BLAST/PSIBLAST alignment of GI: 254780136 and GI: 110635036 at iteration 1
>gi|110635036|ref|YP_675244.1| ribonucleotide-diphosphate reductase subunit beta [Mesorhizobium sp. BNC1] Length = 369
>gi|110286020|gb|ABG64079.1| ribonucleotide reductase [Chelativorans sp. BNC1] Length = 369
 Score =  200 bits (509), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 91/125 (72%), Positives = 102/125 (81%)

Query: 1   MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 60
           +RDES+HLNFGIDVINQIK ENPHLWT EFQ++ R ML +A  LE AY  +TMP+GF+GL
Sbjct: 245 LRDESIHLNFGIDVINQIKHENPHLWTPEFQEELRRMLKDAAELEAAYGRDTMPRGFLGL 304

Query: 61  NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 120
           NA  CEQYM FIANRRC Q+GL P+F  TENPFPWMSE +DLKKEKNFFETRV EYQ G 
Sbjct: 305 NAGQCEQYMHFIANRRCAQLGLPPVFPETENPFPWMSEAMDLKKEKNFFETRVIEYQNGG 364

Query: 121 ELKWD 125
            L WD
Sbjct: 365 ALSWD 369