HHSEARCH alignment of GI: 254780136 and SCOP domain: d1mxra_

Alignment
>d1mxra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
Probab=99.94  E-value=3.6e-27  Score=183.26  Aligned_cols=100  Identities=28%  Similarity=0.489  Sum_probs=91.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCC----CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCHHHHHHHHHHHHHH
Q ss_conf             940378999999999999967700----03112299999999999999999857630876-0188999999999999999
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPH----LWTKEFQQKSRTMLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFIANR   75 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe----~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~-~~Gl~~~~~~~Yiky~an~   75 (125)
                      +|||++|+.|++.++++++++.+.    .++++++++|++++++||++|.+|++++++.| ++|||++++++||+|+||+
T Consensus       235 ~RDE~lH~~~~~~l~~~l~~~~~~~~~~~~~~e~~~~i~~~~~eave~E~~~~~~~~~~~~l~Gl~~~~~~~yi~y~an~  314 (339)
T d1mxra_         235 ARDEALHLTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYITNI  314 (339)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTSSCHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHTTTCCBTTBSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             73237777999999999985377166777678999999999999999999999997047981899999999999999999


Q ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             9998597878898788868999983
Q gi|254780136|r   76 RCHQIGLEPLFKYTENPFPWMSEVI  100 (125)
Q Consensus        76 rL~~lGl~~~f~~~~nPl~W~~~~~  100 (125)
                      ||.+||++|+|++..||+|||+.|+
T Consensus       315 ~L~~lG~~~~f~~~~NP~~w~~~~l  339 (339)
T d1mxra_         315 RMQAVGLDLPFQTRSNPIPWINTWL  339 (339)
T ss_dssp             HHHHTTCCCCSCCCCCSCGGGGGTC
T ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHC
T ss_conf             9997889999999999868898639


SCOP domain information

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Escherichia coli [TaxId: 562]