Query         gi|254780136|ref|YP_003064549.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 125
No_of_seqs    106 out of 1338
Neff          7.1 
Searched_HMMs 23785
Date          Sun May 22 08:34:16 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780136.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1syy_A Ribonucleoside-diphosph 100.0 9.7E-38 4.1E-42  248.9  11.0  123    1-124   224-346 (346)
  2 2rcc_A Ribonucleoside-diphosph 100.0   1E-35 4.3E-40  236.6  11.0  125    1-125   217-344 (346)
  3 1mxr_A Ribonucleotide reductas 100.0 1.8E-33 7.5E-38  223.0   9.5  122    1-122   235-362 (375)
  4 1h0o_A Ribonucleoside-diphosph 100.0 1.2E-32   5E-37  218.0   9.2  114    1-123   264-377 (390)
  5 3n37_A Ribonucleoside-diphosph 100.0 2.3E-32 9.9E-37  216.2  10.4  120    1-123   189-311 (319)
  6 1jk0_A RNR Y2, ribonucleoside- 100.0 6.1E-32 2.6E-36  213.7   7.1  114    1-123   290-403 (419)
  7 2p1i_A Ribonucleotide reductas 100.0 6.7E-32 2.8E-36  213.4   7.2  113    1-122   223-335 (349)
  8 3dhz_A Ribonucleotide reductas 100.0 6.5E-31 2.8E-35  207.4   9.0  119    1-122   199-320 (329)
  9 1jk0_B RNR Y4, ribonucleoside- 100.0 2.3E-30 9.8E-35  204.1   5.2  113    1-122   217-329 (345)
 10 2o1z_A Ribonucleotide reductas  99.9 2.1E-24 8.7E-29  167.9   5.9   89    1-97    222-310 (311)
 11 3mjo_A Ribonucleotide reductas  99.9 4.5E-23 1.9E-27  159.8   9.9   98    1-101   198-296 (296)
 12 3ee4_A Probable ribonucleoside  99.6 3.5E-16 1.5E-20  117.9   6.3  109    1-115   208-317 (323)
 13 2oc5_A Hypothetical protein; N  92.9    0.52 2.2E-05   25.7   7.9   75    1-83    155-230 (244)
 14 2uw1_A Desaturase, plastid del  45.6      16 0.00067   16.6   4.4   23    2-24    202-224 (338)
 15 1za0_A Possible acyl-[acyl-car  44.3      17  0.0007   16.5   4.6   23    2-24    187-209 (275)
 16 2inc_A Toluene, O-xylene monoo  41.5      18 0.00077   16.3   6.5   79    2-85    228-313 (491)
 17 3ge3_A Toluene-4-monooxygenase  38.5      21 0.00086   16.0   3.5   80    2-86    229-315 (500)
 18 2kp7_A Crossover junction endo  30.4      16 0.00068   16.6   1.4   39   79-120     4-44  (87)
 19 3ez0_A Uncharacterized protein  25.9      33  0.0014   14.7   6.5   81    1-83    135-224 (225)
 20 1b0n_B Protein (SINI protein);  24.9      12  0.0005   17.4  -0.1   30   42-71      9-38  (57)

No 1  
>1syy_A Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune evasion, replication; 1.70A {Chlamydia trachomatis} SCOP: a.25.1.2 PDB: 2ani_A
Probab=100.00  E-value=9.7e-38  Score=248.94  Aligned_cols=123  Identities=57%  Similarity=1.023  Sum_probs=119.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      +|||++|+.+++.+++++++|+|++++++++++|++|+.+||++|.+|++++|+.|++|||++++++||+|+||+||.+|
T Consensus       224 ~RDE~~H~~~~~~l~~~l~~e~~~~~~~~~~~~i~~l~~~ave~E~~~~~~~~~~~~~Gl~~~~~~~Yv~y~an~rL~~l  303 (346)
T 1syy_A          224 LRDETIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERI  303 (346)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHHHHHHHHHHHHHHHHHHCSSCBTTBCHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             14578899999999999985197875689999999999999999999999856588789999999999999999999977


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCCC
Q ss_conf             97878898788868999983466573213100333343065778
Q gi|254780136|r   81 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW  124 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~~~  124 (125)
                      |++|+|+. +||+|||++.+++++++||||+|||+|+|||+++|
T Consensus       304 G~~~~f~~-~nP~~w~~~~~~~~~~~nFFe~r~~~Y~k~~~~~~  346 (346)
T 1syy_A          304 GLKPIYHT-KNPFPWMSETIDLNKEKNFFETRVIEYQHAASLTW  346 (346)
T ss_dssp             TCCCSSCC-CCSCTTC----------------------------
T ss_pred             CCCCCCCC-CCCHHHHHHHHCCCCCCCCCCCCHHCCCCCCCCCC
T ss_conf             99998999-99637899863867776878897210454577889


No 2  
>2rcc_A Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125}
Probab=100.00  E-value=1e-35  Score=236.64  Aligned_cols=125  Identities=29%  Similarity=0.502  Sum_probs=116.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      +|||++|+.|++.++++++.++|+++++++++.|++++++||++|.+|++++|+.+++|||+++|++||+|+||+||.+|
T Consensus       217 ~RDE~lH~~~~~~l~~~l~~e~~~~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~e~~~~yi~y~an~~L~~l  296 (346)
T 2rcc_A          217 NRDEQLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLMKAADLEKDWFRYIIGDKIPGINPEDMETYISFIANKRAVQL  296 (346)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCGGGCSHHHHHHHHHHHHHHHHHHHHHHHHHTTTCSTTCCHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             84376889999999999876266102567899999999999999999999981877688889999999999999999977


Q ss_pred             CCCCCCC-CCCCCHHHHHHHHCCC-CCCCCCCCCHHHHHHHCCC-CCC
Q ss_conf             9787889-8788868999983466-5732131003333430657-789
Q gi|254780136|r   81 GLEPLFK-YTENPFPWMSEVIDLK-KEKNFFETRVTEYQQGAEL-KWD  125 (125)
Q Consensus        81 Gl~~~f~-~~~nPl~W~~~~~~~~-~~~nFFE~r~t~Y~k~~~~-~~D  125 (125)
                      |++++|+ ..+||+|||++++++. +++||||+|+|+|+|++.. +||
T Consensus       297 G~~~~f~~~~~nP~~w~~~~~~~~~~~~nFFE~~~t~Y~k~~~~~~~D  344 (346)
T 2rcc_A          297 GMEKPYPEIKHNPMKWIRAYEDVNSGKSDFFEQKSRQYAKVSADNGFD  344 (346)
T ss_dssp             TCCCSCTTCCSCSCTTC-------------------------------
T ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCC
T ss_conf             999999877789588999864347652588889778753267778866


No 3  
>1mxr_A Ribonucleotide reductase R2; radical protein, DI iron, oxidoreductase; 1.42A {Escherichia coli} SCOP: a.25.1.2 PDB: 1jpr_A 1jqc_A 1xik_A 1yfd_A 1piy_A 1r65_A 1biq_B* 1rsv_A 1piz_A 1piu_A 1pim_A 1rsr_A 1biq_A* 1rib_A 1mrr_A 1rnr_A* 1pj0_A 1pj1_A 1av8_A 1pfr_A ...
Probab=100.00  E-value=1.8e-33  Score=223.00  Aligned_cols=122  Identities=25%  Similarity=0.389  Sum_probs=110.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCC----CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCHHHHHHHHHHHHHH
Q ss_conf             94037899999999999996770----00311229999999999999999985763087-60188999999999999999
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENP----HLWTKEFQQKSRTMLHEATLLEIAYAHETMPK-GFVGLNAPSCEQYMQFIANR   75 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~p----e~~~~~~~~~i~~~~~eave~E~~~~~~~~~~-~~~Gl~~~~~~~Yiky~an~   75 (125)
                      +|||++|+.|++.+++.++++.+    +.++++++++|++++.+||++|.+|++++++. +++|||++++++||+|+||+
T Consensus       235 ~RDE~~H~~f~~~l~~~l~~~~~~~~~~~~~~e~~~~i~~~~~eave~E~~~~~~~~~~~~~~glt~~~~~~yi~y~an~  314 (375)
T 1mxr_A          235 ARDEALHLTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYITNI  314 (375)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTSSCHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHTTTCCBTTBSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             84288999999999999984378624566589999999999999999999999986368885898999999999999999


Q ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHHCCCC-CCCCCCCCHHHHHHHCCC
Q ss_conf             99985978788987888689999834665-732131003333430657
Q gi|254780136|r   76 RCHQIGLEPLFKYTENPFPWMSEVIDLKK-EKNFFETRVTEYQQGAEL  122 (125)
Q Consensus        76 rL~~lGl~~~f~~~~nPl~W~~~~~~~~~-~~nFFE~r~t~Y~k~~~~  122 (125)
                      ||.+||++++|++.+||+|||+.++++.+ ++||||+|+|+|+||+..
T Consensus       315 rL~~LG~~~~f~~~~nP~~w~~~~~~~~~~~~nFFe~~~t~Y~~~~~~  362 (375)
T 1mxr_A          315 RMQAVGLDLPFQTRSNPIPWINTWLVSDNVQVAPQEVEVSSYLVGQID  362 (375)
T ss_dssp             HHHHTTCCCCSCCCCCSCGGGGGTC-----------------------
T ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCHHEEECCCC
T ss_conf             999779999999999983679998704887548766870001233445


No 4  
>1h0o_A Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus} SCOP: a.25.1.2 PDB: 1h0n_A 1w68_A 1w69_A 1xsm_A 2uw2_A 3hf1_A 2vux_A
Probab=99.98  E-value=1.2e-32  Score=218.02  Aligned_cols=114  Identities=33%  Similarity=0.632  Sum_probs=104.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      +|||++|+.|+|.|++.++.       +..++.|++++.+||++|.+|++++++.|++|||+++|++||+|+||+||.+|
T Consensus       264 ~RDE~lH~~f~~~l~~~l~~-------e~~~~~i~e~~~eavelE~~~~~~~~~~~~~Gln~~~~~~YIky~an~~L~~L  336 (390)
T 1h0o_A          264 SRDEGLHCDFACLMFKHLVH-------KPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLEL  336 (390)
T ss_dssp             HHHHHHHHHHHHHHHHTCSS-------CCCHHHHHHHHHHHHHHHHHHHHTTSCGGGGTCCHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHH-------CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             98899999999999998740-------21699999999999999999999856787589899999999999999999977


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCC
Q ss_conf             9787889878886899998346657321310033334306577
Q gi|254780136|r   81 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK  123 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~~  123 (125)
                      |++++|++ +||+|||+ .+++.+++||||+|||+|+|+|.++
T Consensus       337 G~~~~f~~-~NP~~wme-~i~~~~ktnFFE~rvt~Y~k~g~~~  377 (390)
T 1h0o_A          337 GFNKIFRV-ENPFDFME-NISLEGKTNFFEKRVGEYQRMGVMS  377 (390)
T ss_dssp             TCCCSSCC-CCSCGGGC--------------------------
T ss_pred             CCCCCCCC-CCCHHHHH-HHCCCCCCCCCCCCHHHCEECCCCC
T ss_conf             99998999-99609998-6224788777677723201565446


No 5  
>3n37_A Ribonucleoside-diphosphate reductase 2 subunit BE; ribonucleotide reductase, four-helix bundle, dimanganese CLU oxidoreductase; 1.65A {Escherichia coli} PDB: 3n38_A 3n39_B* 3n3a_B* 3n3b_B* 1r2f_A 2bq1_I* 2r2f_A
Probab=99.98  E-value=2.3e-32  Score=216.21  Aligned_cols=120  Identities=20%  Similarity=0.234  Sum_probs=111.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      +|||++|+.|++.|++.++++.|+.+++++++++++++++||++|.+|++++++.   |++++++++||+|+||+||.+|
T Consensus       189 ~RDE~lH~~f~~~l~~~l~~e~~~~~~~~~~~~i~e~~~eav~~E~~~~~~~~~~---g~~~~~~~~yiky~an~~L~~l  265 (319)
T 3n37_A          189 IRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAE---TPWADDVKAFLCYNANKALMNL  265 (319)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTT---SSCHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---CCCHHHHHHHHHHHHHHHHHHC
T ss_conf             9788899999999999876528487765689999999999999999999998744---6422779999999999999977


Q ss_pred             CCCCCCCCC---CCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCC
Q ss_conf             978788987---8886899998346657321310033334306577
Q gi|254780136|r   81 GLEPLFKYT---ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK  123 (125)
Q Consensus        81 Gl~~~f~~~---~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~~  123 (125)
                      |++|+|+..   .||+||+...+++.+++||||+|||+|+||++.+
T Consensus       266 G~~~~f~~~~~~~nP~~w~~~~~~~~~~~nFFE~~~t~Y~k~~~~~  311 (319)
T 3n37_A          266 GYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVE  311 (319)
T ss_dssp             TCCCCSCGGGCCCCHHHHHHHCC-----------------------
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCHHHCCCCCCCC
T ss_conf             9998889865788956899872066645688788701021056787


No 6  
>1jk0_A RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1smq_A
Probab=99.97  E-value=6.1e-32  Score=213.67  Aligned_cols=114  Identities=32%  Similarity=0.563  Sum_probs=103.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      .|||++|+.|++.|++.++.+.       ..+.+.+++.+||++|.+|+.++++.+++|||+++|++||+|+||+||.+|
T Consensus       290 ~RDE~lH~~f~~~L~~~l~~e~-------~~~~v~~~i~eavelE~e~~~~~l~~~l~Gln~~~m~~YIky~Anr~L~~L  362 (419)
T 1jk0_A          290 CRDEGLHTDFACLLFAHLKNKP-------DPAIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAF  362 (419)
T ss_dssp             HHHHHHHHHHHHHHHHTCSSCC-------CHHHHHHHHHHHHHHHHHHHHTTSCGGGGTCCHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHCC-------CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             9899999999999999987321-------078999999999999999998732787579999999999999999999976


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCC
Q ss_conf             9787889878886899998346657321310033334306577
Q gi|254780136|r   81 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK  123 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~~  123 (125)
                      |++|+|++ +||+|||+ .++..+++||||+|||+|+|||++.
T Consensus       363 G~~~~f~~-~NP~~wme-~i~~~~ktnFFE~rvt~Y~k~~v~~  403 (419)
T 1jk0_A          363 GNKKYYKV-ENPFDFME-NISLAGKTNFFEKRVSDYQKAGVMS  403 (419)
T ss_dssp             TCCCSSCC-CCCCGGGG-C------------------------
T ss_pred             CCCCCCCC-CCCCHHHH-HHCCCCCCCCCCCCHHHHHHCCCCC
T ss_conf             99987899-99836888-7345787777667688887623666


No 7  
>2p1i_A Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, structural genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii str}
Probab=99.97  E-value=6.7e-32  Score=213.44  Aligned_cols=113  Identities=32%  Similarity=0.647  Sum_probs=104.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      .|||++|+.|++.|++.++.+.|       ++.+++++++||++|.+|+.++++.+++|++++++++||+|+||+||.+|
T Consensus       223 ~RDE~lH~~f~~~l~~~l~~e~~-------e~~v~~~~~eave~E~~~~~~~~~~~~~gl~~~~~~~yi~y~an~~L~~L  295 (349)
T 2p1i_A          223 SRDEGLHTDFNCLIYSLLENKLP-------ENVVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLLECL  295 (349)
T ss_dssp             HHHHHHHHHHHHHHHHTCSSCCC-------HHHHHHHHHHHHHHHHHHHTTTSCSTTTTCCHHHHHHHHHHHHHHHHHHT
T ss_pred             HCCHHHHHHHHHHHHHHHHHCCC-------HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             54287899899999999752088-------78999999999999999999970225334569999999999999999977


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCC
Q ss_conf             978788987888689999834665732131003333430657
Q gi|254780136|r   81 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL  122 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~  122 (125)
                      |++|+|+. +||+|||+ .+++.+++||||+|+|+|+|||+.
T Consensus       296 G~~~~f~~-~nP~~w~~-~~~~~~ktnFFe~r~t~Y~k~~~~  335 (349)
T 2p1i_A          296 GCSKVFHS-KNPFNWMD-LISLQGKTNFFEKRVADYQKSGVM  335 (349)
T ss_dssp             TCCCSSCC-CCSCCC---------------------------
T ss_pred             CCCCCCCC-CCCCCHHH-HHCCCCCCCCCCCCHHHHHHCCCC
T ss_conf             99999999-99954577-853576778888876764316666


No 8  
>3dhz_A Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes} SCOP: a.25.1.2 PDB: 1kgo_A 1kgp_A 1oqu_A 1kgn_A 1uzr_A*
Probab=99.97  E-value=6.5e-31  Score=207.42  Aligned_cols=119  Identities=19%  Similarity=0.265  Sum_probs=108.3

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      +|||++|+.|++.||+.++++.|+.+++++++.|++++++||++|.+|++++|+.  +|++ +++++||+|+||+||.+|
T Consensus       199 ~RDE~lH~~f~~~l~~~~~~~~~~~~~~e~~~~i~~~~~eav~~E~~~~~~~f~~--~gl~-~~i~~Yiky~an~rL~~l  275 (329)
T 3dhz_A          199 IRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDD--LGWT-EDVKRFLRYNANKALNNL  275 (329)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT--TTCH-HHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCH-HHHHHHHHHHHHHHHHHC
T ss_conf             8548999999999999887776799888779999999999999999999998643--4636-999999999999999977


Q ss_pred             CCCCCCCCC---CCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCC
Q ss_conf             978788987---888689999834665732131003333430657
Q gi|254780136|r   81 GLEPLFKYT---ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL  122 (125)
Q Consensus        81 Gl~~~f~~~---~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~  122 (125)
                      |++|+|++.   .||++|+...+++.+++||||+|+|+|++|+..
T Consensus       276 G~~~~f~~~~~~~~P~~~~~~~~~~~~~~nFFE~~~t~Y~~~~~~  320 (329)
T 3dhz_A          276 GYEGLFPTDETKVSPAILSSLSPNADENHDFFSGSGSSYVIGKAE  320 (329)
T ss_dssp             TCCCSSCGGGCCCCHHHHHHHC-----------------------
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCC
T ss_conf             999888976678981669987205675678754763310213556


No 9  
>1jk0_B RNR Y4, ribonucleoside-diphosphate reductase small chain 2; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1sms_A
Probab=99.96  E-value=2.3e-30  Score=204.06  Aligned_cols=113  Identities=23%  Similarity=0.471  Sum_probs=102.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      +|||++|+.|++.|++.++.+.       ..+.+++++++||++|.+|+.++++.+++|||++++++||+|+||+||.+|
T Consensus       217 ~RDE~lH~~f~~~l~~~l~~e~-------~~~~i~~~~~eave~e~~~~~~~~~~~~~gl~~~~~~~Yi~y~an~~L~~l  289 (345)
T 1jk0_B          217 CRDRGAYTDFSCLLFAHLRTKP-------NPKIIEKIITEAVEIEKEYYSNSLPVEKFGMDLKSIHTYIEFVADGLLQGF  289 (345)
T ss_dssp             HHHHHHHHHHHHHHHHTCSSCC-------CHHHHHHHHHHHHHHHHHHHTTSCC-----------CTHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHCCH-------HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             8689999999999999975100-------035899999999999999998545655336589999999999999999977


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCC
Q ss_conf             978788987888689999834665732131003333430657
Q gi|254780136|r   81 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL  122 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~  122 (125)
                      |++|+|++ +||+|||+...+ .+++||||+|||+|+|+|++
T Consensus       290 G~~~~f~~-~nP~~w~~~~~~-~~ktnFFe~r~t~Y~k~~~~  329 (345)
T 1jk0_B          290 GNEKYYNA-VNPFEFMEDVAT-AGKTTFFEKKVSDYQKASDM  329 (345)
T ss_dssp             TCCCCC------------------------------------
T ss_pred             CCCCCCCC-CCCHHHHHHHHC-CCCCCCCCCCHHHCCCCCCC
T ss_conf             99987899-997489998737-67764457763312035556


No 10 
>2o1z_A Ribonucleotide reductase subunit R2; small subunit ribonucleotide reductase, oxidoreductase, DNA replication, iron, DIIRON, radical, R2 subunit; 2.40A {Plasmodium vivax}
Probab=99.90  E-value=2.1e-24  Score=167.92  Aligned_cols=89  Identities=29%  Similarity=0.603  Sum_probs=83.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      .|||++|+.|++.+++.++.+.|       ++.+++++++||++|.+|++++++.+++|||++++++||+|+||+||.+|
T Consensus       222 ~RDE~lH~~f~~~l~~~l~~~~~-------~e~i~~~~~eavelE~~~~~~~~~~~~~Gl~~~~~~~Yi~y~an~~L~~l  294 (311)
T 2o1z_A          222 SRDEGLHTDFNCLIYSLLENKLP-------EEVVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLLECL  294 (311)
T ss_dssp             HHHHHHHHHHHHHHHHTCSSCCC-------HHHHHHHHHHHHHHHHTTBTTTBCCTTTTCCHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCC-------HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             81498999999999999853299-------99999999999999999999876798679999999999999999999977


Q ss_pred             CCCCCCCCCCCCHHHHH
Q ss_conf             97878898788868999
Q gi|254780136|r   81 GLEPLFKYTENPFPWMS   97 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~   97 (125)
                      |++|+|++ +||+|||+
T Consensus       295 Gl~~~f~~-~NP~~Wme  310 (311)
T 2o1z_A          295 GSPKIFHA-KNPFNWMD  310 (311)
T ss_dssp             TCCCSSCC-CCCCTTTT
T ss_pred             CCCCCCCC-CCCCCCCC
T ss_conf             89998999-99987616


No 11 
>3mjo_A Ribonucleotide reductase subunit R2F; Mn ribonucleotide reductase, RNR, radical enzyme, split SIGN metallocofactor; 1.36A {Corynebacterium ammoniagenes} PDB: 1uzr_A*
Probab=99.89  E-value=4.5e-23  Score=159.77  Aligned_cols=98  Identities=19%  Similarity=0.288  Sum_probs=90.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      +|||++|+.|++.+|++++++.|+.+++++++.|++++++||++|.+|++++|+.  +|++. ++++||+|+||+||++|
T Consensus       198 ~RDE~lH~~f~~~l~~~~~~e~~~~~~~~~~~~i~~~~~~ave~E~~~~~~~~~~--~gl~~-~i~~yv~y~an~~L~~l  274 (296)
T 3mjo_A          198 IRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDD--LGWTE-DVKRFLRYNANKALNNL  274 (296)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT--TTCHH-HHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHH-HHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999887877899988889999999999999999999998702--57299-99999999999999978


Q ss_pred             CCCCCCCCCCCCH-HHHHHHHC
Q ss_conf             9787889878886-89999834
Q gi|254780136|r   81 GLEPLFKYTENPF-PWMSEVID  101 (125)
Q Consensus        81 Gl~~~f~~~~nPl-~W~~~~~~  101 (125)
                      |++|+|+..++|. ||+..+++
T Consensus       275 G~~~~f~~~~~~~~P~i~~~l~  296 (296)
T 3mjo_A          275 GYEGLFPTDETKVSPAILSSLS  296 (296)
T ss_dssp             TCCCSSCGGGCCCCHHHHHHHC
T ss_pred             CCCCCCCCCCCCCCHHHHHCCC
T ss_conf             8999999876888878872039


No 12 
>3ee4_A Probable ribonucleoside-diphosphate reductase; manganese, iron, DIIRON, carboxylate, oxidase, ligand, cavity, monooxygenase; HET: MYR; 1.90A {Mycobacterium tuberculosis}
Probab=99.62  E-value=3.5e-16  Score=117.86  Aligned_cols=109  Identities=13%  Similarity=0.126  Sum_probs=86.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      .|||++|+.||+.+++.++.|+|+.++ .+++.+++++.+|+++|.++....++..++|++.+   +||+|+||++|++|
T Consensus       208 ~RDE~~H~~fg~~l~~~l~~e~p~~~~-~~~~~i~el~~~a~e~e~~~~~~~~~~~~~gl~~e---~yv~Yvad~~l~~L  283 (323)
T 3ee4_A          208 GDDERRHMAWGTFTCRRHVAADDANWT-VFETRMNELIPLALRLIEEGFALYGDQPPFDLSKD---DFLQYSTDKGMRRF  283 (323)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCTHHHH-HHHHHHHHHHHHHHHHHHHHHHTTTTCCSTTCCHH---HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHH---HHHHHHHHHHHHHC
T ss_conf             966999999999999999874930448-99999999999999999999987077766799999---99999999999877


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCC-CCCCCCHHH
Q ss_conf             97878898788868999983466573-213100333
Q gi|254780136|r   81 GLEPLFKYTENPFPWMSEVIDLKKEK-NFFETRVTE  115 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~~~~~~~~~~-nFFE~r~t~  115 (125)
                      |.-+.  ...+|++|++-..+..... .|.+.....
T Consensus       284 G~i~~--a~~~p~~~~d~~~~p~~l~~~f~~~~~~~  317 (323)
T 3ee4_A          284 GTISN--ARGRPVAEIDVDYSPAQLEDTFADEDRRT  317 (323)
T ss_dssp             HHHHT--TTTCCGGGTCC------------------
T ss_pred             CCCCC--CCCCCHHHCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99312--44699776577789799999999999999


No 13 
>2oc5_A Hypothetical protein; NP_895059.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: UNL; 1.68A {Prochlorococcus marinus str} SCOP: a.25.1.6
Probab=92.88  E-value=0.52  Score=25.67  Aligned_cols=75  Identities=13%  Similarity=0.158  Sum_probs=43.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9403789999999999999677000311229999999999999999985763087-601889999999999999999998
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPK-GFVGLNAPSCEQYMQFIANRRCHQ   79 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~-~~~Gl~~~~~~~Yiky~an~rL~~   79 (125)
                      |+||.+|+.||..-++.-.        +.+++++.+.-++..-+-..-.+.+-.+ .++|+.++.+.+=.--.-...|..
T Consensus       155 VkDEY~HLN~Ge~WLk~~f--------~~~K~el~~AN~~nLPlv~~ML~qV~~Da~vL~Meke~lvedFmi~Y~eAL~~  226 (244)
T 2oc5_A          155 VKDEYTHLNYGEAWLKANL--------ESCREELLEANRENLPLIRRMLDQVAGDAAVLQMDKEDLIEDFLIAYQESLTE  226 (244)
T ss_dssp             HHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCHHHHHHHHHH--------HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             6447765025899999999--------99999999988850549999999998789997788999999999999999997


Q ss_pred             CCCC
Q ss_conf             5978
Q gi|254780136|r   80 IGLE   83 (125)
Q Consensus        80 lGl~   83 (125)
                      ||+.
T Consensus       227 IGf~  230 (244)
T 2oc5_A          227 IGFN  230 (244)
T ss_dssp             HTCC
T ss_pred             CCCC
T ss_conf             5975


No 14 
>2uw1_A Desaturase, plastid delta4 multifunctional acyl-ACYL carrier protein desaturase; electron transfer, four-helix bundle, oxidoreductase; HET: GVM; 1.95A {Hedera helix} PDB: 2uw1_B* 1oq4_A 1oq7_A 1oq9_A 1oqb_A 1afr_A 2j2f_A
Probab=45.55  E-value=16  Score=16.64  Aligned_cols=23  Identities=17%  Similarity=0.302  Sum_probs=20.8

Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             40378999999999999967700
Q gi|254780136|r    2 RDESLHLNFGIDVINQIKIENPH   24 (125)
Q Consensus         2 RDE~lH~~~~~~l~~~l~~e~pe   24 (125)
                      +||..|..|+.++++.+.+-.|+
T Consensus       202 ~DE~rH~~fY~~~v~~~le~dPd  224 (338)
T 2uw1_A          202 SDEKRHATAYTKIVEKLAEIDPD  224 (338)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCH
T ss_conf             89999999999999999853938


No 15 
>1za0_A Possible acyl-[acyl-carrier protein] desaturase DESA2 (acyl-[ACP] desaturase) (stearoyl-ACP...; four-helix bundle; 2.00A {Mycobacterium tuberculosis H37RV} SCOP: a.25.1.2
Probab=44.32  E-value=17  Score=16.52  Aligned_cols=23  Identities=22%  Similarity=0.205  Sum_probs=20.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             40378999999999999967700
Q gi|254780136|r    2 RDESLHLNFGIDVINQIKIENPH   24 (125)
Q Consensus         2 RDE~lH~~~~~~l~~~l~~e~pe   24 (125)
                      +||..|..|+..+++.+..-+|.
T Consensus       187 ~DE~rH~~fy~~~v~~~le~dpd  209 (275)
T 1za0_A          187 RDEVRHEEFFANLVTHCLDYTRD  209 (275)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHSHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCH
T ss_conf             88999999999999999865907


No 16 
>2inc_A Toluene, O-xylene monooxygenase oxygenase subunit; DIIRON, 4-helix bundle, carboxylate bridge, metalloenzyme, oxidoreductase; HET: P6G; 1.85A {Pseudomonas stutzeri} SCOP: a.25.1.2 PDB: 2ind_A* 1t0q_A 1t0r_A 1t0s_A 2rdb_A*
Probab=41.45  E-value=18  Score=16.25  Aligned_cols=79  Identities=19%  Similarity=0.142  Sum_probs=44.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH----HHHHHHCCCCCCCCCHHHHHHHHHHHHH---
Q ss_conf             403789999999999999677000311229999999999999999----9857630876018899999999999999---
Q gi|254780136|r    2 RDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI----AYAHETMPKGFVGLNAPSCEQYMQFIAN---   74 (125)
Q Consensus         2 RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~----~~~~~~~~~~~~Gl~~~~~~~Yiky~an---   74 (125)
                      +||+-|+.+|..+++.+.++.+.   ...+..|...+=.+..+=.    -..+|..+...-..+-.  +-+-+++++   
T Consensus       228 sDEaRH~~~G~~~l~~l~e~~~~---~~lQ~~vd~~fW~~~r~~~~l~g~~~dY~~p~~~~~~s~~--e~~~ew~~~~~~  302 (491)
T 2inc_A          228 TDESRHAQQGGPSLKILVENGKK---DEAQQMVDVAIWRSWKLFSVLTGPIMDYYTPLESRNQSFK--EFMLEWIVAQFE  302 (491)
T ss_dssp             HHHHHHHTTHHHHHHHHHHTTCH---HHHHHHHHHHHHHHHHHHHHHTHHHHHHTSCGGGCCSCHH--HHHHHHTHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHH--HHHHHHHHHHHH
T ss_conf             58989887589999999857877---9999999999998889999999989874485545287899--999999899999


Q ss_pred             HHHHHCCCCCC
Q ss_conf             99998597878
Q gi|254780136|r   75 RRCHQIGLEPL   85 (125)
Q Consensus        75 ~rL~~lGl~~~   85 (125)
                      ++|..+|++++
T Consensus       303 ~~l~~yGl~~P  313 (491)
T 2inc_A          303 RQLLDLGLDKP  313 (491)
T ss_dssp             HHHHHHTCCCC
T ss_pred             HHHHHHCCCCC
T ss_conf             99998389987


No 17 
>3ge3_A Toluene-4-monooxygenase system protein A; DIIRON hydroxylase, effector protein, T201A, aromatic hydrocarbons catabolism, FAD, flavoprotein; 1.52A {Pseudomonas mendocina} PDB: 3ge8_A 3dhi_A* 3dhh_A* 3dhg_A* 3i5j_A 3i63_A
Probab=38.47  E-value=21  Score=15.97  Aligned_cols=80  Identities=19%  Similarity=0.144  Sum_probs=41.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHH----HHHHHCCCCCCCCCHHHHHHHHHHHH---H
Q ss_conf             4037899999999999996770003112299999999999999999----85763087601889999999999999---9
Q gi|254780136|r    2 RDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA----YAHETMPKGFVGLNAPSCEQYMQFIA---N   74 (125)
Q Consensus         2 RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~----~~~~~~~~~~~Gl~~~~~~~Yiky~a---n   74 (125)
                      +||+-|..+|..+++.+.+..+   .+..+..|...+-.+..+=..    ..+|..+...--.|-..+  +-++++   =
T Consensus       229 sDEaRH~~~G~~~lk~l~e~~n---~~~lQ~~vd~wfwr~~~~~~~l~G~~~dY~~~~~~r~~s~~e~--~~ew~~g~~~  303 (500)
T 3ge3_A          229 TDESRHAQQGGPALQLLIENGK---REEAQKKVDMAIWRAWRLFAVLTGPVMDYYTPLEDRSQSFKEF--MYEWIIGQFE  303 (500)
T ss_dssp             HHHHHHGGGHHHHHHHHHHTTC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCGGGCSSCHHHH--HHHHTTTTHH
T ss_pred             HHHHHHHHHHHHHHHHHHHCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH--HHHHHHHHHH
T ss_conf             8999999858999999996776---6999999999999889999988888888448663225349999--9999889999


Q ss_pred             HHHHHCCCCCCC
Q ss_conf             999985978788
Q gi|254780136|r   75 RRCHQIGLEPLF   86 (125)
Q Consensus        75 ~rL~~lGl~~~f   86 (125)
                      ++|..+|++++-
T Consensus       304 ~~L~~~Gl~~P~  315 (500)
T 3ge3_A          304 RSLIDLGLDKPW  315 (500)
T ss_dssp             HHHHHTTCCCCT
T ss_pred             HHHHHHCCCCCH
T ss_conf             999982799863


No 18 
>2kp7_A Crossover junction endonuclease MUS81; helix-hairpin-helix, tumour suppressor, DNA damage, DNA recombination, DNA repair, hydrolase, magnesium; NMR {Mus musculus}
Probab=30.45  E-value=16  Score=16.61  Aligned_cols=39  Identities=21%  Similarity=0.359  Sum_probs=23.5

Q ss_pred             HCCCCCCCCCCCCCH--HHHHHHHCCCCCCCCCCCCHHHHHHHC
Q ss_conf             859787889878886--899998346657321310033334306
Q gi|254780136|r   79 QIGLEPLFKYTENPF--PWMSEVIDLKKEKNFFETRVTEYQQGA  120 (125)
Q Consensus        79 ~lGl~~~f~~~~nPl--~W~~~~~~~~~~~nFFE~r~t~Y~k~~  120 (125)
                      ++|+.|+= ...||+  .|+.++.+.....|-  +++..|.++-
T Consensus         4 ~~~~r~~P-s~~N~lfi~~L~e~~~~~~~k~~--k~~~aY~kA~   44 (87)
T 2kp7_A            4 RASVRPLP-VCPNPLFVRWLTEWRDEAASRGR--HTRFVFQKAL   44 (87)
T ss_dssp             ----CCCC-CSCCCHHHHHHHHHHHHHHHHTC--TTHHHHHHHH
T ss_pred             CCCCCCCC-CCCCHHHHHHHHHHHHHHHHCCC--HHHHHHHHHH
T ss_conf             67889999-99889999999999999987073--5799999999


No 19 
>3ez0_A Uncharacterized protein with ferritin-like fold; YP_832262.1, protein of unknown function with ferritin-like fold, structural genomics; HET: UNL TLA; 2.33A {Arthrobacter SP}
Probab=25.93  E-value=33  Score=14.68  Aligned_cols=81  Identities=14%  Similarity=0.112  Sum_probs=44.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH------HHHHHHCCCCCCCCCHHHHHHHH---HH
Q ss_conf             9403789999999999999677000311229999999999999999------98576308760188999999999---99
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI------AYAHETMPKGFVGLNAPSCEQYM---QF   71 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~------~~~~~~~~~~~~Gl~~~~~~~Yi---ky   71 (125)
                      ++|+. |..|+...++......|..- ..+.-..+.++-++..+=.      .-...+++.+..+-+.+.+.+..   .-
T Consensus       135 l~e~~-h~~~~~~~l~~~i~~d~~~~-~rlalw~RRl~geal~~~~~v~~~~~~l~~l~~~~~~~~~~~~l~~~~~~l~~  212 (225)
T 3ez0_A          135 QASDE-TTEVLRERLRSALADDPRLA-SRLALWGRRLLGEALTQAQRVSYEHAFLGSLIGGEDSAAAKELVSGLIAGLAE  212 (225)
T ss_dssp             SCCHH-HHHHHHHHHHHHHHHCTTHH-HHHHHHHHHHHHHHHHHHHHHHHHTCCHHHHC-----CHHHHHHHHHHHHHHH
T ss_pred             HCCHH-HHHHHHHHHHHHHHCCHHHH-HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             73004-89999999999985585778-89999999889999998575234655789887214566778889999999999


Q ss_pred             HHHHHHHHCCCC
Q ss_conf             999999985978
Q gi|254780136|r   72 IANRRCHQIGLE   83 (125)
Q Consensus        72 ~an~rL~~lGl~   83 (125)
                      --.+||..|||-
T Consensus       213 ~H~~RM~~LGLt  224 (225)
T 3ez0_A          213 KHSKRMTQLGLT  224 (225)
T ss_dssp             HHHHHHHTTTCC
T ss_pred             HHHHHHHHCCCC
T ss_conf             999999981889


No 20 
>1b0n_B Protein (SINI protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1
Probab=24.87  E-value=12  Score=17.42  Aligned_cols=30  Identities=7%  Similarity=0.143  Sum_probs=23.2

Q ss_pred             HHHHHHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             999999857630876018899999999999
Q gi|254780136|r   42 TLLEIAYAHETMPKGFVGLNAPSCEQYMQF   71 (125)
Q Consensus        42 ve~E~~~~~~~~~~~~~Gl~~~~~~~Yiky   71 (125)
                      .++..+|.+.++.-.-.||+.+.+..|+.-
T Consensus         9 ~eLD~EWv~Li~eA~~a~is~EEiR~~L~~   38 (57)
T 1b0n_B            9 FELDQEWVELMVEAKEANISPEEIRKYLLL   38 (57)
T ss_dssp             CCCCHHHHHHHHHHHHTTCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             998899999999999949999999999982


Done!