BLAST/PSIBLAST alignment of GI: 254780138 and GI: 254693733 at iteration 1
>gi|254693733|ref|ZP_05155561.1| hypothetical protein Babob3T_03544 [Brucella abortus bv. 3 str. Tulya] Length = 391
>gi|261214007|ref|ZP_05928288.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] Length = 391
>gi|260915614|gb|EEX82475.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] Length = 391
 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 229/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLAALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389