HHsearch alignment for GI: 254780136 and conserved domain: PRK09101

>PRK09101 nrdB ribonucleotide-diphosphate reductase subunit beta; Reviewed.
Probab=100.00  E-value=3.1e-35  Score=235.05  Aligned_cols=121  Identities=27%  Similarity=0.470  Sum_probs=112.7

Q ss_pred             CCHHHHHHHHHHHHHHHHH--HHCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCHHHHHHHHHHHHHH
Q ss_conf             9403789999999999999--6770003--112299999999999999999857630876-0188999999999999999
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIK--IENPHLW--TKEFQQKSRTMLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFIANR   75 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~--~e~pe~~--~~~~~~~i~~~~~eave~E~~~~~~~~~~~-~~Gl~~~~~~~Yiky~an~   75 (125)
T Consensus       236 ~rDE~~Hl~~~~~ii~~l~~~~e~pe~~~~~~e~~~~v~~m~~~ave~E~~wa~ylf~~G~iiGLn~~~l~~Yi~ylan~  315 (376)
T PRK09101        236 ARDEALHLTGTQHMLNLMRSGKDDPEMAEIAEECKQECYDLFVQAAEQEKEWADYLFKDGSMIGLNKDILCQYVEYITNI  315 (376)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             97199899999999999985389827889999999999999999999999999996669971688999999999999999


Q ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHHCCCC-CCCCCCCCHHHHHHHCC
Q ss_conf             99985978788987888689999834665-73213100333343065
Q gi|254780136|r   76 RCHQIGLEPLFKYTENPFPWMSEVIDLKK-EKNFFETRVTEYQQGAE  121 (125)
Q Consensus        76 rL~~lGl~~~f~~~~nPl~W~~~~~~~~~-~~nFFE~r~t~Y~k~~~  121 (125)
T Consensus       316 Rl~~lGl~~~y~~~~NPlpWm~~~~~~~~~q~a~qE~evtsY~~g~~  362 (376)
T PRK09101        316 RMQAVGLDLPFQTRSNPIPWINTWLVSDNVQVAPQEVEVSSYLVGQI  362 (376)
T ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCEEEECC
T ss_conf             99976999999999998458999865576746731201300112142