protein [Paenibacillus curdlanolyticus YK9]
          Length = 473

 Score = 36.6 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 68  QMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
           Q   I++LRR G +  +L S +E+   L+++  
Sbjct: 242 QDLRIKDLRRYGIQAVILDSYDEITEILQDIEH 274


>gi|55978207|ref|YP_145263.1| hypothetical protein TTHB025 [Thermus thermophilus HB8]
 gi|55773380|dbj|BAD71820.1| conserved hypothetical protein [Thermus thermophilus HB8]
          Length = 436

 Score = 36.6 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 11/46 (23%), Positives = 18/46 (39%), Gaps = 3/46 (6%)

Query: 42  DRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRG-QRVKVLV 86
           D +++ P G  W +EVK+             E L+    Q   V+ 
Sbjct: 366 DLVLLLPGGRFWAVEVKRSLD-PRPS-RGFHEALKDLKPQEAFVIY 409


>gi|81343982|ref|YP_398998.1| hypothetical protein rtp54 [Enterobacteria phage RTP]
 gi|80750705|emb|CAJ42258.1| conserved protein [Enterobacteria phage RTP]
          Length = 139

 Score = 36.6 bits (84), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 31/95 (32%), Gaps = 10/95 (10%)

Query: 17  RLVTGAKKLDCWVRKASFVGR-RGCPDRLIITPNG-----GLWWIEVKKPTGR----LSH 66
             V   KK     RK    G  +G  D + + P           IE+K+        +S 
Sbjct: 45  HCVNEGKKTIGQARKDQAKGLLKGVSDCMFLIPESIRGKYPFGAIELKRAGKTQASPVSE 104

Query: 67  QQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +Q + ++ +   G    V    E      +E+   
Sbjct: 105 EQKAFLKSVMESGGFSAVAYGREGFLAAFKEMISK 139


>gi|209695028|ref|YP_002262957.1| hypothetical protein VSAL_I1520 [Aliivibrio salmonicida LFI1238]
 gi|208008980|emb|CAQ79205.1| hypothetical protein VSAL_I1520 [Aliivibrio salmonicida LFI1238]
          Length = 181

 Score = 35.9 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 27/64 (42%), Gaps = 1/64 (1%)

Query: 32  ASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRR-RGQRVKVLVSMEE 90
                  G PD  +  P+  L ++ VKK    LS  ++  +  ++      V++    EE
Sbjct: 100 LRTGLTSGEPDLFLYKPDSSLLFVVVKKENEYLSDAELICLSNIKSVLEYDVEIAYLAEE 159

Query: 91  VDNF 94
            +N+
Sbjct: 160 KNNY 163


>gi|259502625|ref|ZP_05745527.1| type III restriction-modification system enzyme [Lactobacillus
           antri DSM 16041]
 gi|259169440|gb|EEW53935.1| type III restriction-modification system enzyme [Lactobacillus
           antri DSM 16041]
          Length = 991

 Score = 35.9 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 26/67 (38%), Gaps = 8/67 (11%)

Query: 41  PDRLIITPNGG---LWWIEVKKPTGRLSHQ-----QMSEIEELRRRGQRVKVLVSMEEVD 92
           PD +    +G       IE K    RL  +     Q    + L+  G   ++  S +EV 
Sbjct: 920 PDFIFKIEHGNKPIYLVIETKAGNMRLGDEEIHIIQQKYFDHLKESGVYYRMATSEQEVH 979

Query: 93  NFLEELA 99
           + + +L 
Sbjct: 980 DLINKLE 986


>gi|327394864|dbj|BAK12286.1| phage-related protein Cll [Pantoea ananatis AJ13355]
          Length = 300

 Score = 35.9 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 42  DRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           D +I+   G ++  E+K     LS  Q ++I+  R+   ++ V+   E +D+ L+    T
Sbjct: 110 DLIILNGTGTVY--EIKSERDSLSRLQ-NQIKNYRKAFGKIYVIAGSEHLDDVLKTTEST 166

Query: 102 L 102
           +
Sbjct: 167 I 167


>gi|325192226|emb|CCA26680.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 875

 Score = 35.9 bits (82), Expect = 2.0,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 21/51 (41%), Gaps = 1/51 (1%)

Query: 53  WWIEVKKPTGRLSHQQMSEIEEL-RRRGQRVKVLVSMEEVDNFLEELACTL 102
             IEVK P  RLS QQ   +     +      V+  +EE  + ++     L
Sbjct: 822 RLIEVKGPRDRLSDQQRVWLCVFNEKMNISASVMHVLEEEKHIIKRGFHCL 872


>gi|269219185|ref|ZP_06163039.1| conserved hypothetical protein [Actinomyces sp. oral taxon 848 str.
           F0332]
 gi|269211332|gb|EEZ77672.1| conserved hypothetical protein [Actinomyces sp. oral taxon 848 str.
           F0332]
          Length = 422

 Score = 35.9 bits (82), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 22/60 (36%), Gaps = 1/60 (1%)

Query: 7   HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
            +  E  V   L+  A+ L   V        R   D ++  PNG    IEVK   G+   
Sbjct: 318 GFLFESAVVHDLLVYAEALGGHVHHYRDSNGREI-DAVLTMPNGSWAAIEVKLGGGQAQR 376


>gi|50282966|ref|YP_053022.1| hypothetical protein VP5_gp22 [Vibrio phage VP5]
          Length = 145

 Score = 35.9 bits (82), Expect = 2.0,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 23/74 (31%), Gaps = 5/74 (6%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTG-----RLS 65
          E  + K L         + R  +     G PD      + G   IE+K          L 
Sbjct: 4  EHGMWKYLRPKLAPHGMFTRIETGGTASGVPDVDAFLEDYGPLKIELKICKDVNNGFTLR 63

Query: 66 HQQMSEIEELRRRG 79
            Q   +++  + G
Sbjct: 64 PAQHRFMQDRIKLG 77


>gi|46255152|ref|YP_006064.1| ATPase [Thermus thermophilus HB27]
 gi|46198001|gb|AAS82411.1| probable ATPase [Thermus thermophilus HB27]
          Length = 308

 Score = 35.9 bits (82), Expect = 2.0,   Method: Composition-based stats.
 Identities = 12/46 (26%), Positives = 19/46 (41%), Gaps = 3/46 (6%)

Query: 42  DRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRG-QRVKVLV 86
           D +++ P G LW +EVK+             E L+    Q   V+ 
Sbjct: 238 DLVLLLPGGRLWAVEVKRGLD-PRPS-RGFHEALKDLKPQEAFVIY 281


>gi|302536760|ref|ZP_07289102.1| ATP-dependent DNA helicase [Streptomyces sp. C]
 gi|302445655|gb|EFL17471.1| ATP-dependent DNA helicase [Streptomyces sp. C]
          Length = 840

 Score = 35.9 bits (82), Expect = 2.0,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 21/51 (41%), Gaps = 5/51 (9%)

Query: 25  LDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEEL 75
              +  +      RG  DR+   P G  + ++ K   G  + +Q++   +L
Sbjct: 661 AGGYAVRI-----RGSMDRVEADPQGRAYVVDFKTGKGAPTREQVARHPQL 706


>gi|227515539|ref|ZP_03945588.1| type III site-specific deoxyribonuclease [Lactobacillus fermentum
           ATCC 14931]
 gi|227086152|gb|EEI21464.1| type III site-specific deoxyribonuclease [Lactobacillus fermentum
           ATCC 14931]
          Length = 991

 Score = 35.9 bits (82), Expect = 2.1,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 24/67 (35%), Gaps = 8/67 (11%)

Query: 41  PDRLIITPNGG---LWWIEVKKPTGRL-----SHQQMSEIEELRRRGQRVKVLVSMEEVD 92
           PD +    +G       IE K    RL        Q    + L+  G   ++  S +EV 
Sbjct: 920 PDFIFKIEHGNKPIYLVIETKAENMRLGDEEIRIIQQKYFDHLQESGVYYRMATSEQEVH 979

Query: 93  NFLEELA 99
             + +L 
Sbjct: 980 ALINKLE 986


>gi|319794567|ref|YP_004156207.1| hypothetical protein Varpa_3921 [Variovorax paradoxus EPS]
 gi|315597030|gb|ADU38096.1| hypothetical protein Varpa_3921 [Variovorax paradoxus EPS]
          Length = 707

 Score = 35.9 bits (82), Expect = 2.1,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 29/81 (35%), Gaps = 14/81 (17%)

Query: 10  TE--KDVEKRLVTGAKKLDCWV-RKASFV----GRRGCPDRLIITPNGGLWWIEVKKPTG 62
            E  + +E RL T  +     V           G  G  D +    +G ++ IEVK    
Sbjct: 540 REETQRIETRLGTALEARGFKVMLNWHPPTETHGNAGEVDLI-CARDGTVFVIEVKSTF- 597

Query: 63  RLSHQQM-SEIEE---LRRRG 79
            +   Q  + +     LRR G
Sbjct: 598 -VRKSQRDAWLHATTTLRRAG 617


>gi|147921747|ref|YP_684431.1| putative type III restriction-modification system, restriction
           subunit [uncultured methanogenic archaeon RC-I]
 gi|110619827|emb|CAJ35105.1| putative type III restriction-modification system, restriction
           subunit [uncultured methanogenic archaeon RC-I]
          Length = 935

 Score = 35.5 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 25/78 (32%), Gaps = 8/78 (10%)

Query: 28  WVRKASFVGRRGCPDRLIITPNGGLWWIEVKK----PTGRLSHQQMSEIEELRRRGQ--- 80
            V   + V R+  PD ++    G    +EVK                 I+ + + G    
Sbjct: 855 IVYMFNGVVRKYRPDFIVRLKGGKHLVLEVKGQETFQDQVKRAALEEWIKAVNQHGGFGV 914

Query: 81  -RVKVLVSMEEVDNFLEE 97
               V     +V+  + +
Sbjct: 915 WSSAVSRDPADVEEIIRK 932


>gi|50282931|ref|YP_052987.1| hypothetical protein VP2p23 [Vibrio phage VP2]
          Length = 145

 Score = 35.5 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 23/74 (31%), Gaps = 5/74 (6%)

Query: 11 EKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTG-----RLS 65
          E  + K L         + R  +     G PD      + G   IE+K          L 
Sbjct: 4  EHGMWKYLRPKLAPHGMFTRIETGGTASGVPDVDAFLEDYGPLKIELKICKDVNNGFTLR 63

Query: 66 HQQMSEIEELRRRG 79
            Q   +++  + G
Sbjct: 64 PAQHRFMQDRIKLG 77


>gi|87200723|ref|YP_497980.1| hypothetical protein Saro_2710 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136404|gb|ABD27146.1| hypothetical protein Saro_2710 [Novosphingobium aromaticivorans DSM
           12444]
          Length = 146

 Score = 35.5 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 27/94 (28%), Gaps = 17/94 (18%)

Query: 7   HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVK-----KPT 61
           H + E    +     AK L             G  D ++  P  G  ++E+K        
Sbjct: 52  HVKNEG---RHNHAKAKTLGVV---------TGHGDYIVTWPKCGTAFVEMKGYSAAGRP 99

Query: 62  GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFL 95
           G LS  Q+         G  V           +L
Sbjct: 100 GELSQAQVDWANRKFMMGFPVACFFCPHAAFEWL 133


>gi|327191123|gb|EGE58169.1| hypothetical protein RHECNPAF_337004 [Rhizobium etli CNPAF512]
          Length = 460

 Score = 35.5 bits (81), Expect = 2.6,   Method: Composition-based stats.
 Identities = 11/45 (24%), Positives = 20/45 (44%), Gaps = 3/45 (6%)

Query: 58  KKPTGRLSHQ---QMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           K  +G+       Q   + +LRR G    V+ + +E    L+ +A
Sbjct: 228 KADSGKAPDAIQRQQQWVMDLRRVGIHCAVVDNFDEYAAVLDSIA 272


>gi|301100454|ref|XP_002899317.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262104234|gb|EEY62286.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 940

 Score = 35.5 bits (81), Expect = 2.6,   Method: Composition-based stats.
 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%)

Query: 53  WWIEVKKPTGRLSHQQMSEIEEL-RRRGQRVKV 84
             +EVK P  RLS +Q+  ++ L    G    V
Sbjct: 870 RVVEVKGPRDRLSDKQLLWLQVLSEEIGLDASV 902


>gi|298253801|ref|ZP_06977390.1| hypothetical protein GV51_1089 [Gardnerella vaginalis 5-1]
 gi|297532137|gb|EFH71110.1| hypothetical protein GV51_1089 [Gardnerella vaginalis 5-1]
          Length = 37

 Score = 35.5 bits (81), Expect = 2.7,   Method: Composition-based stats.
 Identities = 5/30 (16%), Positives = 16/30 (53%)

Query: 72  IEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           +++L+  G +V V+    ++   ++ +  T
Sbjct: 1   MKDLQDLGFKVFVVDDKSQIGGVIDAIQAT 30


>gi|309812078|ref|ZP_07705838.1| conserved hypothetical protein [Dermacoccus sp. Ellin185]
 gi|308433957|gb|EFP57829.1| conserved hypothetical protein [Dermacoccus sp. Ellin185]
          Length = 309

 Score = 35.5 bits (81), Expect = 2.8,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 26/62 (41%), Gaps = 4/62 (6%)

Query: 11 EKDVEKRLVTGAKKL-DCWVRKASFVGR---RGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
          E++VE  L    +++    + + +        G PD L +   G +  IEVK+   R   
Sbjct: 27 EREVEDLLWDNLEEMLGRTLFRVARQAHLPHGGIPDILALDETGRIVVIEVKRDVDRQLL 86

Query: 67 QQ 68
           Q
Sbjct: 87 SQ 88


>gi|22298938|ref|NP_682185.1| putative Spo0A activation inhibitor soj [Thermosynechococcus
          elongatus BP-1]
 gi|22295119|dbj|BAC08947.1| tll1395 [Thermosynechococcus elongatus BP-1]
          Length = 455

 Score = 35.5 bits (81), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 26/73 (35%), Gaps = 13/73 (17%)

Query: 10 TEKDVEKRLVT-GAKKLDC----WVRKASFVGRRGCPDRLIITP-----NGGLWWIEVKK 59
           E ++E++++    K        +  K       G PD LI  P     +     IEVK 
Sbjct: 5  NEAEIEQKIILPLLKVWGYASSDYWSKPKLGN--GYPDFLICLPLAGDRSFNYLVIEVKS 62

Query: 60 PTG-RLSHQQMSE 71
              RL  QQ   
Sbjct: 63 SNESRLRGQQQLR 75


>gi|254513747|ref|ZP_05125809.1| hypothetical protein RKLH11_4351 [Rhodobacteraceae bacterium KLH11]
 gi|221531896|gb|EEE34956.1| hypothetical protein RKLH11_4351 [Rhodobacteraceae bacterium KLH11]
          Length = 286

 Score = 35.1 bits (80), Expect = 3.0,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 24/65 (36%), Gaps = 6/65 (9%)

Query: 7   HYQTEKDVEKRLVTGAKKLDCWVR-KASFVGRR-GC----PDRLIITPNGGLWWIEVKKP 60
           HY+  K +   L    +     V  K    G   G     PD +  TP+G    IEVK  
Sbjct: 222 HYEHHKAMTDDLKLQLRDQGYRVSDKEISFGSSCGTGRCRPDIVYETPDGKWGIIEVKTG 281

Query: 61  TGRLS 65
              L+
Sbjct: 282 NADLT 286


>gi|332169838|gb|AEE19093.1| UvrD/REP helicase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 1046

 Score = 35.1 bits (80), Expect = 3.0,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 27/64 (42%), Gaps = 10/64 (15%)

Query: 40   CPDRLIITPNGGLWWIEVKKPTGRLS-HQQMSEIEEL-RRRGQRVKVLVSMEEVDNFLEE 97
             PDR+++ PNG    I+ K      S  +Q+S   +L    G +V         + FL  
Sbjct: 985  IPDRVVVLPNGDTTIIDYKTGMHNPSHSKQISMYAKLYEEMGFKV--------ANKFLVY 1036

Query: 98   LACT 101
            +  T
Sbjct: 1037 IDAT 1040


>gi|253570419|ref|ZP_04847827.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251839368|gb|EES67451.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 230

 Score = 35.1 bits (80), Expect = 3.1,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 38/110 (34%), Gaps = 14/110 (12%)

Query: 3   FYSFHYQT----EKDVEKRLVTGAKKLDCWVRKASFVGR----RG--CPDRLIITPNGGL 52
           FYS   Q     E  +EK+     +K    +            RG   PD ++   +G  
Sbjct: 32  FYSNKLQRNVFYESMLEKKFYKRLEKSHEVIYYVEQGITITYDRGKYTPDAIVFLDDGKG 91

Query: 53  WWIEVKKPTGRLSHQ-QMSE---IEELRRRGQRVKVLVSMEEVDNFLEEL 98
           + +E+K  T   +   Q      ++     G    +     ++++  E +
Sbjct: 92  FVVEIKPLTEMANQSVQKKFKALLDFCEETGLGATLTDGRTDINHIFETI 141


>gi|299820325|gb|ADJ54335.1| Holliday junction resolvase [archaeon enrichment culture clone
          1(2010)]
          Length = 93

 Score = 35.1 bits (80), Expect = 3.2,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 6/76 (7%)

Query: 7  HYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
          +Y+  +  E R+    +K   +V +++       PD + I  +G +  +EVK+     S 
Sbjct: 4  NYERGRAFEYRVKQYLEKQGYFVVRSAGSH---FPDLIAI-KHGKVLAVEVKRYKPSQSV 59

Query: 67 QQMSE--IEELRRRGQ 80
           Q  E   +EL R G 
Sbjct: 60 IQEVEEKAQELLRYGI 75


>gi|9633035|ref|NP_050143.1| hypothetical protein phiadhp35 [Lactobacillus phage phiadh]
 gi|5730292|emb|CAB52513.1| hypothetical protein [Lactobacillus phage phiadh]
          Length = 90

 Score = 35.1 bits (80), Expect = 3.2,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 27/80 (33%), Gaps = 20/80 (25%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRK-------------ASFVGRRGCPDRLIITPNGGLWWIE 56
          +E  ++ ++     K  C V +              S     G PD        G  WI+
Sbjct: 7  SEHSIQSKIQIELSKHGCTVFRANVGKMRTPDGRFFSTGLPSGFPDL------SGFRWID 60

Query: 57 VKKPTGRLSHQQMSEIEELR 76
           K    +L   Q+   E++R
Sbjct: 61 GKLSILKLR-MQLVNQEKIR 79


>gi|163839981|ref|YP_001624386.1| ATP-dependent DNA helicase [Renibacterium salmoninarum ATCC 33209]
 gi|162953457|gb|ABY22972.1| ATP-dependent DNA helicase [Renibacterium salmoninarum ATCC 33209]
          Length = 1073

 Score = 35.1 bits (80), Expect = 3.2,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 20/38 (52%)

Query: 38  RGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEEL 75
           +G  DRL +T  G L  +++K    + +  Q+ +  +L
Sbjct: 940 KGIVDRLELTAEGTLIVVDLKTGKNKPTAAQVEQHPQL 977


>gi|29347317|ref|NP_810820.1| putative RNA polymerase sigma factor RpoS [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|29339216|gb|AAO77014.1| putative RNA polymerase sigma factor RpoS [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 405

 Score = 35.1 bits (80), Expect = 3.5,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 38/110 (34%), Gaps = 14/110 (12%)

Query: 3   FYSFHYQT----EKDVEKRLVTGAKKLDCWVRKASFVGR----RG--CPDRLIITPNGGL 52
           FYS   Q     E  +EK+     +K    +            RG   PD ++   +G  
Sbjct: 207 FYSNKLQRNVFYESMLEKKFYKRLEKSHEVIYYVEQGITITYDRGKYTPDAIVFLDDGKG 266

Query: 53  WWIEVKKPTGRLSHQ-QMSE---IEELRRRGQRVKVLVSMEEVDNFLEEL 98
           + +E+K  T   +   Q      ++     G    +     ++++  E +
Sbjct: 267 FVVEIKPLTEMANQSVQKKFKALLDFCEETGLGATLTDGRTDINHIFETI 316


>gi|218297123|ref|ZP_03497794.1| N-6 DNA methylase [Thermus aquaticus Y51MC23]
 gi|218242537|gb|EED09075.1| N-6 DNA methylase [Thermus aquaticus Y51MC23]
          Length = 1214

 Score = 35.1 bits (80), Expect = 3.6,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 27/70 (38%), Gaps = 4/70 (5%)

Query: 22  AKKLDCWVRKASFVGRRGC--PDRLIITPNGG--LWWIEVKKPTGRLSHQQMSEIEELRR 77
             +L     +  +  ++G   PD L+    GG   + +E K     L+  Q      +RR
Sbjct: 55  LARLGYDESRVIYNQQKGSEKPDWLVCLEPGGAPYFLVEDKATGEDLAAHQEQLFRYMRR 114

Query: 78  RGQRVKVLVS 87
            G    VL +
Sbjct: 115 LGVPRGVLTN 124


>gi|126459061|ref|YP_001055339.1| hypothetical protein Pcal_0440 [Pyrobaculum calidifontis JCM 11548]
 gi|126248782|gb|ABO07873.1| conserved hypothetical protein [Pyrobaculum calidifontis JCM 11548]
          Length = 178

 Score = 34.7 bits (79), Expect = 4.4,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 42  DRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKV 84
           D      +G ++ +EVK  TGRL+  Q  + E L  +   V+V
Sbjct: 125 DLFA-EKDGEIYAVEVKTNTGRLTEAQREKAEALELKHLLVRV 166


>gi|328954103|ref|YP_004371437.1| type III restriction protein res subunit [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454427|gb|AEB10256.1| type III restriction protein res subunit [Desulfobacca acetoxidans
           DSM 11109]
          Length = 1141

 Score = 34.7 bits (79), Expect = 4.5,   Method: Composition-based stats.
 Identities = 8/53 (15%), Positives = 14/53 (26%), Gaps = 8/53 (15%)

Query: 15  EKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
           +K ++   K                 PD  +    G    +E+K     L   
Sbjct: 825 QKLMIDYLKPDGHRAHY--------IPDFFVGLKEGDYLLVELKGKQDNLVPL 869


>gi|55668089|ref|YP_138222.1| hypothetical protein pSKU146_01 [Spiroplasma kunkelii CR2-3x]
 gi|45385187|gb|AAS59573.1| hypothetical protein [Spiroplasma kunkelii CR2-3x]
          Length = 197

 Score = 34.7 bits (79), Expect = 4.5,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 21/59 (35%), Gaps = 3/59 (5%)

Query: 30  RKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSE---IEELRRRGQRVKVL 85
            K      +G PD +I   +    +IE ++     S  Q       + LR  GQ   + 
Sbjct: 107 LKMENGNLKGYPDLIIYKNDDSEIYIEFERTQKSPSRFQKKLDGHTKWLREGGQIYWIA 165


>gi|260807776|ref|XP_002598684.1| hypothetical protein BRAFLDRAFT_107186 [Branchiostoma floridae]
 gi|229283958|gb|EEN54696.1| hypothetical protein BRAFLDRAFT_107186 [Branchiostoma floridae]
          Length = 626

 Score = 34.7 bits (79), Expect = 4.6,   Method: Composition-based stats.
 Identities = 12/47 (25%), Positives = 21/47 (44%), Gaps = 6/47 (12%)

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
           E+K   G+LS +Q   + +L      V+V    EE    ++E+    
Sbjct: 32  ELKDIYGQLSPEQEERLRDL------VEVEFGSEEAALIIKEIKAIH 72


>gi|260781200|ref|XP_002585709.1| hypothetical protein BRAFLDRAFT_111409 [Branchiostoma floridae]
 gi|229270742|gb|EEN41720.1| hypothetical protein BRAFLDRAFT_111409 [Branchiostoma floridae]
          Length = 642

 Score = 34.7 bits (79), Expect = 4.6,   Method: Composition-based stats.
 Identities = 12/47 (25%), Positives = 21/47 (44%), Gaps = 6/47 (12%)

Query: 56  EVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL 102
           E+K   G+LS +Q   + +L      V+V    EE    ++E+    
Sbjct: 105 ELKDIYGQLSPEQEERLRDL------VEVEFGSEEAALIIKEIKAIH 145


>gi|124027969|ref|YP_001013289.1| hypothetical protein Hbut_1101 [Hyperthermus butylicus DSM 5456]
 gi|123978663|gb|ABM80944.1| conserved archaeal protein [Hyperthermus butylicus DSM 5456]
          Length = 270

 Score = 34.7 bits (79), Expect = 4.7,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 2/54 (3%)

Query: 8   YQTEKDVEKRLVT--GAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKK 59
           Y  EK++   L       +    V +       G  D + +  +G    IEVK+
Sbjct: 130 YLDEKEIADYLAKHPELVEEGLRVLRRERPIETGYADIVAVDKDGNYVVIEVKR 183


>gi|329945861|ref|ZP_08293548.1| hypothetical protein HMPREF9056_01437 [Actinomyces sp. oral taxon
           170 str. F0386]
 gi|328528309|gb|EGF55287.1| hypothetical protein HMPREF9056_01437 [Actinomyces sp. oral taxon
           170 str. F0386]
          Length = 420

 Score = 34.7 bits (79), Expect = 4.8,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 21/59 (35%), Gaps = 3/59 (5%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKA-SFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
           E  V + L   A+ L   +       GR    D ++   +G     EVK    ++   Q
Sbjct: 317 ESLVVQHLRVFAEVLGGRIYHFRDKSGREA--DVIVELDDGRWAAFEVKLGQRQIPAAQ 373


>gi|53805069|ref|YP_113236.1| hypothetical protein MCA0729 [Methylococcus capsulatus str. Bath]
 gi|53758830|gb|AAU93121.1| conserved domain protein [Methylococcus capsulatus str. Bath]
          Length = 574

 Score = 34.3 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 21/58 (36%), Gaps = 7/58 (12%)

Query: 11 EKDVEKRLVTGAKK-------LDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPT 61
          E  V + L     +       +   +R+     + G  D L+  P+ G   IEVK   
Sbjct: 21 EAKVYRALRDKLPQDYVVFFQVGWILRREEEQAKDGETDFLVCHPDHGYLCIEVKGGG 78


>gi|328957427|ref|YP_004374813.1| hypothetical protein CAR_c11050 [Carnobacterium sp. 17-4]
 gi|328673751|gb|AEB29797.1| conserved hypothetical protein [Carnobacterium sp. 17-4]
          Length = 345

 Score = 34.3 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 8/57 (14%)

Query: 51  GLWWIE-VKKPTGRLSHQ-------QMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
              + E VK+  G +          Q   IE+L+R G +   L S  E+ N L E+ 
Sbjct: 90  HYCFFEKVKQEKGEIQEDFLYRKAKQKLRIEDLQRYGIQAITLDSYSEITNLLSEIE 146


>gi|281422397|ref|ZP_06253396.1| conserved hypothetical protein [Prevotella copri DSM 18205]
 gi|281403560|gb|EFB34240.1| conserved hypothetical protein [Prevotella copri DSM 18205]
          Length = 417

 Score = 34.3 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 19/50 (38%), Gaps = 3/50 (6%)

Query: 16  KRLVTGAKKLDCWVRKASFVGRRGC-PDRLIITPNGGLWWIEVKKPTGRL 64
           + L   A  L   V       R+G   D ++   NG    IEVK    +L
Sbjct: 316 RDLRVYADALGGSVYHFR--DRKGLECDAVVHLRNGKYGLIEVKLGGDKL 363


>gi|269219177|ref|ZP_06163031.1| putative ATP/GTP binding protein [Actinomyces sp. oral taxon 848
           str. F0332]
 gi|269211324|gb|EEZ77664.1| putative ATP/GTP binding protein [Actinomyces sp. oral taxon 848
           str. F0332]
          Length = 421

 Score = 34.3 bits (78), Expect = 5.2,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 20/59 (33%), Gaps = 3/59 (5%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKA-SFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQ 68
           E    + L   A+ L   V       GR    D ++   +G     EVK    ++   Q
Sbjct: 318 ESQAVQHLRVFAEPLGGRVFHFRDKSGREA--DIVVELDDGRWAAFEVKLGQRQIPAAQ 374


>gi|20093542|ref|NP_613389.1| Holliday junction resolvase, type [Methanopyrus kandleri AV19]
 gi|19886383|gb|AAM01319.1| Holliday junction resolvase, archaeal type [Methanopyrus kandleri
          AV19]
          Length = 138

 Score = 34.3 bits (78), Expect = 5.8,   Method: Composition-based stats.
 Identities = 12/55 (21%), Positives = 21/55 (38%), Gaps = 2/55 (3%)

Query: 8  YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTG 62
          Y+   D E++LV   ++      + +  G  G  D +   P  G   +E K    
Sbjct: 3  YRRGADFERQLVRYLREHGGEAVRVAGSG--GAVDVVGYAPAMGHVAVECKVRRD 55


>gi|229119306|ref|ZP_04248609.1| Phage NTP-binding protein [Bacillus cereus Rock1-3]
 gi|228664172|gb|EEL19710.1| Phage NTP-binding protein [Bacillus cereus Rock1-3]
          Length = 576

 Score = 34.3 bits (78), Expect = 5.9,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 21/58 (36%), Gaps = 4/58 (6%)

Query: 30 RKASFVGRRGCPDRLIITPNGGLWWIEVKKP---TGRLSHQQMS-EIEELRRRGQRVK 83
           K       G  D ++  P+G    I+ K        +   Q+    + L++ G  V+
Sbjct: 36 YKIDKPNYVGFVDLIVQAPDGTCMVIDFKYSNHIKNYMDSAQLHIYKDYLKQDGFNVE 93


>gi|147857337|emb|CAN79195.1| hypothetical protein VITISV_000237 [Vitis vinifera]
          Length = 808

 Score = 34.3 bits (78), Expect = 5.9,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 55  IEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM-EEVDNFLE 96
           +E K   G+    Q + +E+ R  G  V V  S+ EE  + +E
Sbjct: 176 VERKASKGQSQKVQQAVLEKFRAGGFNVIVATSIGEEGLDIME 218


>gi|111018721|ref|YP_701693.1| acyl-CoA thioesterase [Rhodococcus jostii RHA1]
 gi|110818251|gb|ABG93535.1| possible acyl-CoA thioesterase [Rhodococcus jostii RHA1]
          Length = 647

 Score = 34.3 bits (78), Expect = 6.1,   Method: Composition-based stats.
 Identities = 9/39 (23%), Positives = 13/39 (33%), Gaps = 2/39 (5%)

Query: 28  WVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSH 66
           W  +     R   PD  +  P+  L  +E   P G    
Sbjct: 295 WAMRFVSEDR--VPDLFVPPPDAWLVTVEASTPDGTSRR 331


>gi|300867538|ref|ZP_07112188.1| Type III restriction enzyme, res subunit [Oscillatoria sp. PCC
           6506]
 gi|300334426|emb|CBN57358.1| Type III restriction enzyme, res subunit [Oscillatoria sp. PCC
           6506]
          Length = 937

 Score = 33.9 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 26/65 (40%), Gaps = 8/65 (12%)

Query: 41  PDRLIITPNGGLWWIEVKKPTGRLSHQQM----SEIEELRRRGQ----RVKVLVSMEEVD 92
           PD +I   NG    +E K    R    +       I+ + + G     +++V  +  +V 
Sbjct: 867 PDFIIRLKNGNFLILETKGQPTRQDEAKWGFLDRWIQAVNQHGGFGYWQLEVSRNPSDVR 926

Query: 93  NFLEE 97
             LE+
Sbjct: 927 LILEK 931


>gi|254441566|ref|ZP_05055059.1| hypothetical protein OA307_981 [Octadecabacter antarcticus 307]
 gi|198251644|gb|EDY75959.1| hypothetical protein OA307_981 [Octadecabacter antarcticus 307]
          Length = 313

 Score = 33.9 bits (77), Expect = 6.8,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 2/44 (4%)

Query: 42  DRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVL 85
           D  +      +  IEVK P  RL   Q  ++E   + G +  V+
Sbjct: 267 DLTVW--KDSVASIEVKAPRDRLLPHQKEQLELDIKNGNKSWVI 308


>gi|153948461|ref|YP_001399791.1| hypothetical protein YpsIP31758_0807 [Yersinia pseudotuberculosis
          IP 31758]
 gi|152959956|gb|ABS47417.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
          31758]
          Length = 616

 Score = 33.9 bits (77), Expect = 7.0,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 14/69 (20%)

Query: 15 EKRLVTGAKK---LDCWVRKASFVGR-RGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMS 70
          E+R     +     DC       VGR R  PD +I+ P  GL ++EVK            
Sbjct: 19 ERRFAKRIEASLGNDCLCWYDIPVGRQRRYPDFIILNPERGLLFVEVKD----------W 68

Query: 71 EIEELRRRG 79
           IE LR+  
Sbjct: 69 RIEHLRKIN 77


>gi|317509159|ref|ZP_07966783.1| response regulator receiver domain-containing protein [Segniliparus
           rugosus ATCC BAA-974]
 gi|316252516|gb|EFV11962.1| response regulator receiver domain-containing protein [Segniliparus
           rugosus ATCC BAA-974]
          Length = 224

 Score = 33.9 bits (77), Expect = 7.8,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 32/101 (31%), Gaps = 21/101 (20%)

Query: 11  EKDVEKRLVTGAKKLDCWVRKASFVGRRGC-------PDRLII-----TPNGGLWWIEVK 58
           E  +   LV   K+    V   +  G+          PD +++       +G     E+ 
Sbjct: 9   EALIRLDLVEMLKEEGYAVVGEAADGQSAVDLAVSLRPDLVLMDVKMPVRDGIDAASEI- 67

Query: 59  KPTGRLSH-------QQMSEIEELRRRGQRVKVLVSMEEVD 92
              GR++         Q   +E  R  G    ++    + D
Sbjct: 68  -AKGRIAPVVILTAFSQRDMVERAREAGALAYLVKPFSQAD 107


>gi|288921508|ref|ZP_06415783.1| hypothetical protein FrEUN1fDRAFT_5481 [Frankia sp. EUN1f]
 gi|288347076|gb|EFC81378.1| hypothetical protein FrEUN1fDRAFT_5481 [Frankia sp. EUN1f]
          Length = 439

 Score = 33.9 bits (77), Expect = 8.1,   Method: Composition-based stats.
 Identities = 8/19 (42%), Positives = 12/19 (63%)

Query: 41  PDRLIITPNGGLWWIEVKK 59
           PD L+I P+G    +E+K 
Sbjct: 186 PDLLVIRPDGRAHVVEIKS 204


>gi|134103228|ref|YP_001108889.1| hypothetical protein SACE_6800 [Saccharopolyspora erythraea NRRL
           2338]
 gi|291007980|ref|ZP_06565953.1| hypothetical protein SeryN2_25956 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133915851|emb|CAM05964.1| hypothetical protein SACE_6800 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 325

 Score = 33.5 bits (76), Expect = 8.3,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 5/38 (13%)

Query: 63  RLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
           RLS +Q + +E L  RG   +     E+V   LEEL  
Sbjct: 6   RLSPEQRARLERLADRGVLTR-----EQVAAVLEELDS 38


>gi|320095081|ref|ZP_08026790.1| ChvD family ATP-binding cassette protein [Actinomyces sp. oral taxon
            178 str. F0338]
 gi|319977948|gb|EFW09582.1| ChvD family ATP-binding cassette protein [Actinomyces sp. oral taxon
            178 str. F0338]
          Length = 1176

 Score = 33.5 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 59   KPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
             P GR +  Q+ ++  L R   R  +  + ++VD ++EEL   L+
Sbjct: 1122 APGGRAAPPQVVQLSALTRDLCRTTI-RTPDDVDAYVEELRSALH 1165


>gi|330950350|gb|EGH50610.1| hypothetical protein PSYCIT7_02906 [Pseudomonas syringae Cit 7]
          Length = 43

 Score = 33.5 bits (76), Expect = 9.1,   Method: Composition-based stats.
 Identities = 5/33 (15%), Positives = 9/33 (27%)

Query: 67 QQMSEIEELRRRGQRVKVLVSMEEVDNFLEELA 99
           Q   I +L  +G    V     +    +    
Sbjct: 2  SQYEWIRQLNLQGYLAIVCRGHFDAMEQIRAYL 34


>gi|91217510|ref|ZP_01254469.1| hypothetical protein P700755_19872 [Psychroflexus torquis ATCC
          700755]
 gi|91184395|gb|EAS70779.1| hypothetical protein P700755_19872 [Psychroflexus torquis ATCC
          700755]
          Length = 353

 Score = 33.5 bits (76), Expect = 9.1,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 24/61 (39%), Gaps = 11/61 (18%)

Query: 10 TEKDVEKRLVTGAKKLDCWVRK----------ASFVGRRGCPDRLIITPNGGLWWIEVKK 59
          +E+  E +++   +KL     K               R   PD +I +    L+ IEVK 
Sbjct: 23 SEQVFELKVIQAFEKLGWSHFKREISVRENIQLGASNRI-MPDIIIKSGETNLFVIEVKN 81

Query: 60 P 60
          P
Sbjct: 82 P 82


>gi|17233129|ref|NP_490219.1| hypothetical protein all7113 [Nostoc sp. PCC 7120]
 gi|17135651|dbj|BAB78197.1| all7113 [Nostoc sp. PCC 7120]
          Length = 171

 Score = 33.5 bits (76), Expect = 9.1,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 20/52 (38%), Gaps = 11/52 (21%)

Query: 40  CPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEV 91
            PD            +EVK  + R+   Q   I+     G  V +L+  ++V
Sbjct: 89  VPDL----------TVEVKSKSDRIKPLQEK-IKLFLELGSTVGILIDPDKV 129


>gi|57505847|ref|ZP_00371772.1| type IIS restriction enzyme [Campylobacter upsaliensis RM3195]
 gi|57015877|gb|EAL52666.1| type IIS restriction enzyme [Campylobacter upsaliensis RM3195]
          Length = 1096

 Score = 33.5 bits (76), Expect = 9.1,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 29/95 (30%), Gaps = 22/95 (23%)

Query: 11 EKDVEKRLVTGAKKLD-CWVRKASF------------VGRRG-----CPDRLIIT----P 48
          E+ +E R     K+    +  K                 + G      PD  +       
Sbjct: 5  EERIEDRTKQQLKEFGISYYTKTESINSDIDSALAKYPSKSGGSGKNYPDIKLFLTTETR 64

Query: 49 NGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVK 83
                IEVK   G+L   +  EIE +  +G+   
Sbjct: 65 RKIPVMIEVKGAKGKLEKFKNGEIENINNKGEPHY 99


>gi|228899779|ref|ZP_04064025.1| Wall associated protein [Bacillus thuringiensis IBL 4222]
 gi|228859798|gb|EEN04212.1| Wall associated protein [Bacillus thuringiensis IBL 4222]
          Length = 263

 Score = 33.5 bits (76), Expect = 9.4,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 42  DRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQR 81
           D L+ TP G L  +EVK    R +  Q+ + + +R++G +
Sbjct: 199 DHLVRTPRGKLLAVEVKAGNARRTAMQLKKDKLMRKQGGK 238


>gi|291613570|ref|YP_003523727.1| DEAD/DEAH box helicase domain protein [Sideroxydans lithotrophicus
           ES-1]
 gi|291583682|gb|ADE11340.1| DEAD/DEAH box helicase domain protein [Sideroxydans lithotrophicus
           ES-1]
          Length = 909

 Score = 33.5 bits (76), Expect = 9.7,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 25/63 (39%), Gaps = 4/63 (6%)

Query: 2   SFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPT 61
           ++  F  + E  +E  L    +K    + K     R+G PD +I   +     +E K  T
Sbjct: 751 AYRLFGNEYEDAIEALL--RLEKT-WKITKLEDGKRQGVPDFMIQL-DSKSAVLECKTCT 806

Query: 62  GRL 64
            + 
Sbjct: 807 KKP 809


>gi|37675975|ref|NP_936371.1| hypothetical protein VVA0315 [Vibrio vulnificus YJ016]
 gi|37200515|dbj|BAC96341.1| uncharacterized protein conserved in bacteria [Vibrio vulnificus
           YJ016]
          Length = 338

 Score = 33.5 bits (76), Expect = 9.7,   Method: Composition-based stats.
 Identities = 7/40 (17%), Positives = 20/40 (50%)

Query: 62  GRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101
           G+L+      ++ ++  G    V+ S+++V   +E +  +
Sbjct: 81  GKLNRFPSMRLDRMQDLGGCRAVVSSIDDVYKVVERIKSS 120


  Database: nr
    Posted date:  May 13, 2011  4:10 AM
  Number of letters in database: 999,999,932
  Number of sequences in database:  2,987,209
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 13, 2011  4:17 AM
  Number of letters in database: 999,998,956
  Number of sequences in database:  2,896,973
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 13, 2011  4:23 AM
  Number of letters in database: 999,999,979
  Number of sequences in database:  2,907,862
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 13, 2011  4:29 AM
  Number of letters in database: 999,999,513
  Number of sequences in database:  2,932,190
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 13, 2011  4:33 AM
  Number of letters in database: 792,586,372
  Number of sequences in database:  2,260,650
  
Lambda     K      H
   0.314    0.170    0.499 

Lambda     K      H
   0.267   0.0520    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,300,148,422
Number of Sequences: 13984884
Number of extensions: 63857068
Number of successful extensions: 192761
Number of sequences better than 10.0: 882
Number of HSP's better than 10.0 without gapping: 755
Number of HSP's successfully gapped in prelim test: 127
Number of HSP's that attempted gapping in prelim test: 191366
Number of HSP's gapped (non-prelim): 898
length of query: 103
length of database: 4,792,584,752
effective HSP length: 72
effective length of query: 31
effective length of database: 3,785,673,104
effective search space: 117355866224
effective search space used: 117355866224
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.1 bits)
S2: 76 (33.5 bits)