HHsearch alignment of GI: 254780136 and MMDB domain: 1jk0_A_1-103_228-419

>1jk0_A (A:1-103,A:228-419) RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae}
Probab=99.97  E-value=2.1e-31  Score=211.34  Aligned_cols=114  Identities=32%  Similarity=0.563  Sum_probs=104.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      .|||++|+.|++.||+.++.+.       .++.+.+++++||++|.+|++++++.+++|++++++++||+|+||+||.+|
T Consensus       166 ~RDE~lH~~f~~~L~~~l~~e~-------~~e~v~el~~eAvelE~ef~~~~l~~~~lGi~~e~i~qYIkY~AN~~L~~L  238 (295)
T 1jk0_A          166 CRDEGLHTDFACLLFAHLKNKP-------DPAIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAF  238 (295)
T ss_dssp             HHHHHHHHHHHHHHHHTCSSCC-------CHHHHHHHHHHHHHHHHHHHHTTSCGGGGTCCHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHCCC-------CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             9899999999999999864032-------188999999999999999999853788579999999999999999999976


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCC
Q ss_conf             9787889878886899998346657321310033334306577
Q gi|254780136|r   81 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK  123 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~~  123 (125)
                      |++++|++ +||+|||+..+ ..+++||||+||++|+||+..+
T Consensus       239 G~e~~F~~-~NP~~wme~~~-d~~ktNFFE~rvs~YqK~~~~~  279 (295)
T 1jk0_A          239 GNKKYYKV-ENPFDFMENIS-LAGKTNFFEKRVSDYQKAGVMS  279 (295)
T ss_dssp             TCCCSSCC-CCCCGGGGC-------------------------
T ss_pred             CCCCCCCC-CCCCHHHHHHC-CCCCCCCCCCCHHHHHHCCCCC
T ss_conf             99987999-99825888724-5788787678788787624776