>cd01894 EngA1 EngA1 subfamily. This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains. Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.

Probab=96.98 E-value=0.00023 Score=47.32 Aligned_cols=48 Identities=21% Similarity=0.277 Sum_probs=34.2 Q ss_pred EECCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCCCC--CCCCHHHCC Q ss_conf 987999998999999985189817998602788898833--464201001 Q gi|254780132|r 7 LIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEK--QYIDYRFIS 54 (186) Q Consensus 7 i~GpsGsGK~tl~~~L~~~~~~~~~~v~~TTR~~R~~E~--~g~dY~Fvs 54 (186) T Consensus 2 ivG~pN~GKSsL~N~l~~~~~~ivs~~~gtTr~~~~~~~~~~~~~~~lvD 51 (157) T cd01894 2 IVGRPNVGKSTLFNRLTGRRDAIVEDTPGVTRDRIYGEAEWGGREFILID 51 (157) T ss_pred CCCCCCCCHHHHHHHHHCCCCEEEECCCCCEEEEEEEEEEECCEEEEEEE T ss_conf 04899988999999995887535407999356678999999998899985

HHsearch alignment for GI: 254780132 and conserved domain: cd01894