HHsearch alignment for GI: 254780136 and conserved domain: cd01049

>cd01049 RNRR2 Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain. Ribonucleotide Reductase, R2/beta subunit (RNRR2) is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. The RNR protein catalyzes the conversion of ribonucleotides to deoxyribonucleotides and is found in all eukaryotes, many prokaryotes, several viruses, and few archaea. The catalytically active form of RNR is a proposed alpha2-beta2 tetramer. The homodimeric alpha subunit (R1) contains the active site and redox active cysteines as well as the allosteric binding sites. The beta subunit (R2) contains a diiron cluster that, in its reduced state, reacts with dioxygen to form a stable tyrosyl radical and a diiron(III) cluster. This essential tyrosyl radical is proposed to generate a thiyl radical, located on a cysteine residue in the R1 active site that initiates ribonucleotide reduction. The beta subunit is composed of 10-13 helices, the 8 longest helices form an alpha-
Probab=99.94  E-value=4.3e-26  Score=179.45  Aligned_cols=100  Identities=41%  Similarity=0.762  Sum_probs=95.9

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
T Consensus       187 ~rDE~lH~~f~~~l~~~l~~e~~~~~~~~~~~~i~~~~~eav~~E~~~~~~~~~~~i~gl~~~~~~~yi~y~an~~l~~l  266 (288)
T cd01049         187 SRDESLHGDFACLLIRELLNENPELFTEEFKEEVYELIKEAVELEKEFARDLLPDGILGLNKEDMKQYIEYVANRRLENL  266 (288)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             99899999999999999886298856566799999999999999999999980688689899999999999999999977


Q ss_pred             CCCCCCCCC-CCCHHHHHHHH
Q ss_conf             978788987-88868999983
Q gi|254780136|r   81 GLEPLFKYT-ENPFPWMSEVI  100 (125)
Q Consensus        81 Gl~~~f~~~-~nPl~W~~~~~  100 (125)
T Consensus       267 G~~~~f~~~~~nP~~~~~~~~  287 (288)
T cd01049         267 GLEKLFNVEDKNPFDWMELIS  287 (288)
T ss_pred             CCCCCCCCCCCCCHHHHHHHC
T ss_conf             999999999999777998751