BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780128|ref|YP_003064541.1| VRR-NUC domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] (103 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780128|ref|YP_003064541.1| VRR-NUC domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Score = 215 bits (548), Expect = 1e-58, Method: Compositional matrix adjust. Identities = 103/103 (100%), Positives = 103/103 (100%) Query: 1 MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60 MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP Sbjct: 1 MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60 Query: 61 TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103 TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY Sbjct: 61 TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103 >gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter asiaticus str. psy62] Length = 98 Score = 105 bits (263), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 52/93 (55%), Positives = 63/93 (67%) Query: 8 YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67 Y +E +EKRLV G+KKLDC V K F+ +RGCPDRLIITPNG +W+E+K GRLS+ Sbjct: 5 YLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNA 64 Query: 68 QMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100 Q I L Q+V+VL S EEVD FL L C Sbjct: 65 QKRVIATLLLYHQKVQVLSSTEEVDGFLRMLEC 97 >gi|254780438|ref|YP_003064851.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Score = 24.3 bits (51), Expect = 0.53, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 21 GAKKLDCWVRKASFVGRRGCPDRL 44 A L+C V++A F RR C L Sbjct: 227 AATALECGVKEAVFCFRRACGQHL 250 >gi|254781011|ref|YP_003065424.1| orotate phosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 228 Score = 21.6 bits (44), Expect = 3.2, Method: Compositional matrix adjust. Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Query: 39 GCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98 G P ++ L I V+K + + H Q S+IE +G RV V+ + + N + E Sbjct: 88 GIPFATLLAERLNLPMIYVRKKSKK--HGQKSQIEGHLFKGARVLVIEDLVTLGNSMFEF 145 Query: 99 A 99 Sbjct: 146 V 146 >gi|254780757|ref|YP_003065170.1| glycyl-tRNA synthetase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 307 Score = 21.6 bits (44), Expect = 3.4, Method: Compositional matrix adjust. Identities = 6/14 (42%), Positives = 10/14 (71%) Query: 38 RGCPDRLIITPNGG 51 + C + ++TPNGG Sbjct: 293 KACGEAFLMTPNGG 306 >gi|254780781|ref|YP_003065194.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 285 Score = 21.6 bits (44), Expect = 3.8, Method: Compositional matrix adjust. Identities = 9/28 (32%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Query: 28 WVRKASFVGRRGCPDRLIITPNG-GLWW 54 W++KA + + P ++I NG WW Sbjct: 62 WIKKAILLSFQINPTKIISDGNGYSTWW 89 >gi|254780466|ref|YP_003064879.1| putative modification methylase [Candidatus Liberibacter asiaticus str. psy62] Length = 375 Score = 20.8 bits (42), Expect = 5.3, Method: Composition-based stats. Identities = 7/13 (53%), Positives = 9/13 (69%) Query: 43 RLIITPNGGLWWI 55 R ++ PNG LW I Sbjct: 93 RRVLKPNGTLWVI 105 >gi|254781158|ref|YP_003065571.1| peptidyl prolyl cis-trans isomerase D signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 631 Score = 20.4 bits (41), Expect = 6.8, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query: 42 DRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEEL 98 D + P+G W+++K+ + + ++++ + VK + EEV + +L Sbjct: 453 DHTVALPDGSYMWVQIKESIPARDRKLEEVLTDVKKDWKTVK---TAEEVSSKANQL 506 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.137 0.428 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,821 Number of Sequences: 1233 Number of extensions: 2375 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 103 length of database: 328,796 effective HSP length: 62 effective length of query: 41 effective length of database: 252,350 effective search space: 10346350 effective search space used: 10346350 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 32 (16.9 bits)