HHsearch alignment for GI: 254780138 and conserved domain: TIGR00377

>TIGR00377 ant_ant_sig anti-anti-sigma factor; InterPro: IPR003658 An anti-sigma factor antagonist is an anti-anti-sigma factor, which relieves inhibition of sigma factor activity by the anti-sigma factor. Examples include the Bacillus subtilis SpoIIAA protein, which, in its phosphorylated form, acts as an anti-anti-sigma factor to relieve SpoIIAB inhibition of sigma F; and the anti-sigma B factor antagonist, RsbV, which counteracts the RsbW-mediated inhibition of sigma B by binding to RsbW.; GO: 0045152 antisigma factor binding, 0006355 regulation of transcription DNA-dependent.
Probab=96.03  E-value=0.023  Score=35.26  Aligned_cols=87  Identities=15%  Similarity=0.365  Sum_probs=69.6

Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHH---HCCCCCCCCCCCHHHH
Q ss_conf             5882799984035635522007999986431167880899701051521299999999997---5187643158991269
Q gi|254780138|r    3 ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME---KYHGKIKLQGVSTHIE   79 (373)
Q Consensus         3 ~dG~~vL~LsGdWTl~~l~~l~~~l~~~L~~~~~~~~i~iDls~i~~lDTAGA~lL~~l~~---~~~~~~~~~~l~~~~~   79 (373)
T Consensus        10 ~~~~~~~~~~g~~d~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~   89 (109)
T TIGR00377        10 QGGVLVVRLSGELDAHTAPALRELLTPLAERGTGIRPIVLDLEGLEFMDSSGLGVLLGLYKQVKRNGGELVLVGLSPRVA   89 (109)
T ss_pred             CCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHH
T ss_conf             37556887425323301688999988876215776514775056431110037999999888751786079960766788


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999886422
Q gi|254780138|r   80 QLFSLISFTH   89 (373)
Q Consensus        80 ~Ll~Ll~~~~   89 (373)
T Consensus        90 ~~~~~~gl~~   99 (109)
T TIGR00377        90 RLLEITGLLD   99 (109)
T ss_pred             HHHHHHCCCC
T ss_conf             8998713100