HHsearch alignment for GI: 254780138 and conserved domain: COG0767

>COG0767 Ttg2B ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].
Probab=100.00  E-value=0  Score=506.09  Aligned_cols=262  Identities=39%  Similarity=0.611  Sum_probs=248.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             13665899985999999999999999999999999999740267887289999999998377699999999999999999
Q gi|254780138|r  105 NSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ  184 (373)
Q Consensus       105 ~~~~~~~~~iG~~~~~~~~~~~~~~~f~G~~~~~~~~~~~~~~~~r~~~~~~~~q~~~~G~~alpiv~l~~~~~G~v~a~  184 (373)
T Consensus         6 ~~~~~~~~~~g~~~~~~~~~~g~~~~~~~~~l~~-------~~~~~~~~~~~~~q~~~vg~~sl~Iv~~~~~~vG~vla~   78 (267)
T COG0767           6 PRLIALLRRLGKALLKTLRSLGRAFLFLGNALRG-------LFREPFRPRELVRQLYFVGVGSLPIVALTSLFVGAVLAL   78 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             1389999999898999999999999999999998-------402436689999999998600379999999999999999


Q ss_pred             HHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             99998754275668999999999999899999999999645789999999987500134444278689999999999999
Q gi|254780138|r  185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALI  264 (373)
Q Consensus       185 q~~~~l~~fGa~~~v~~~~~~~~~RElgPlltaii~agR~gsa~aAeiG~M~v~eeidAL~~~Gi~p~~~Lv~PRv~A~~  264 (373)
T Consensus        79 qg~~~L~~fGAe~~~g~lval~~~RElgPvlTal~~AGr~gSa~tAeIG~MritEEIDAlevmgidPi~~LV~PRvlA~~  158 (267)
T COG0767          79 QGYTQLRDFGAEDFSGFLVALSLLRELGPVLTALVVAGRVGSAITAEIGAMRITEEIDALEVMGIDPISRLVAPRVLAGV  158 (267)
T ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             99999998089999999999999999878999999985338899999812669889999998577943888788899999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHH
Q ss_conf             99999999999999999999999861139899999999861699999999999999999999983177045598658999
Q gi|254780138|r  265 ISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGK  344 (373)
Q Consensus       265 i~~p~L~~~~~~~~i~gg~~~~~~~~~i~~~~f~~~~~~~~~~~d~~~~~~K~~~fg~~i~~i~c~~Gl~~~~~a~~VG~  344 (373)
T Consensus       159 i~~plL~~l~~~~gi~GG~~v~~~~~gi~~g~f~~~l~~~v~~~dv~~g~iKa~~fg~ii~li~cy~G~~~~gg~~gvG~  238 (267)
T COG0767         159 IVLPLLTALADAAGILGGYLVAVFLLGISPGAFLSRLQTFVGPEDVLIGLIKAPVFGVIIGLIGCYYGYTVGGGPEGVGR  238 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHEEEECCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCEECCCCCCHHHH
T ss_conf             99999999999999850250014441798689999998625899999999999999999999996647102899552737


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999999999999999999985089
Q gi|254780138|r  345 KVTTCVVQSISIVIIIDSLFAIFYFAIGI  373 (373)
Q Consensus       345 att~aVV~si~~ii~~d~~~~~~~~~~gi  373 (373)
T Consensus       239 att~sVV~s~~~v~~~d~v~t~~~~~~~~  267 (267)
T COG0767         239 ATTRSVVTSILVVIVLDFVLTALMFGVGI  267 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             76589999999999999999999845689