HHsearch alignment of GI: 254780136 and MMDB domain: 3chh_A_

>3chh_A (A:) P-aminobenzoate N-oxygenase; DI-iron oxygenase, oxidoreductase; 2.00A {Streptomyces thioluteus} PDB: 3chi_A 3cht_A* 3chu_A 2jcd_A
Probab=98.76  E-value=2.6e-09  Score=77.04  Aligned_cols=102  Identities=11%  Similarity=0.099  Sum_probs=86.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCH-HHHHHHHHHHHHHHHHH
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899-99999999999999998
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNA-PSCEQYMQFIANRRCHQ   79 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~-~~~~~Yiky~an~rL~~   79 (125)
                      +|||+.|+.|++.+++.+..+.|....+.+.+.+..++..++..|..+..+++  ..+|++. +.+.+|++|.+|+++..
T Consensus       224 ~rDE~~H~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~--~~~Gl~~~~~~~~~~~~~~~~~~~~  301 (336)
T 3chh_A          224 LRDETAHGSIVVEVVRELYARMNEQQRRALVRCLPIALEAFAEQDLSALLLEL--NAAGIRGAEEIVGDLRSTAGGTRLV  301 (336)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHCCCTHHHHHHH--HHHTCTTHHHHHHHCC-------CC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH--HHCCCCHHHHHHHHHHCHHHHHHHH
T ss_conf             99999999999999999998699999999999999999999861324779999--8869987999999872958789999


Q ss_pred             CCCCCCCCCCCCCHHHHHHH-HCCCCCCCCCCC
Q ss_conf             59787889878886899998-346657321310
Q gi|254780136|r   80 IGLEPLFKYTENPFPWMSEV-IDLKKEKNFFET  111 (125)
Q Consensus        80 lGl~~~f~~~~nPl~W~~~~-~~~~~~~nFFE~  111 (125)
                      +|++       ++++|+++. +.+.-...|+++
T Consensus       302 ~~~~-------~~~~~l~~~Gl~~~~~~~~~~~  327 (336)
T 3chh_A          302 RDFS-------GARKMVEQLGLDDAVDFDFPER  327 (336)
T ss_dssp             CBCH-------HHHHHHHHTTCTTTCCCCCCCC
T ss_pred             HHHH-------HHHHHHHHCCCCCCCCCCCCCC
T ss_conf             9888-------8999999848988999986768