HHSEARCH alignment of GI: 254780136 and SCOP domain: d3dhza1

Alignment
>d3dhza1 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
Probab=99.87  E-value=2.1e-22  Score=154.22  Aligned_cols=98  Identities=19%  Similarity=0.274  Sum_probs=87.3

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254780136|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      +|||++|+.|++.+++.++++.|+.+++++++++++++++||++|.+|++++|+.  +|++. ++++||+|+||+||.+|
T Consensus       186 ~RDE~lH~~f~~~l~~~~~~e~~~~~~~e~~~~i~~~~~~ave~E~~~~~~~~~~--~gl~~-~~~~yiky~an~~L~~l  262 (284)
T d3dhza1         186 IRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDD--LGWTE-DVKRFLRYNANKALNNL  262 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT--TTCHH-HHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCHH-HHHHHHHHHHHHHHHHC
T ss_conf             9877777789999998750413255567779999999999999999999998742--57499-99999999999999978


Q ss_pred             CCCCCCCCCCC-CHHHHHHHHC
Q ss_conf             97878898788-8689999834
Q gi|254780136|r   81 GLEPLFKYTEN-PFPWMSEVID  101 (125)
Q Consensus        81 Gl~~~f~~~~n-Pl~W~~~~~~  101 (125)
                      |++|+|+..+. .-||+...++
T Consensus       263 G~~~~f~~~~~~~nP~~~~~~~  284 (284)
T d3dhza1         263 GYEGLFPTDETKVSPAILSSLS  284 (284)
T ss_dssp             TCCCSSCGGGCCCCHHHHHHHC
T ss_pred             CCCCCCCCCCCCCCHHHHHCCC
T ss_conf             8999999855778878882249


SCOP domain information

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Corynebacterium ammoniagenes [TaxId: 1697]