HHsearch alignment for GI: 254780136 and conserved domain: KOG1567

>KOG1567 consensus.
Probab=99.96  E-value=7e-29  Score=196.40  Aligned_cols=113  Identities=34%  Similarity=0.625  Sum_probs=106.1

Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             40378999999999999967700031122999999999999999998576308760188999999999999999999859
Q gi|254780136|r    2 RDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG   81 (125)
Q Consensus         2 RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~lG   81 (125)
T Consensus       219 rdeglh~dFacll~~~l~~-------kp~~~ri~eII~eAV~IEqef~~eaLPv~liGMN~~lM~qYIEFVADrLL~~lG  291 (344)
T KOG1567         219 RDEGLHCDFACLLFSHLKK-------KPNEERIEEIITEAVEIEQEFLTEALPVNLIGMNCDLMSQYIEFVADRLLVELG  291 (344)
T ss_pred             HCCCCCCCHHHHHHHHHHH-------CCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             0247761199999999860-------897899999999999999999871165455345788999999999999999848


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCC
Q ss_conf             787889878886899998346657321310033334306577
Q gi|254780136|r   82 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK  123 (125)
Q Consensus        82 l~~~f~~~~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~~  123 (125)
T Consensus       292 ~~K~Yn~-~NPFdfME-nISl~GKTNFFEKrVseYQk~~vMs  331 (344)
T KOG1567         292 NEKYYNA-ENPFDFME-NISLAGKTNFFEKRVSEYQKAGVMS  331 (344)
T ss_pred             CCCEECC-CCCHHHHH-HHHHCCCCCHHHHHHHHHHHCHHCC
T ss_conf             5502057-88168888-7353254415776567765010024