>cd07042 STAS_SulP_like_sulfate_transporter Sulphate Transporter and Anti-Sigma factor antagonist domain of SulP-like sulfate transporters, plays a role in the function and regulation of the transport activity, proposed general NTP binding function. The SulP family is a large and diverse family of anion transporters, with members from eubacteria, plants, fungi, and mammals. They contain 10 to 14 transmembrane helices which form the catalytic core of the protein and a C-terminal extension, the STAS (Sulphate Transporter and AntiSigma factor antagonist) domain which plays a role in the function and regulation of the transport activity. The STAS domain is found in the C-terminal region of sulphate transporters and bacterial anti-sigma factor antagonists. It has been suggested that this domain may have a general NTP binding function.

Probab=97.35 E-value=0.001 Score=44.69 Aligned_cols=87 Identities=18% Similarity=0.306 Sum_probs=70.2 Q ss_pred CCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHH---CCCCCCCCCCCHHH Q ss_conf 858827999840356355220079999864311678808997010515212999999999975---18764315899126 Q gi|254780138|r 2 SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK---YHGKIKLQGVSTHI 78 (373) Q Consensus 2 s~dG~~vL~LsGdWTl~~l~~l~~~l~~~L~~~~~~~~i~iDls~i~~lDTAGA~lL~~l~~~---~~~~~~~~~l~~~~ 78 (373) T Consensus 6 ~~~~v~i~~~~g~LfF~~~~~~~~~i~~~~~~~~~~~~vvld~~~v~~iD~s~~~~L~~~~~~~~~~g~~l~~~~~~~~~ 85 (107) T cd07042 6 EPPGVLIYRIDGPLFFGNAEYFKDRLLRLVDEDPPLKVVILDLSAVNFIDSTAAEALEELVKDLRKRGVELYLAGLNPQV 85 (107) T ss_pred CCCCEEEEEECCEEEEEEHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHH T ss_conf 68988999956706761799999999998715899729999984998547599999999999999779999998098799 Q ss_pred HHHHHHHHHH Q ss_conf 9999988642 Q gi|254780138|r 79 EQLFSLISFT 88 (373) Q Consensus 79 ~~Ll~Ll~~~ 88 (373) T Consensus 86 ~~~l~~~g~~ 95 (107) T cd07042 86 RELLERAGLL 95 (107) T ss_pred HHHHHHCCCH T ss_conf 9999986997

HHsearch alignment for GI: 254780138 and conserved domain: cd07042