RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780128|ref|YP_003064541.1| VRR-NUC domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >gnl|CDD|149740 pfam08774, VRR_NUC, VRR-NUC domain. Length = 96 Score = 50.5 bits (121), Expect = 1e-07 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Query: 17 RLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGL-WWIEVKKPTGRLSHQQMSEIEEL 75 R G K + + + R+G PD ++ P G +EVK P +LS +Q + ++ L Sbjct: 23 RKNWGKKGAEALGKYFRYGLRKGVPDLILFLPPGKRFLLVEVKGPGDKLSPEQRAWLDRL 82 Query: 76 RRRGQRVKVLVSME 89 R G +V V S+E Sbjct: 83 ARSGFKVAVCDSVE 96 >gnl|CDD|180076 PRK05429, PRK05429, gamma-glutamyl kinase; Provisional. Length = 372 Score = 31.6 bits (73), Expect = 0.052 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 5/32 (15%) Query: 60 PTGRLSHQQMSE----IEELRRRGQRVKVLVS 87 G L +++E I LR G V VLVS Sbjct: 23 GGGGLDRARIAELARQIAALRAAGHEV-VLVS 53 >gnl|CDD|181960 PRK09567, nirA, ferredoxin-nitrite reductase; Reviewed. Length = 593 Score = 30.4 bits (69), Expect = 0.11 Identities = 12/28 (42%), Positives = 16/28 (57%) Query: 51 GLWWIEVKKPTGRLSHQQMSEIEELRRR 78 GL WI V P GRL+ QM + ++ R Sbjct: 373 GLNWIGVVLPVGRLTTDQMRGLAKIAAR 400 >gnl|CDD|173190 PRK14727, PRK14727, putative mercuric reductase; Provisional. Length = 479 Score = 28.8 bits (64), Expect = 0.31 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 12/50 (24%) Query: 39 GC-PDRLII-----------TPNGGLWWIEVKKPTGRLSHQQMSEIEELR 76 GC P +++I P G+ + G L HQQ + +EELR Sbjct: 59 GCVPSKILIRAAQLAHQQRSNPFDGVEAVAPSIDRGLLLHQQQARVEELR 108 >gnl|CDD|152399 pfam11964, DUF3478, Protein of unknown function (DUF3478). This family of proteins is functionally uncharacterized. This protein is found in bacteria and archaea. Proteins in this family are typically between 120 to 132 amino acids in length. This protein has a single completely conserved residue A that may be functionally important. Length = 118 Score = 28.3 bits (64), Expect = 0.40 Identities = 7/40 (17%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 59 KPTGRLSHQQMSE----IEELRRRGQRVKVLVSMEEVDNF 94 K +G+L+H+ +E +V++L+ +++ + + Sbjct: 16 KVSGKLTHEDYEVLIPALEAKLEEHGKVRLLIDLDDFEGW 55 >gnl|CDD|162287 TIGR01290, nifB, nitrogenase cofactor biosynthesis protein NifB. This model describes NifB, a protein required for the biosynthesis of the iron-molybdenum (or iron-vanadium) cofactor used by the nitrogen-fixing enzyme nitrogenase. Archaeal homologs lack the most C-terminal region and score between the trusted and noise cutoffs of this model. Length = 442 Score = 26.7 bits (59), Expect = 1.3 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 6/38 (15%) Query: 52 LWWIEVKKPTGR-----LSHQQMSEIEELRRRGQRVKV 84 +W+ E ++ TGR L +Q+ +E+L RG VKV Sbjct: 156 VWY-EGERYTGREAADLLIERQLEGLEKLTERGILVKV 192 >gnl|CDD|183048 PRK11239, PRK11239, hypothetical protein; Provisional. Length = 215 Score = 26.6 bits (59), Expect = 1.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Query: 74 ELRRRGQRVKVLVSMEEVDNFLEELA 99 ELR R R+ M EV++ LE+LA Sbjct: 116 ELRSRAARMYEFSDMAEVESTLEQLA 141 >gnl|CDD|171551 PRK12512, PRK12512, RNA polymerase sigma factor; Provisional. Length = 184 Score = 26.6 bits (59), Expect = 1.6 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 5/28 (17%) Query: 72 IEELRRRGQRVKVLVSMEEVDNFLEELA 99 I+ LRRRG+RV V ++D+F E L Sbjct: 90 IDALRRRGRRVFV-----DIDDFAETLP 112 >gnl|CDD|133958 PHA01753, PHA01753, Holliday junction resolvase. Length = 121 Score = 26.4 bits (58), Expect = 1.8 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 32 ASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRR 77 S G++ PD +I T N ++ IEVK + + +IE+L R Sbjct: 30 VSGTGKQALPD-IIATKNNTIYPIEVKSTSKDVVTVDKFQIEKLFR 74 >gnl|CDD|132172 TIGR03128, RuMP_HxlA, 3-hexulose-6-phosphate synthase. at the cost of also yielding formaldehyde. These latter species tend usually have a formaldehyde-activating enzyme to attach formaldehyde to the C1 carrier tetrahydromethanopterin. In these species, the enzyme is viewed as a lyase rather than a synthase and is called D-arabino 3-hexulose 6-phosphate formaldehyde lyase. Note that there is some overlap in specificity with the Escherichia coli enzyme 3-keto-L-gulonate 6-phosphate decarboxylase. Length = 206 Score = 26.2 bits (58), Expect = 2.2 Identities = 8/39 (20%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Query: 54 WIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVD 92 IE+ T + ++ + ++E++ KVL ++ +D Sbjct: 27 IIEIG--TPLIKNEGIEAVKEMKEAFPDRKVLADLKTMD 63 >gnl|CDD|178779 PLN03241, PLN03241, magnesium chelatase subunit H; Provisional. Length = 1353 Score = 26.0 bits (57), Expect = 2.3 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 57 VKKPTGRLSHQQMSEIEELRRRGQRVKVLVSM 88 VK+ TGR+ ++ + EL R RV VL +M Sbjct: 1018 VKEGTGRVVRYELIPLSELGR--PRVDVLCNM 1047 >gnl|CDD|130875 TIGR01816, sdhA_forward, succinate dehydrogenase, flavoprotein subunit, E. coli/mitochondrial subgroup. Succinate dehydrogenase and fumarate reductase are homologous enzymes reversible in principle but favored under different circumstances. This model represents a narrowly defined clade of the succinate dehydrogenase flavoprotein subunit as found in mitochondria, in Rickettsia, in E. coli and other Proteobacteria, and in a few other lineages. However, this model excludes all known fumarate reductases. It also excludes putative succinate dehydrogenases that appear to diverged before the split between E. coli succinate dehydrogenase and fumarate reductase. Length = 565 Score = 25.9 bits (57), Expect = 2.4 Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 10/53 (18%) Query: 61 TGRLSHQQMSEIEELRRRGQRVKV----------LVSMEEVDNFLEELACTLY 103 TG + + + +I L+ R + VK+ LV E+ N LE T Sbjct: 449 TGEVLQKGVEKISALKERYKNVKINDKSKVWNTDLVEALELQNLLECAEATAV 501 >gnl|CDD|173501 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional. Length = 1466 Score = 25.8 bits (56), Expect = 2.5 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 8/44 (18%) Query: 6 FHYQTEKDVEKRLVTGAKKLDCWVRKA---SFVGRRGCPDRLII 46 FHY T KDVE K L+ + + +FVG GC I+ Sbjct: 390 FHYDTRKDVEIY-----KDLNFTLTEGKTYAFVGESGCGKSTIL 428 >gnl|CDD|148371 pfam06728, PIG-U, GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI. Length = 174 Score = 25.6 bits (57), Expect = 2.9 Identities = 7/9 (77%), Positives = 8/9 (88%) Query: 46 ITPNGGLWW 54 +TPN GLWW Sbjct: 17 LTPNIGLWW 25 >gnl|CDD|161984 TIGR00663, dnan, DNA polymerase III, beta subunit. University). Length = 367 Score = 25.8 bits (57), Expect = 3.0 Identities = 10/50 (20%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Query: 54 WIEVKKPTGR---LSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100 E+K+ R L+ ++ + + L G+++K +E+ EE+ Sbjct: 260 REELKEAIKRVSLLADEKRNLVLTLSENGKKLKESSDTQEIGEAEEEIEV 309 >gnl|CDD|151032 pfam10459, Peptidase_S46, Peptidase S46. Dipeptidyl-peptidase 7 (DPP-7) is the best characterized member of this family. It is a serine peptidase that is located on the cell surface and is predicted to have two N-terminal transmembrane domains. Length = 696 Score = 25.6 bits (57), Expect = 3.1 Identities = 11/23 (47%), Positives = 13/23 (56%) Query: 69 MSEIEELRRRGQRVKVLVSMEEV 91 S EEL G RV VLV + +V Sbjct: 88 KSRAEELPAPGLRVYVLVRITDV 110 >gnl|CDD|152934 pfam12500, DUF3706, Protein of unknown function (DUF3706). This domain family is found in bacteria, and is typically between 174 and 217 amino acids in length. There is a conserved TRSP sequence motif. Length = 199 Score = 25.3 bits (56), Expect = 3.9 Identities = 13/52 (25%), Positives = 17/52 (32%), Gaps = 12/52 (23%) Query: 46 ITPNGGLWWIEVKKPTGRL------SHQQMSEIEELR------RRGQRVKVL 85 GGL W TGR + + R+G+RV VL Sbjct: 55 DVTRGGLPWPSYLPDTGRFGILPEDRAGLEAALAAAAARLAEVRKGERVLVL 106 >gnl|CDD|149699 pfam08722, TnsA_N, TnsA endonuclease N terminal. The Tn7 transposase is composed of proteins TnsA and TnsB. DNA breakage at the 5' end of the transposon is carried out by TnsA, and breakage and joining at the 3' end is carried out by TnsB. The N terminal domain of TnsA is catalytic. Length = 81 Score = 25.2 bits (56), Expect = 3.9 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 41 PDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRR 78 PD L+ +G +EV K + L ++ E E+ RR Sbjct: 31 PDFLVTYKDGKPEAVEV-KYSEDLEDERTLEKFEIERR 67 >gnl|CDD|162024 TIGR00757, RNaseEG, ribonuclease, Rne/Rng family. The C-terminal half of RNase E (excluded from the seed alignment for this model) lacks ribonuclease activity but participates in mRNA degradation by organizing the degradosome. Length = 414 Score = 24.6 bits (54), Expect = 6.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Query: 72 IEELRRRGQRVKVLVSMEEVDN 93 I EL R GQ V V V E N Sbjct: 80 ISELLRPGQSVLVQVVKEPRGN 101 >gnl|CDD|149435 pfam08371, PLD_envelope, Phospholipase D/viral envelope. This domain is found in phospholipases and viral envelope proteins between Phospholipase D (PLD) active site motifs (pfam00641). PLD is associated with Golgi membranes and alters their lipid content by the conversion of phospholipids into phosphatidic acid, which is thought to be involved in the regulation of lipid movement. This might explain the prevalence of this domain in viral envelope proteins. Length = 163 Score = 24.5 bits (54), Expect = 6.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 9/35 (25%) Query: 74 ELRR----RGQRVKVLVS-----MEEVDNFLEELA 99 LRR RG +V++L+S + FL+ L Sbjct: 121 ALRRAAIERGVKVRLLISCWKHSDPSMFAFLKSLQ 155 >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional. Length = 1004 Score = 24.3 bits (52), Expect = 8.0 Identities = 8/15 (53%), Positives = 13/15 (86%) Query: 83 KVLVSMEEVDNFLEE 97 K L+ +EE+D+FL+E Sbjct: 374 KELIKLEELDDFLKE 388 >gnl|CDD|183520 PRK12421, PRK12421, ATP phosphoribosyltransferase regulatory subunit; Provisional. Length = 392 Score = 24.2 bits (53), Expect = 8.7 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Query: 70 SEIEELRRRGQRVKVLVSMEEVDNFLEELACT 101 + I ELR++G+RV L+ ++ + E C Sbjct: 348 AAIAELRQQGERVVQLLPGDDGSS---EPGCD 376 >gnl|CDD|184712 PRK14501, PRK14501, putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional. Length = 726 Score = 24.1 bits (53), Expect = 8.9 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Query: 50 GGLW--WIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLE 96 GGLW W + S +Q + IE V V +S EEVD + E Sbjct: 42 GGLWVGWPGLD--LEEESEEQRARIEPRLEELGLVPVFLSAEEVDRYYE 88 >gnl|CDD|129833 TIGR00750, lao, LAO/AO transport system ATPase. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however. Length = 300 Score = 24.0 bits (52), Expect = 9.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 72 IEELRRRGQRVKVL 85 ELRRRG +V V+ Sbjct: 55 GMELRRRGLKVAVI 68 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.137 0.428 Gapped Lambda K H 0.267 0.0880 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,748,270 Number of extensions: 102724 Number of successful extensions: 295 Number of sequences better than 10.0: 1 Number of HSP's gapped: 294 Number of HSP's successfully gapped: 50 Length of query: 103 Length of database: 5,994,473 Length adjustment: 70 Effective length of query: 33 Effective length of database: 4,481,913 Effective search space: 147903129 Effective search space used: 147903129 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (22.8 bits)