HHsearch alignment for GI: 254780138 and conserved domain: TIGR02886

>TIGR02886 spore_II_AA anti-sigma F factor antagonist; InterPro: IPR014237 This represents the anti-sigma F factor antagonist, also known as stage II sporulation protein AA. This protein is universally conserved in the endospore-forming bacteria, all of which belong to the Firmcutes.; GO: 0045152 antisigma factor binding, 0006355 regulation of transcription DNA-dependent, 0030435 sporulation.
Probab=97.74  E-value=7.7e-06  Score=59.57  Aligned_cols=86  Identities=19%  Similarity=0.387  Sum_probs=73.4

Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHH-HH--HHHCCCCCCCCCCCHHHH
Q ss_conf             588279998403563552200799998643116788089970105152129999999-99--975187643158991269
Q gi|254780138|r    3 ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM-YF--MEKYHGKIKLQGVSTHIE   79 (373)
Q Consensus         3 ~dG~~vL~LsGdWTl~~l~~l~~~l~~~L~~~~~~~~i~iDls~i~~lDTAGA~lL~-~l--~~~~~~~~~~~~l~~~~~   79 (373)
T Consensus         6 ~~~~L~Vrl~GELDHH~aE~~R~~i~~~i~~~-~~~~~ilnL~~vtFMDSSGlGVilGRYK~i~~~gG~v~v~~v~p~vk   84 (106)
T TIGR02886         6 KGDVLIVRLSGELDHHTAEEVRRKIDDAIERR-PIKHLILNLKNVTFMDSSGLGVILGRYKKIKQEGGEVIVCNVSPAVK   84 (106)
T ss_pred             ECCEEEEEEEECCCHHHHHHHHHHHHHHHHHC-CCCEEEEECCCCCEEEECCCCEEEEEEEEEEECCCEEEEECCCCCCE
T ss_conf             18889999861004467899999999898507-98368986277647865122101110357730688898972993110


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999886422
Q gi|254780138|r   80 QLFSLISFTH   89 (373)
Q Consensus        80 ~Ll~Ll~~~~   89 (373)
T Consensus        85 r~felSGlFk   94 (106)
T TIGR02886        85 RVFELSGLFK   94 (106)
T ss_pred             EEEECCCCCC
T ss_conf             0011148750