HHsearch alignment of GI: 254780136 and MMDB domain: 3ee4_A_

>3ee4_A (A:) Probable ribonucleoside-diphosphate reductase; manganese, iron, DIIRON, carboxylate, oxidase, ligand, cavity, monooxygenase; HET: MYR; 1.90A {Mycobacterium tuberculosis}
Probab=99.92  E-value=2.1e-25  Score=174.86  Aligned_cols=116  Identities=15%  Similarity=0.069  Sum_probs=108.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      +|||++|+.||+.+++.++.|.|+.+ ++..+.+++++.+||++|.+|+.++++.+++|++++.+.+|++|++|+||..+
T Consensus       208 ~rDE~~H~~f~~~~~~~l~~e~~e~~-~~~~e~~~~~~~~~v~~e~~~~~~~~~~~~~g~~~~~~~~y~~~~~~~~l~~l  286 (323)
T 3ee4_A          208 GDDERRHMAWGTFTCRRHVAADDANW-TVFETRMNELIPLALRLIEEGFALYGDQPPFDLSKDDFLQYSTDKGMRRFGTI  286 (323)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCTHHH-HHHHHHHHHHHHHHHHHHHHHHHTTTTCCSTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             80488999999999999986395030-69999999999999999999988627776679999999999999999987994


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCC
Q ss_conf             97878898788868999983466573213100333343065
Q gi|254780136|r   81 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE  121 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~  121 (125)
                      |+++.|+...+|++|+.    ..+++||||+|+|+|+|||+
T Consensus       287 g~~~~~~~~~~~~~~~~----~~~~~nFFe~~~~~Y~~~~a  323 (323)
T 3ee4_A          287 SNARGRPVAEIDVDYSP----AQLEDTFADEDRRTLAAASA  323 (323)
T ss_dssp             HTTTTCCGGGTCC----------------------------
T ss_pred             CCCCCCCHHHCCCCCCH----HHHHHHHHHHHHHHHHHHCC
T ss_conf             22346984433676897----99999988989999876149