HHsearch alignment for GI: 254780136 and conserved domain: COG0208

>COG0208 NrdF Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism].
Probab=100.00  E-value=4.8e-34  Score=227.80  Aligned_cols=121  Identities=40%  Similarity=0.742  Sum_probs=116.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
T Consensus       218 ~RDE~~H~~~~~~l~~~~~~e~~~~~t~e~~~~~~~l~~~ave~E~~y~~~~~~-~~~Glt~d~~~~Yi~y~ankrL~~l  296 (348)
T COG0208         218 IRDEALHLYFIGYLIQRLVAENPELWTAELKDEIYDLFKEAVELEKEYAEYLYP-GILGLTEDLVKQYIRYNANKRLQNL  296 (348)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             977999998999999999873838556888999999999999999999998735-6579988999999999987999975


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCC
Q ss_conf             978788987888689999834665732131003333430657
Q gi|254780136|r   81 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL  122 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~  122 (125)
T Consensus       297 G~~~~y~~~~NP~~~~~~~~~~~~~~dFFe~~~ssY~~~~~~  338 (348)
T COG0208         297 GLEPLYPAEENPIPWIELSLSADEKTDFFEGRVSSYQKGSVA  338 (348)
T ss_pred             CCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHCC
T ss_conf             999889987896579986234333577500464167761045