RPSBLAST alignment of GI: 254780136 and MMDB domain: 3dhz_A_139-329

>3dhz_A (A:139-329) Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes}Length = 191
 Score =  110 bits (277), Expect = 5e-26
 Identities = 25/129 (19%), Positives = 53/129 (41%), Gaps = 7/129 (5%)

Query: 1   MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 60
           +RDES+H  +      Q   +      +E++  +  ++++    EI Y  +         
Sbjct: 61  IRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLG--- 117

Query: 61  NAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 117
                ++++++ AN+  + +G E LF   +   +P    S   +  +  +FF    + Y 
Sbjct: 118 WTEDVKRFLRYNANKALNNLGYEGLFPTDETKVSPAILSSLSPNADENHDFFSGSGSSYV 177

Query: 118 QG-AELKWD 125
            G AE   D
Sbjct: 178 IGKAEDTTD 186