PSIBLAST alignment of GI: 254780136 and protein with PDB id: 2uw2

>gi|145580571|pdb|2UW2|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase Subunit R2 Length = 332
 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 65/122 (53%), Gaps = 9/122 (7%)

Query: 2   RDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLN 61
           RDE LH +F   +         HL  K  +++ R ++  A  +E  +  E +P   +G+N
Sbjct: 207 RDEGLHCDFACLMFK-------HLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMN 259

Query: 62  APSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 121
               +QY++F+A+R   ++G   +F   ENPF +M E I L+ + NFFE RV EYQ+   
Sbjct: 260 CTLMKQYIEFVADRLMLELGFSKVF-RVENPFDFM-ENISLEGKTNFFEKRVGEYQRMGV 317

Query: 122 LK 123
           + 
Sbjct: 318 MS 319