RPSBLAST alignment of GI: 254780136 and MMDB domain: 1syy_A_

>1syy_A (A:) Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune evasion, replication; 1.70A {Chlamydia trachomatis}Length = 346
 Score =  111 bits (277), Expect = 4e-26
 Identities = 71/124 (57%), Positives = 91/124 (73%), Gaps = 1/124 (0%)

Query: 1   MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 60
           +RDE++HLNFGID+IN IK ENP +WT E QQ+   ++  A  LEI YA + +P+G +GL
Sbjct: 224 LRDETIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGL 283

Query: 61  NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 120
            A     Y+Q IA+RR  +IGL+P++ +T+NPFPWMSE IDL KEKNFFETRV EYQ  A
Sbjct: 284 RASMFIDYVQHIADRRLERIGLKPIY-HTKNPFPWMSETIDLNKEKNFFETRVIEYQHAA 342

Query: 121 ELKW 124
            L W
Sbjct: 343 SLTW 346