>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans. NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes. Thus, defects in NOG1 can lead to defects in 60S biogenesis. The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function. It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.

Probab=96.93 E-value=0.00067 Score=44.50 Aligned_cols=50 Identities=22% Similarity=0.411 Sum_probs=37.0 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCCC--CCCCCHHHCC Q ss_conf 99998799999899999998518981799860278889883--3464201001 Q gi|254780132|r 4 IFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDE--KQYIDYRFIS 54 (186) Q Consensus 4 iivi~GpsGsGK~tl~~~L~~~~~~~~~~v~~TTR~~R~~E--~~g~dY~Fvs 54 (186) T Consensus 2 ~VaivG~pNvGKStL~N~L~g~~~~v-~~~p~TTr~~~~~~~~~~~~~~~liD 53 (168) T cd01897 2 TLVIAGYPNVGKSSLVNKLTRAKPEV-APYPFTTKSLFVGHFDYKYLRWQVID 53 (168) T ss_pred EEEEECCCCCCHHHHHHHHHCCCCEE-CCCCCCCCCCEEEEEEECCCEEEEEC T ss_conf 79998899988999999995898602-37587235743689998372768724

HHsearch alignment for GI: 254780132 and conserved domain: cd01897