BLAST/BLAST alignment of GI: 254780128 and GI: 254781194
>gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter asiaticus str. psy62] Length = 98
 Score =  105 bits (263), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 63/93 (67%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
           Y +E  +EKRLV G+KKLDC V K  F+ +RGCPDRLIITPNG  +W+E+K   GRLS+ 
Sbjct: 5   YLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNA 64

Query: 68  QMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
           Q   I  L    Q+V+VL S EEVD FL  L C
Sbjct: 65  QKRVIATLLLYHQKVQVLSSTEEVDGFLRMLEC 97